<?xml version="1.0"?>
<TEI xmlns="http://www.tei-c.org/ns/1.0" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://www.tei-c.org/ns/1.0 http://digital.lib.ecu.edu/tei/xsd/tei_P5.xsd">
  <teiHeader>
    <fileDesc>
      <titleStmt>
        <title>
        </title>
        <author>
        </author>
        <respStmt>
          <resp>Text encoded by</resp>
          <name>Digital Collections</name>
        </respStmt>
      </titleStmt>
      <publicationStmt>
        <distributor>East Carolina University. J. Y. Joyner Library</distributor>
        <address>
          <addrLine>Digital Collections</addrLine>
          <addrLine>Joyner Library, East Carolina University</addrLine>
          <addrLine>East Fifth Street, Greenville NC 27858-4353 USA</addrLine>
        </address>
        <date>2012</date>
      </publicationStmt>
      <sourceDesc>
        <bibl>
        </bibl>
      </sourceDesc>
    </fileDesc>
    <encodingDesc>
      <samplingDecl>
        <p>All quotation marks retained as data.</p>
        <p>All end-of-line hyphens have been removed, and the trailing part of a word has been joined to the preceding line.</p>
        <p>All smart quotes have been converted into straight quotes.</p>
      </samplingDecl>
      <classDecl>
        <taxonomy xml:id="LCSH">
          <bibl>Library of Congress Subject Headings</bibl>
        </taxonomy>
      </classDecl>
    </encodingDesc>
    <profileDesc>
      <creation>
        <date>
        </date>
      </creation>
      <langUsage xml:lang="en-US">
        <language ident="en-US" usage="100">English</language>
      </langUsage>
      <textClass>
        <keywords scheme="#LCSH">
          <list>
            <item>
            </item>
          </list>
        </keywords>
      </textClass>
    </profileDesc>
  </teiHeader>
  <text>
    <body>
      <div type="other">
        <p rend="align(centerbold)">[This text is machine generated and may contain errors.]</p>
        <pb facs="00096780_0001" />
        <p>tLt'-:: .. </p>
        <p>^ V  ;j</p>
        <p>^ \/  '  %v    *  M  '</p>
        <p>THE DAILY REFLECTOR</p>
        <p>06lhYEAR NO. 279</p>
        <p>GREENVILLE. N.C.</p>
        <p>TRUTH IN PREFERENCE TO FICTION</p>
        <p>SUNDAY MORNING, NOVEMBER 22,1987</p>
        <p>92 PAGES</p>
        <p>PRICE 75 CENTS</p>
        <p> ^</p>
        <p>an, Democratic Leader Urge Budget-Cut OK</p>
        <p>'   _  .  j  1*1   A____maaaU ^%m trAl cf/\o1* o fi/am/f an/l An</p>
        <p>By W. DALE NELSON Associated Press Writer</p>
        <p>Reagan ordered $23 billion in Gramm-Rudman cuts late Friday, althou* crat alike, ongr^ has 10 days to prevent the cuts from taking effect by adopting the  United Sta</p>
        <p> : ...u:..k .......lA nluuiF MA Killinn Fhie fisAal var anH 4A hillinn  Dl&amp;gt;liven</p>
        <p>I, must work on to reach^ vital goal: a sound and enforceable</p>
        <p>United States budget.</p>
        <p>SXhisdio.ddssU..drfe^.ftos.^^ mLuxntant sten forward  I  hos  economy.  Despite stock mariiet fluctuatums, d^pite all you may have</p>
        <p>delivSng his weekly radio address fromjte Oval Offiw, Mid,  heard to the contrary, he Mid, the truth is the Amencan economy remains  ^  ^  _______</p>
        <p>^i&amp;amp;^2 reports of gloom and doom to the contrary, please take getatthe^3^thed^dtso i^ont gw</p>
        <p>them^afflS^^  Weve never gone this far before, he said.</p>
        <p>"IflKuSSaSSna.'theSenateBudgetCommittee^  Nevertheless,  the  presideni  smd,  wlp the st m^et plunged last -(^rtainly this agreement sh(^ we havent mute sh^en^^^</p>
        <p>the  nackaue  fiood  news far the nati^ Mying, We should have  monti, it became clear that the time had amie for dramtic action.  ^  altogether, the bu^et chairman cautiwied. It s a hard habit to w^,</p>
        <p>dtete bettei Butthemwiey wedidMveisreal. No gimmicks, no accounting After outlining Fridays agreement, he Mid, W^effoi^ to cut the deficit especially since weve practiced it for so Im^. But at least now we re ^tting tricks n^oke no mirrors.  *  further  must  certainly  continue,  this  agreemMtwiMnd  the  i^tmesMge  at  our  act  together.</p>
        <p>CU'ICUA'a  *va MIVVVWAM^.</p>
        <p>tiie firet time in years that Congr^ and the president were able to reason</p>
        <p>____________   together to reduce the fi^ral deficit.  ^  ^  .  u.*</p>
        <p>the truth is the American economy remains  Its been hard work, he Mid. Its^ thing to cut a tre^own to size, but</p>
        <p>its a lot tougher to get at the roots. And thats what weve been trying to do-*k_  ltA  jWaF  en  F umnF artva hark </p>
        <p>tricks, no smoke, no mirrors.</p>
        <p>Congressional approval.oi uie pa  uy uu uicona w;im.ui. j ReduuicaiiB prefer the automatic cuts of the Gramm-Rudman deficit-re-duetion law to the $9 billion in new taxes in e first year of the compromise imckage *  i.</p>
        <p>Fha,rM  The  agreement  will  have  its  critics,  he  said.  But  it should r^ the</p>
        <p>^SS.dS&amp;amp;aiidtaaspiritofco(eraaon,UieUm^  mmbrfskepUcs  who  thought  Congress  aid  the  White  Hou^</p>
        <p>Msen to act, the president said. Now each of us, Republican and Demo- together.</p>
        <p>chosen to act.</p>
        <p>GOP Governors Avoid Mecham Issue Stance</p>
        <p>i*:|iLu - AU six of the major: hop^afi met Saturday a New</p>
        <p>Rev. Jesse Jackson, and Gov. Mmad Dukakis of Hanachnsetts. All six joined hands ioHowing their speeches at 0ie convention on Saturday. (AP Laser-photo)  -"t</p>
        <p>By DONALD M. ROTHBERG APPoUtical Writer SANTA FE, N.M. (AP) -Republican governors shied away</p>
        <p>troubles^of GOP Gov. Evan Mech^ of Arizona-as they opened a meeting expected to mix presidential politics with (^ussimis of the economy and education.</p>
        <p>I dont think we should take any position whatsoever, Mid Gov. Thomas H. Kean of New Jersey, when asked if the governors might consider a resolution offering an endorsement of Mecham, the object of a recall campaign and a grand jury investigation.</p>
        <p>Were not going to get involved in tbuiwliftiM oi a particular state, added Kean, the chairman of the Republican Governors Association. Gov. Garrey Carruthers of New Mexico, the host of the conference. Mid 1 (fid not believe Me&amp;lt;*ams problems wore having any affect on</p>
        <p>Republican governors in other states.</p>
        <p>Kean, Carruthers and Gov. Michael Castle of Delaw^, vice chairman of the associati(Mi, participated in a press cimfmence opening the meetii^.</p>
        <p>The three governors also withheld any detailed comment on the budtot compromise announced Friday by President Reagan and congressional leaders.</p>
        <p>A lot of the agi^ment is still very, very fuzzy, Mid Kean.</p>
        <p>Mecham was planning to attend the conference and there was an uneasy feeling that he might ask his R^itolican colleagues ffH* a vote of confetele.</p>
        <p>Youll see governors hiding behind potted patans in the lobby if thats the case, said Michelle Davis,</p>
        <p>(SeeG0P,A-2)</p>
        <p>Mayor-Elect Denies Telling AIDS Joke</p>
        <p>By ROGER PETTER)N iMclated PreM Writer A river of icy air flowing out of ftorth-central Canada dragged temperatures below the freezing mart Saturday as far south as Alkbama as it spread up to 14 inches of snow from the Great Lakes to the East Coast.</p>
        <p>Baltimore canceled its Thanksgiving Day parade because of the</p>
        <p>4:</p>
        <p>Grips T South</p>
        <p>weather. Snow and ice on highways contributed to hundreds of traffic ac-</p>
        <p>In northern Vermont, wind blowing at IS to 30 mph and temperatures predicted to range as low as zero overmght could make it feel like 40 desees below zero, the National Weather Smvice cautioned.</p>
        <p>The cold air was pulled out of Canada like a wet sheet through a wr-</p>
        <p>ingor by the combinaticm of the clockwise spin of a high pressure area over the BliMMippi Valley and a low pressure center spinning counter-clockwise south of Nova Scotia, the weather service Mid.</p>
        <p>Snow fell along the southern edge it likes,</p>
        <p>of the Great Lakes, the upper Ohio Valley, the central Appalachians, nortfaieni Vermont and upstate New York. It was the first snow of the</p>
        <p>Troopers Say Contractors iRequested Patrols On 264</p>
        <p>season across large parts of Ohio. Traces of snow were reported in the Appalachians as far south as Roanoke, Va., and Bristol, Tenn.</p>
        <p>The l^w^oe ski resort at an elevation of over 4,000 feet in West Virginias mountains got 14 inches of snow in 24 hours, with a low of just 3 degrees, and the isolated town of Pickens about 20 miles away got 10 inches. Up to 8 inches of snow fell overmght in northeastern Ohio and northwestern Pennsylvania, and 7 inches fell at Fabius, N.Y., southeast of Syracuse.</p>
        <p>East of the MiMissippi, only Florida had early morning</p>
        <p>(See BITTER. A-2)</p>
        <p>ByCUYDEANHARDT Reflector Staff Writer</p>
        <p>Greenville Mayor-elect Edward E. (Tarter ^nied Satunfiiy that he made an AIDS joke at a public meeting in Greensboro on Tuesday.</p>
        <p>I diit make an AIDS j&amp;lt;*e. I dont think its worth any comment. Im real busy about getting this city together and thats all I have to My, (Tarter said.</p>
        <p>AccxNTding to media reports, at least two North Carolina mayors My (Tarter made the j(^e during tte (piestion and answer piM of a panel discizssion on Poutics and the Media.</p>
        <p>Carter was elected mayor two we^ ago following a campaign in which racial and ethnic jwes attributed to incumbmit Mayor Les Garner became a campaign issue.</p>
        <p>When contacted Saturday Garner said he had no comment on the situation.</p>
        <p>Carter said he did not know how his remarks at the Gremistero meeting could have been misunderstood.</p>
        <p>D.D. Garrett, incident of the Pitt County NAACP, Mid it was unfortunate that the story had broken at this time.</p>
        <p>Two days ago I talked with mayor-tect Carter and asked him abcmt the story and he vriiemently denied the story and Mid he was misquoted, Garrett Mid.</p>
        <p>If he did My it, it was in poor taste and he should not have said it. He said he didnt (make the j^e), and thore was a witness who said he did, so I dont know.</p>
        <p>Councilman-elect Rufus Huggins said he didnt think Carter made the</p>
        <p>Ed is not the type of pmson to make that type of statement in that manner. In my c&amp;lt;mvaMtions with him he Mid be is trying to get away from that kind of thing, Huggins said.</p>
        <p>He Mid he did not think witnesses had quoted Carter exactly, and that they were simply giving an impression of what they thought be meant</p>
        <p>(Touncilwoman Lorraine Shinn said Saturday morning she would iipi comment on the reports. She Mid sne bad been out of town ail week and was not familiar with the incident.</p>
        <p>Other (Tity Council members could not be reached for comment</p>
        <p>iW CAROL TYER Reflectori</p>
        <p>T Staff Writer tt it against the law to drive on a section (fiM^ay that is barricaded wl^ under construction. The charge for violating the law is entering a ControlledacceMhiahway.</p>
        <p>Pe(^ who use^ section of U.S. 364 between Greenville and Farm-ville prior to its being opened to the public Monday apparently did not know they were in violation or felt that it wasnt a law that was likely to be enforcd, S|t C.E. Pearce of the N.C. Highway patrol Mid.</p>
        <p>But last Thursday through Sunday, tickets were written for between 40 aqd 80 drivnrs on the nearly-Gompl^ roadway. Most of them er directed to appear in District Court Tues^.</p>
        <p>The tnx^ers went out there to patrol at the request of the contractor</p>
        <p>and the state inspectors, Pearce said. The contractor was paying a penalty for every day he had gone past Ms Oct. 15 deadune and people were riding on the highway hampering his woriiers and that of the inspectors.</p>
        <p>Trooper J.R. Letchworth Mid he understands that the crowning blow to the contractor came when his workmen discovered Thursday morning that someone had torn up about ^eet of a miedian with a four-wheel drive vehicle some time after they left work on Wednesday. Law edr forcement was called in, he Mid.</p>
        <p>Letchworth said he probably wrote about 25 of the tickets issue(! Saturday and Sunday.</p>
        <p>Almost everyone I stopped told me they were just curious about the new road, be Mid. I could see bow they felt, but the road was clearly</p>
        <p>barricaded at each entrance and people knew they werent supposed tobeonit. He Mid one of the people he arrested damaged a section of meclian when he attempted to turn around after having spotted Letchworth writing another ticket.</p>
        <p>Letchworth Mid there was work going on throughout the weekend as the contractor tried to complete the roadway and turn it over to the state  r to the announced Monday open-</p>
        <p>prior t(</p>
        <p>inei</p>
        <p>I of those who received a ticket Mid she (fid not see aiw workmen on the two and a half mues she drove from the Stantonsburg entrance to hor planned exit near Pop Nichols Grocery. I wouldnt have driven on it if it hadnt looked finished and if Id seen anyone working, she said. I</p>
        <p>(See PATROLS, A-2)</p>
        <p>h'Netl Still In Intensive Care</p>
        <p>BOSTON (AP) - Former House Speaker Thomas P. Tip ONeiU was moved from intensive care to a</p>
        <p>operation Wednesday to remove a cancerous tumor about the size of a  __________________________ golf baU from Ms rectum. He also reprivate room Saturday at Brigham  ceived a permanent coloatomy,</p>
        <p>and Womens Hospital, where he is  wMch grovides an artificial route for</p>
        <p>recuperating firom bowel cancer surgery, a spokeswoman Mid.</p>
        <p>I Hes in good conditioo, said lUtMeeBODooneUoftheho^tal.</p>
        <p> ONeill, 71. underwent a W4-hour</p>
        <p>I-..</p>
        <p>oeiccai</p>
        <p>On Friday, Dr. Richard E. Wilson, the hospital^s chief of surgical oncology, said test results showed tbs operation had removed al| the</p>
        <p>cancer, eliminating the need for further treatTMnt for mat problem.</p>
        <p>Wilson also said ne expected surgery would be scheduled for a non-cancerous prostate problem late this week or around Dec. L</p>
        <p>ONsiU retired in January after 34 yeait in (Tongress, the final 10 as speaker. He keeps an office in Boston and lives on Chpe Cod with Ms wtfe, Mlldrad.</p>
        <p>READING DAY - Storytelliiig. face pabiting. clewis and tinging were part if Osnneding the Generations Through Reading events held Saturw day at Ouelina East MpU. The goal for the day was to have at leait 3M children attend and take part in</p>
        <pb facs="00096780_0002" />
        <p>1^ nioiww&amp;gt;iiiQtor.Qw&amp;gt;iwtw.N.a ) ' </p>
        <p>Obituaries</p>
        <p>Bitter Cold Took A Firm Griji On South</p>
        <p> -i</p>
        <p>^  Byaam</p>
        <p>- FARIIVILLE - Mr. George Itm dted Satuntoy in Pitt Com IlnMrial Hospital. Arrangements ire ineomplete at Joyners Mortuary.</p>
        <p>I  Di*oo</p>
        <p>t AYDEN-A ftmeral for Mr. Semilie Dixon of 822 Venters St. will be Sonducted Tuesday at 2 p.m. at little Onircli of Oirist. Disciples of 4anrist Church, Route l,Aj"</p>
        <p>lader Clifton Howard. Interment Mhm in the Ayden Cemetery.</p>
        <p>Mr. Dixon was born and lived most af his hie in and around Ayden. Heat-blended the Pitt County schools. He bias a inember of Little Creek Church if Christ, Disciples of Christ Church, Se Zkm Hill Christian Aid Lodfe No. 8 and was a retired postal empbwee.</p>
        <p>He is survived Iqr his wife, Ethel</p>
        <p>Mae Younger Dixon of the home ; one son, Hotert E. Dixon of Ayden; two dmmhters, Willie Mae Dixon Smith of Kimrfiw and Dekris Jean Dixon Newkirk of Baltimoie; one brother. Brace Dixon of Ayden; five sisters, QoyneD Dixon Hurney and Rupy Dixon Strong, both of Ayden, Jesse Dixon Mills of Winter^ Edith Dixon Spivey of Newark, N.J., and Etta Lee Dixon of Grifton; eight grandchildren, and 11 great-grand-ddldreiL Hie body will be at Norcott Memorial Chapel in Ayden from 6 pjn. Monday until carried to ttie dliurch one hour before the funeral. The family will recave friends from 7p.m. to I p.m. Monday at Norcott Funeral Honw in Aydoi and at oHier times win be at the home.</p>
        <p>Gay</p>
        <p>GRIFTON - Mr. James Robert Gay of 115 South St died Satnday in Pitt County Memorial HoepitaL Ar yangenents are incomplele at No^ cott and Company Fhneral Home in Ayden.</p>
        <p>I  Graham</p>
        <p>^ Mr. L. James (Jim) Graham, II, JtedFridayatldshome.</p>
        <p>His ftmeral win be conducted Mon-liy atlfajn. intheFiritPreM ^ Church by the Rev. Dan wnhen. 'teial win be in Pinewood Memorial Ml.</p>
        <p> A native of State Goneg^ Pa., Mr. .Graham received Usbaodoris and masters degrees in bhidiHnkitnr fkom Penn State Univenily. He HlNved to (SreenviUe in lin and w wnmloyed as a biodiemist with Bar Mb WenconM from IM to m Jktttie time of his retirement, he was</p>
        <p>superintendent of sterile products manufacturing department. After retirement, he was a consultant to SterileProductsManufacturingCo.</p>
        <p>Mr. Graham was a member of Crown Point Masonic Lodge No. 708, and a 32nd degree mason in the New Bern Scottish Rite Bodies, the Provost Guard of the Sudan Ten^ in New Bern, and the Pitt County Shrine Chib. He was a past presklent of Parenteral Drug Association, a member of the Burroughs Wellcome Retirenient Group, members of the</p>
        <p>(COntfawedfromA*!)</p>
        <p>temperatures as warm as the SOB, but a warning of freesins temneratures</p>
        <p>board of directors of the United Wai and the Pitt CounW Memorial Hospital Foundation, a former member of</p>
        <p>the Greenville Host Uoos (3ub, member of the Pitt (tolden K Kiwanis aub and Mended Hearts, Chapter No. 23. He was a member of the First Presbyterian Church.</p>
        <p>Surviving are his wife, Rose Mary (toaham of the home, and his sister, Kitty (toaham Rosriierry of State College,Pa.</p>
        <p>The famUy will receive friends at Wilkerson Home from 7 p.m. to 9</p>
        <p>Sm. Sunday. In lieu of flowers the suggests memorials may be made to the First Presbytian Church or the charity of ones choice.</p>
        <p>I</p>
        <p>Johnson</p>
        <p>A funeral for Mr. Lewis June Johnson Jr. will be conducted at 3</p>
        <p>and pose little threat to crops.</p>
        <p>In nortlKentral Alabaina, Pinson had a record low of 21 degrees, the weather service reported. In Misris^, Biloxi on the Gulf Coast was the only official reporting station that did not hit freezing.</p>
        <p>Other record lows included 8 at Binghamton, N.Y.; 18 at Newark, N.J.; 14 at Scranton, Pa.; 9 at SyraciBe, N.Y.; 18 at Hartford, Conn.; 10 at Worcester, Mass.; and 19 at Providence, R.I. At 2 p.m..</p>
        <p>MontpeUer, Vt., had a rwding of only 7d^ees.</p>
        <p>By contrast, Williston, N J)., had a record high of 58 degrees in the afternoon. Temperatures were even warmer along me eastern slm of the Colorado Rockies, where Pueblo readied 73 degrees.</p>
        <p>The aisrui^ drop in temperatures meant the workday began before dawn Saturday for Morey Gurnee of National Heating Service in Buffalo, N.Y., when people with faulty ftir-naces began calling.</p>
        <p>They began at 4 a.m., said Gurnee. There are too many calls. We cant handle all d them.</p>
        <p>The force of all that air blowing toward the southeast pushed water across Chesapeake Bay, dropping</p>
        <p>water levels .2 feet on the shore of the bay and m the tidal Potomac River, the weateser^ said. In Washington, wind gusted to SOmphormore.</p>
        <p>Waves of fierce snow squalls, rated by brief periods of ams^. and the cold Gombined m Maiyland</p>
        <p>to cause hundreds d traffic acddoits</p>
        <p>and force the temporary closure of several Interstate Mghways around Baltimore and the cancellation d</p>
        <p>if Hieflurrierleftbehindoa^y^ItoJ</p>
        <p>, inches dsnpw,^btoNh2^</p>
        <p>GOP Governors</p>
        <p>etoy.</p>
        <p>He was a Pitt County native and spent most d his life in Greenville. A World War H veteran, Mr. Jofansn was employed by the Greenville Tobecoo(to.for30years.</p>
        <p>Sorviring are a dau^der, Unda Taft d Greenville; a son, Carttan TaR d WashiiMton, D.C.; trial Gay NeD Johnson d New Yak, and ttaee oandcMldken.</p>
        <p>Hw family will receive viriton Sunday from 7 pin. to I pJiL at Planaiu Ftaal Cha^ to at ofirKes win beat lllOWardSt</p>
        <p>GOU) POINT - Mr. Levi</p>
        <p>Saturday in Marlin GBMly General Hosp^ Arranienaenli wffl be aonounced by Ranagan ftenl Home in Greenville.</p>
        <p>gpeHman Ibi. Roa Nobka SriritoHi d</p>
        <p>494-A Darden Drive dtodSelii^ in Pitt County MesMrial HopBaL Ar lanflemenls wfll be anMinoed by FfamagraFkneralHouM.</p>
        <p>(ContfamcdfnmiA-l)</p>
        <p>executivedirector d the RGA.</p>
        <p>On the political front, Vice President Geoi^ Bush was regarded as the favorite d most governors in the race for the 1988 GOP presidential nomination. Bush and Rep. Jack Kemp d New York were scheduled to address the conference on Tuesday.</p>
        <p>BiBh ahready had the endorsements d (km. John Sununu d New Hampshire, Bob Martinez d Florida, Henry Bellmon d Oklahoma, James Hwmpson d Illinois and John R. McKernanJr.dMaine.</p>
        <p>Several other governors, including Carruthers, were considered almost certabi to end up in the Bush camp. In Iteas, (tov. William Clements was neutral but his wife and a top aide were working for Bush.</p>
        <p>Senate GW lesder Bob Dole had the endorsement d home state (tov. Mfte Hayden d Kansas and Gov. GeoBelOckrisondSoiith Dakota.</p>
        <p>Gov. Michael Castle d Delaware was backing Pete du Pont, his predeooavasstatechief executive.</p>
        <p>Hie formal agenda fa the con-fcrcnoe inclnded discuBrions d the econonfe, education and the fiiture d the Rcpnfican Party as the Reagan presidency enters its final year.</p>
        <p>CMlle, scheduled to succeed Kean asdinimiandtfaeRGA,8aidtliel4 GOP gsvenon repnsent states that hrid a an^M in the electoral col-</p>
        <p>approach, so say you are just not going to raise taxes.^</p>
        <p>Castle said governors are diarac-terized by a need to take pragmatic aiqMToadies to problems and have been wUhng to increase taxes when theyve had to and make budget cuts when theyve had to.</p>
        <p>Since he was elected governa d Arizona in a stunning u^ in 1986, Mecham has been caught in a stom of self-generated controversy.</p>
        <p>One of his first acts as governa was to cancel a state holiday hona-ing the Rev. Martin Lutlwr King Jr. Otha incidents followed and a recall drive was launched that succeeded in collecting 388,988 signatures, more than twice the numba needed to force an election on whetha Mecham oujt to be rmoved from office.</p>
        <p>Former Sen. Barry Gddwater d Arizona has called on Mecham to</p>
        <p>resign.</p>
        <p>In addition to those controversies, a state grand jury is investigating a posriUe codlict d interest invdving a $350,000 unreported loan to Me^ams campaign tw a man who was the target d a racketeering suit filed Iqr the state.</p>
        <p>service meteorologist.</p>
        <p>Baltimore Police said they had received reports d at least 200 traffic accidents when tiiey stopped counting.</p>
        <p>Patrols</p>
        <p>(CoRtinaedfromA-l)</p>
        <p>knew I wasnt supposed to get on it at aU, but I reaUy Mt think I was doing anybody any harm.</p>
        <p>She admitted the time she was given a ticket was not the first time she had used the roadway. I really didnt know I was doing anything illegal, slie said.</p>
        <p>^t. Pearce said that the law, Im beUeves, is written not only fa the ootection d the contracta but fa the prdection d the public. Ive seal hoivy eqidiunent that a tarii couldnt budge Idt ri^t out in the middle d the roadway, he said. And its the contractors r#t to leave it there. When the road is clos^ ed, its his territory, not the publics. But if anyone hit one d those things, theymightnotlivetoteUit Trooper Letchworth said he understands the same kind d thing is happeniiui on the section d U.S. 264 beteir^^ville and Washington. The coidractor is briiind on his contract there, too, he said, and hes not gdng to Imve a lot d j^tienoe with pe^ driv^ on ttie road. Hdtets may be given there, also, according to the trooper.</p>
        <p>Felice Sgt. Steve ReynoWs said^</p>
        <p>MOW mtol wtottUt tewrito</p>
        <p>imyi^ areas and then froze when ii washitbythecddair.</p>
        <p>Philadelphia sent teams d pottre</p>
        <p>and social service woriters oik Friday night to dfa shelter to hometea</p>
        <p>peopleoncitystreets.</p>
        <p>On Friday, roads covered era snow and ice were blamed fa hnn-</p>
        <p>dreibdtraffic accidente in Ohio, and a section d Interstate 70 was dos^ temporarily because d ice and</p>
        <p>Ive got eight troopers out then ling from .</p>
        <p>___________ loH^</p>
        <p>PatrdU. H.J. CallahanatMedna.</p>
        <p>theyre running from one acd-ttottiei</p>
        <p>dent to fee next, said Ohio 1</p>
        <p>In Michigan, the snow alk^ three ski resorts to onen fa the</p>
        <p>Stot^^UUedatleerifr^</p>
        <p>*^*to?'mow*^f the season always causes accidente^Mk^ State Troopa Dan (toUlns said at Houghton Lake. Folks have to rO-learn how to drive in the sn^.*</p>
        <p>OtyHatBadnti</p>
        <p>JACKSON, MdL (AP)_i5l wDCh</p>
        <p>tad Jackson as one</p>
        <p>rated</p>
        <p>An ovoflow crowd d about 900 gave Landon Y. Jones Jr. a riandtog ovation after his address to nomk Chib d Jackson, in wUeh be admitted the recent Monqr svm was flawed but stepped dM d csJi-iraitinaccurate. ^</p>
        <p>hb most inmoriant tbtag Tfe learned is thatTie leedeni* here wants to make this an even betta commndty in the future, Joom said. The pride d a pliioe cannot bo underestimated a measured by a survey.</p>
        <p>The survey d Monqr readers rated Jackson the seventh-worst place to live out d 900 American dfies. The results prompted Ha J. Smith, pveei-dent of the Greater Jacuon Chamba d Commerce, to invite Jones totown for a first-hand look.</p>
        <p>Ineiimbents Fac9 Runofk In Im,</p>
        <p>By ALAN SAYRE Amokted Press Writer</p>
        <p>NEW ORUEANS (AP) - With</p>
        <p>intend wkhifraw from the</p>
        <p>ftchaOenga Pad--cincombentU.Qov, ^whfleteatte^.</p>
        <p>runoff, race.</p>
        <p>.    UriHrUwWWtdt^R^</p>
        <p>Reeman, Also on the bdtot ww a pnpoaed</p>
        <p>^----- sracewn   *</p>
        <p>PvirtnallyiBadeadfieat ^ With reports in from OW d the :;tetes sjn precinels, a abod 90 Cferced, Freeman tnM Haidy, a Pm secretary d state, 101,808 ^01 to 822I Hachad abod 55 ^peroedofffievote.</p>
        <p>% Attorney Gcoetd William Gate Clmd 87,574 votes to 86,014 fa 'CchaUenga Harra Connick, the tOrieansf^DiBtektAtto^</p>
        <p>^ 1 feel cautionriyoptimistie,^said ifter studbrud the early</p>
        <p>thatwodd</p>
        <p>retire the $5 umonptoi debt d 18</p>
        <p>pUbHe nIinnMd aydems ova </p>
        <p>sas&amp;amp;msin</p>
        <p>mlciegMMietaflBfmrttlhe</p>
        <p>SnFaS^^SSl</p>
        <p>todetenaespenlngandi-----</p>
        <p>censida tax increaaes to cd the dd-</p>
        <p>tett.  '</p>
        <p>baprwaniereaeeintenleiv,G-</p>
        <p>trssvss^</p>
        <p>they wbddnevaratee tans.</p>
        <p>*1ve always said neva say nava, sad the Delaware governa. flO^IwoddlUdL thats jnria wrong</p>
        <p>I Tlw mO of Sm iHi HqwRwd H.</p>
        <p>Qiy Sr. Mm to qmM Sito WVtortVton (or Sw food.</p>
        <p>Cwd Of Thanks</p>
        <p>Ths family of Ennb A. Coward of Vhdnia Baach. Virginia, wishes to express appredadon to afl of you who contrlbuled in any way to rist them and make their sorrows easier. God Mess you.</p>
        <p>Ihihy, Jaan it Jtanmy</p>
        <p>THANK YOU</p>
        <p>The family of Frank (Duke) Harris wishes to thank aO d their famibr &amp;amp; friends for every kind act shown them during the illness and deOh (rf their loved one. May God richly bless each and everyone.</p>
        <p>From the Family* Wifo.AiuiitK.Hafrit AChOdrmi</p>
        <p>ANOTEOFTHAHK8</p>
        <p>Wtm GRATEFUL HE^ TOE FAMn.Y OF THOMAS OAI^ WISHES TO thank All OF THEIR FRIENDS AND LOV ONES FOR every ACT  KINDNESS AND EXra^J OF SYMPATHY SHOWN DRWO HIS niNESS AND DEATH.</p>
        <p>MAY GOD BLESS YOU.</p>
        <p>THE OAKES FAMILY</p>
        <p>dwtag iw ttm of iito hw. May</p>
        <p>I God tichly bloM Mh and</p>
        <p>Thaakyow, Tha Family</p>
        <p>&amp;amp;</p>
        <p>I have one feeling - uncotain-^ty,Comiicksaid.</p>
        <p> In tiie</p>
        <p>^Mike ^lawya.</p>
        <p>$ Freeman, a Democrat seeking a ^IMid term, and Hardy both por :trayed themselvea during the runoff ^campaign u the candidate who can Nworit best with (tov.-elect Buddy ^Roona.</p>
        <p>He led the governas race in the 550d 94 primarv. causing (tov. Edwin</p>
        <p>Hardy, who recently swRehed to tiB Iteiiiibllean Pttto, WM an cesriUf candidato for govona in 1979.</p>
        <p>(toste, seeking a fifth &amp;lt; edinanacrimooioiRGa-, ComiiGk,wiaccuMd^ of miehandlinfl a State laWSUit</p>
        <p>against Texaco HBh</p>
        <p>incumbent also unsocceM^ tried to block Connick in oovt from</p>
        <p>|andhadl</p>
        <p>who had____________</p>
        <p>iright to run in Saturdays</p>
        <p>aco caw. Both candidates are Domo-crati.  .  ^</p>
        <p>McKritbm and Cntehaw. both Democrate. alio campaigned largely on Roemer^s themerf changhig state govcrnuBig.</p>
        <p>Abo Saturday, voters in five louffi LouUana parferiBS comktered offtrack horse race betting, white the fete of confrofverrial New Orieansp</p>
        <p>area sheriff Harry Lee abo was on thelkB.</p>
        <p>The DaOy Reflector</p>
        <p>hooipontod 209CotMidwStiMt QnmvBi. N.C. 27834 (919) 752-6166</p>
        <p>SMMdOMiFWItoiPWd AtGfMnvto. N C</p>
        <p>(USPS145dOOt</p>
        <p>AdMrtMtoOtadH..........JmyVanNiMMnd</p>
        <p>Plwmiii OtociM...............J. nm JofM*</p>
        <p>Ctotom Dtocto..............NWon Mm</p>
        <p>"wtfittrr  BbmJarvl*</p>
        <p>Pliblilwd Monday Ihrou^ Friday aUamoons and Sunday morning</p>
        <p>SubKriptton Rates Hmm dtowy by canlir a nntor louit. nonMytoOO</p>
        <p>Mali Rates</p>
        <p>HawdTO)Wn|WMnto&amp;gt;.......$500|Miniolh</p>
        <p>nUN.C..............16.50 pH monlh</p>
        <p>N.C..................16.50 per moMh</p>
        <p>Mtmbif AmqcMmI I^ms nd</p>
        <p>AitollnNMgiCbculMlon</p>
        <p>HOMESTEAD FUNERAL HOME AND MEMORIAL GARDENS</p>
        <p>Heres How lO Avoid A Costly Mistake</p>
        <p>Dear Friend;</p>
        <p>Would you IHte a sure way to provide yow family with greater piece of mlnd-ttoth emotioneHy and finaneialiy? Than I urga you to consider the wisdom of an everlasting family shrine once only the affluent could afford. It could be one of the moM bnpornnt deol-slons of your life.</p>
        <p>What Im talking about Is burial In aclean, dry. abovwwound mausoleum, which according to studies, 79% of Amertcant prefer but think they can't afford. I'd like to dispel that by provino how you and your family can have ali the advantagse of mwaoieum burial at a cost comparable to or lose then below-ground burial.</p>
        <p>Mausoleum Entombment Cost Comparable To Ground Burial</p>
        <p>Avarage Coat Of Single ^ Mausoleum Crypt In Pitt County - $4000.00</p>
        <p>Averege Cost of Ground Burial In Pitt County</p>
        <p>1-Burtel Space....................$600</p>
        <p>1-Veult...........................1750</p>
        <p>1-Merker Or Monument.............$600</p>
        <p>1-Open &amp;amp; Closing Grave.............$150</p>
        <p>No Plot, Vault, Marker. Monument Or Opening And Cloeing Grave Chargee.</p>
        <p>Single Crypt At Homettead Memorial Gardens As Low As</p>
        <p>Total Cost $1800.00</p>
        <p>Total Cost $1695.00</p>
        <p>Inflation proof advance funeral planning offered by Homaetead Funeral Home guaranteea todayt price whenever death oeouit. And by planning ahead, thosa you leva will be spared pidnful last minute decisions and emotional over spending that can ao aaally occur. This plan offers a vwlety of payment schedulet ranging from a tingle payment to a five or ten year payment plan.</p>
        <p>Funeral Home</p>
        <p>Memorial Gardena</p>
        <p>83(H)648</p>
        <p>830-1113</p>
        <p>AND MEMORIAL GARDENS</p>
        <p>I'm mMrtiitd in your 'Prt Nttd" program. PWaM contact ma with ful datath on tha Kama.</p>
        <p>Fva chachad balow I undaratand thara it no obkgailon</p>
        <p>Camafty 8mc  aHaeeetewa Crpple</p>
        <p>Cvstoatlaa NtctMS Faneral OMaeemeelOeidea PyAiraagatoa</p>
        <p>Rt. 3. Bok S4 Greenville. N.C. 27834</p>
        <p>Name.</p>
        <p>Addreaa.</p>
        <p>City.</p>
        <p>.State.</p>
        <p>.Zip.</p>
        <p>Phone.</p>
        <p>It s as inevitable as taxes, but don\ ask your CE\ about it.</p>
        <p>Itie two inevitabilities. When it comes Id questions about taxes most people don't hesitate to make plans and amingemente with their aooountanL But when it comes to the other inevitahility, itk amazing how few people make any arrangements at all And that's a mystery, considering the benefits to femily and fifends that funeral</p>
        <p>kived ones. And it takes very little time.</p>
        <p>' So if you'ie tax planning, ask your CPA or tax lawya. llie other inevitahility? Ask UK</p>
        <p>S.G. Wilkerson &amp;amp;Scms Pineuwd Menwrial Park</p>
        <p>7W-2IOI</p>
        <p>2100 E. 3th SC</p>
        <p>Greenville, MC-</p>
        <pb facs="00096780_0003" />
        <p>Mrs. Dukakis Outlines Husband's</p>
        <p>Program For Rural Development</p>
        <p>ByCLAYDEANHARDT ^ And ROSALIE TROTMAN</p>
        <p>Reflector Staff Writers ' Investing in America means investing in nnral areas, said the wife of a candidate for the Democratic nomination for president while discussing her husbands five-point development plan.</p>
        <p>"' Kitty Dukakis, wife of Mike Dukakis, said the programs her husband initiated as governor of Massachusetts could be carried over m the nation if he is elected president, f</p>
        <p>She spoke Saturday at a reception in the Willis Building in Greenvifle.</p>
        <p>' Mrs. Dukakis said the plan included Ininging working capital to rural areas; allocating federal help to</p>
        <p>train rural Americans for new jobs; investing in roads, bridges, sewers and water systems in smaller com* munities; providing technical assistance to rural entrepeneurs, and offering federal support for regional development.</p>
        <p>She said Dukakis is proposing the creation of a $500 million strate^c investment fund to make key investments in rural areas and to create jobs.</p>
        <p>Michael has been successful in helping rural economies in Massachusetts, she said. Ite can do it nationwide with creative differences and harnessing those differences in different r^ons of the country.</p>
        <p>Several times during her speech, Mrs. Dukakis referred to her husbands work as governor as evidence of his abiUty to lead the nation.</p>
        <p>Michael knows what it is to deal with deficits, she said. He inherited a $^ million deficit and turned it into millions of dollars in surplus. He knows how to balance buckets, hes done it nine times.</p>
        <p>She said, When Michael took office in Massachusetts our unemployment rate was at 11 percent across the board. We are now, and for the last 36 months have been, the state with the lowest unemployment rate of any industrialized state in the United States.</p>
        <p>She said Massachusetts has an unemployment rate under 3 percent.</p>
        <p>We have to make tough choices about spending, and that means reci^nizmg that pouring billions of dollars into Star Wars is not going to</p>
        <p>over ^ billion for a new missile, she said.</p>
        <p>KITTY DUKAKIS</p>
        <p>make it work. And that means choosing a stronger conventional defense</p>
        <p>Programs Said In Jeopaidy</p>
        <p>RALEIGH (AP) - If automatic federal spending reductions under the Gramm-Rudman budget-cutting law remain in effect. Norm Carolina ag^icies stand to lose $61 million in health, education and highway programs, officials say.</p>
        <p>; In North Carolina, only about $16 million of the Gramm-Rudman cuts vere scheduled to be spent by July 1, 1988tte end of the state fiscal year - according to deputy state budget offico' Marvin Dorman Jr. The otlr $45 million would come later, and its loss could have a significant impact on state services, he said.</p>
        <p>' Betweoi now and next June, I think we can make it by tightening our belts and making any necessary</p>
        <p>budget transfers that we have to, Dorman told the News and Observer of Raleigh.</p>
        <p>Although the White House and con-gressicmal leaders reached agreement Friday on a substitute plan to cut the federal deficit, that proposal faced strong opposition in Coi and President Reagan has or the automatic cute</p>
        <p>The $23 billion in spending cuts under the Gramm-Rudman law will be in effect until the measures outlined Friday can be translated mto legislation.</p>
        <p>ctrollna east mall</p>
        <p>grwmiwiw</p>
        <p>SUPER POWER, SUPER CLEAN, SUPER EASY, ALL THIS AND SUPER RESULTS CUISINART'S NiW "BASIC"</p>
        <p>FOOD PROCESSOR</p>
        <p>All the capacity and power of a full size Cuisinart food processor with the simplicity of use and ease of cleaning of a small food processor.</p>
        <p>SImpNfled feed tube and pusher make everyday food preparation fast and easy. FCill size work bowl holds over 1 quart of shredded cheese, salad fixings, or cole slaw. Con-vienent On/Off/Pulse lever for powerful, quiet Cusinart motor.</p>
        <p>Base takes up less counter space than an 8 square cake pan. Also Included are a 3 year warranty on the entire machine and an additional 17 years on the motor* Easy to use instruction booklet, step by step recipe booklet, and</p>
        <p>Cuislnart designed spatula. Three months' free membership in the Cuisinart Cooking Club with its monthly</p>
        <p>newsletter of useful tips and everyday recipes.</p>
        <p>Come by our demonstration booth In our housewares department and meet Ms. Patty Carter who will be demonstrating the Culalnart* food processors in our store on Friday, November 27th and Saturday, November 28th from 11:00 am to 3:00 pm.</p>
        <p>*89.99</p>
        <p>CUISINART BASIC-------------------- .SPECIAL</p>
        <p>CUISINART DLC10 PLUS............SPECIAL^I  1 9n99</p>
        <p>CUISINARTDLC8PLUS..............SPECIAL^I  99n99</p>
        <p>Shop Carolina East Mall, Qraenvllle, hrough Saturday 10 a.m. Until 9 p.m.</p>
        <p>Sunday 1:30 p.iri. Until 5:30 p.m.  Phone 756-B-E-L K (7562355)</p>
        <p>Monday</p>
        <p>Mrs. Dukakis also said the nation has to start collecting the billions of dollars in taxes that go unpaid each year. She said her husband believes that ^e government should crack down on those who dont pay taxes before levying additonal burdens on those who do.</p>
        <p>We have today the lowest compliance rate ever in the history of our country  81 percent. Nineteen percent 01 our fellow Americans are not paying taxes, and that doesnt count the underground economy.</p>
        <p>She said her husband was a firm supporter of universal health care and cMlucation, citing wwrk he has done in both areas in Massachusetts.</p>
        <p>State funding for education has gone up at all levels, she said. Funding for higher public education has gone up 250 percent during the last decade and state scholarship aid for our college students has increased five-fold in the last five yrars witlmut our public school tuition rates going up.</p>
        <p>She said her husband proposes a national teaching excellence fund, a new educational insurance fund for coUege students and a drive to fight insurance. He also wants to encourage college students to go into teaching throu^ scholarship aid, she said.</p>
        <p>In an interview after her speech, Mrs. Dukakis said she has been cam-;when</p>
        <p>Campaigning is very much a family effort - including our son and daughter-in-law, two daughters, Mikes mother, my father, sister and her husband and nieces and nephews, she said.</p>
        <p>Our son and daughter-in-law live in Atlanta and he is coordinating campaign efforts in the South. Daughter Andrea lives in Des Moines, Iowa, with her coUege roommates and they are campgn-ing. Kara, now a college freshman, took a year off and worked for about five months on the campaign before</p>
        <p>going to college, she Mid.</p>
        <p>Mrs. Dukakis was in Chapel Hill Saturday morning for a brunch given by Chancellor William Friday. She attended a tailgate party for cain-naign volunteers thare befcffe traveling to Jacksonville ioc a reception.</p>
        <p>Gov. and Mrs. Dukakis will be spending Thanksgiving in Massachusetts with K^a. We will be having Thanksgiving at my sisters - she will cook the turkey and we each will contribute other</p>
        <p>foods. There could be as few as 20 of</p>
        <p>us or up to 35. Four generations will be there. For the holidays in December, we will all be together, stiG sdici</p>
        <p>When asked what she considered the strongest thrust of being the wife of a presidential nominee, Mrs. Dukakis Mid, I know him better than anyone else and sect^y, I</p>
        <p>Fitness Finesse</p>
        <p>Center</p>
        <p>Holiday Specials</p>
        <p>7 Sonina UaHe. ^annin^ !3ecL</p>
        <p>The No Sweat Exercise 10 Visits for $60.00</p>
        <p>Wolff System 30 Visits For $60.00</p>
        <p>\a,ags</p>
        <p>DdL</p>
        <p>30 Visits For $60.00</p>
        <p>919*355*3181 214 Suite A. Arlington Blvd. Virginia Glenn, Owne, Greenville, N.C.  ___</p>
        <p>liusband was a candidate for the state legislature. He served fmur terms in that branch of government and has been governor of the state nine out of tte last 13 years.</p>
        <p>Mrs. Dukakis has been Mmpaign-ing on her husbands behalf as a presidential nominee for the past seven months.</p>
        <p>table with it. All of those are positives, she Mid.</p>
        <p>The negative is being away from my husband. We have a very close</p>
        <p>marriage and worked very</p>
        <p>together over the years. Its very ficult being away - I havent seen him on this trip since last Tuesday, she Mid.</p>
        <p>January 31st</p>
        <p>Based On 2 Nights</p>
        <p>For As Low As</p>
        <p>(Based On 6 People)</p>
        <p>07 p:in</p>
        <p>Call for Details</p>
        <p>reenville</p>
        <p>travel center</p>
        <p>200 Artlngton 8lvd. Suite M</p>
        <p>756-1521</p>
        <p>ank^Ying gale</p>
        <p>State officials were concerned about the cuts, but most Mid the impact wouldnt be diMSterous.</p>
        <p>pMlurepedics Umaat Priea Esarl</p>
        <p>$7994</p>
        <p>% AND MORE!?</p>
        <p>  *139</p>
        <p>Queen *379</p>
        <p>S *449</p>
        <p>Firm 15 Yeer Warranty</p>
        <p>BEDDING</p>
        <p>AilOeiMliig SoMln Setal Odd Piece* A*II*M* At Sevlno*</p>
        <p>"START AT</p>
        <p>ONLY</p>
        <p>CHOOSE TWIN, FULL, QUEEN, or KINO SIZE brass plated headboard. Many styles to choose from.</p>
        <p>WHILE</p>
        <p>SUPPLY</p>
        <p>LASTS</p>
        <p>BE0DING1 TRUNDLE UNIT PRICED SEPARATELY</p>
        <p>FRAME LINK SPRING</p>
        <p>THIS CLeOANT dyt&amp;gt;ed he* a turdy wiilte metal frame, slratght line styling. A brtghl new touchi</p>
        <p>WATERBEDS ON SALE NOW!</p>
        <p>BASIC WATERBEDS</p>
        <p>START AT</p>
        <p>SOLID PINE BOOKCASE WATERBED</p>
        <p>*99</p>
        <p>ANY SIZE</p>
        <p>OAK WATERBEDS</p>
        <p>!199</p>
        <p>&amp;amp;S0</p>
        <p>M69  ^^259</p>
        <p>'tMlUi mirror</p>
        <p>ANY SIZE  WW  only</p>
        <p>oomplett  2  Tier</p>
        <p>Cfffltpltte Water bed* Come With: 2 Mattreaaea, Heatar, Linar, Frama, FUI KH, CondlUonar t A LMetUna WatraiNyll Slmp Our Large Selection * are.</p>
        <p>ECONOMY STYLE FIRM^</p>
        <p>1 Year Warranty</p>
        <p>Twin Ea. PC..</p>
        <p>ST..........M39</p>
        <p>Baaic</p>
        <p>FIRM INNERSPRING</p>
        <p>S Year Warranty</p>
        <p>Twin</p>
        <p>Ea. PC.......</p>
        <p>Full</p>
        <p>Ea. PC......</p>
        <p>$49951</p>
        <p>.*59</p>
        <p>ST." M69</p>
        <p>Kina  252  Coil*</p>
        <p>^  *229</p>
        <p>Support</p>
        <p>LUXURY FIRM ^  ^  ^</p>
        <p>10 Year Warranty</p>
        <p>L"pc............</p>
        <p>Twin</p>
        <p>Ea. Pc............</p>
        <p>ST" *199</p>
        <p>Si  *249*  312  Coll</p>
        <p>............ Quilted  Cover</p>
        <p>Extra Firm</p>
        <p>15 Year Warranty</p>
        <p>Twin Ea. Pc..</p>
        <p>FuU</p>
        <p>Ea. Pc..</p>
        <p>Quaaa  $229**</p>
        <p>Sata.</p>
        <p>.*299*</p>
        <p>$11 cue</p>
        <p>VwyFInu</p>
        <p>PILLOWTOP  .-.-C --.vfHta</p>
        <p>LUXURY isrwwmnty</p>
        <p>79"</p>
        <p>*99*</p>
        <p>*259*</p>
        <p>312 Coll</p>
        <p>*349*</p>
        <p>Twin Ea. Pc</p>
        <p>SUPER FIRM</p>
        <p>20 Year Warranty</p>
        <p> *jg*,&amp;lt;*if'.</p>
        <p>ETpc *109*!</p>
        <p>*279*J</p>
        <p>SS *379" S</p>
        <p>EVERYTHING WE SELL IS 1ST QUALITY &amp;amp; FULLY GUARANTEED &amp;amp; AT THE LOWEST PRICES IN TOWN!!</p>
        <p>FACTORY MATTRESS &amp;amp; WATERBED OUTLET</p>
        <p>355-2626</p>
        <p>ludilvil Ml'  Hlyi1</p>
        <p>lo Thv i'Uirt Actos f rom  MsrI</p>
        <p>355-2626</p>
        <p>90 Days Cash I f 90 day layawa^ J i Financing</p>
        <p>j Delivery</p>
        <p>Visa &amp;amp; MasterCard</p>
        <pb facs="00096780_0004" />
        <p>Saturday Incidents</p>
        <p>Greenville police said seven inci-drats were reported to the depart-moit Saturday.</p>
        <p>Officer N.B. Rice said the attempted breaking and entry of Shawns Grocerv was remrted at 12:56 a.m., while Officer Alexander Batts said the breaking and entering of a residence at 115 Osceola Drive was reported at 7:01a.m.</p>
        <p>Officer L.E. White said a window was shot at Williams Auto Parts causing $100 damage in an incident reported at 7:56 a.m., while Officer S.A. Person said a breaking and entering at Budget Tire Co., resulting in the theft mag wheels valued at $80, was reported at 8:04 a.m.</p>
        <p>Officer M.R. Benton said the theft af two coats, one worth $400 and the other worth $100, from 600 A-1 Kings '.Row was reported at 11:15 a.m., v^e Officer R.C. Stroud said the thdt of a license plate worth $20 from a car at 106 B Stancil Drive was reported at 12:09 p.m.In The Area</p>
        <p>Six Are Arrested</p>
        <p>Greenville police said six arrests were made by officers of the department (Friday.</p>
        <p>Officer C.A. Elks said John Lee Watts of 920 E. 14th St. was arrested at 9:30 a.m. ( a charge of larceny.</p>
        <p>Officer J.E. Williams said R(mald Ashley White of 109-A Brookwood Drive was arrested at 8:30 a.m. for</p>
        <p>TOY RIDE - Nearly 200 biken from regkmal motorcycle clubs visited Greenvilto Saturday afternoon to deliver toys to the Salvation Army pick-up point at Carolina East Center. Chip and Joy Velasquez, left, of Jacksonville ride with the group to deliver abont 2,000</p>
        <p>items for Toys for Tots for needy children. A donation of $300 was also presented by the group to the Pitt County Council on A^g during the gathering. (Reflector Photo by Thomas FiHrrest)</p>
        <p>Detective D.R. Best said Leslie Todd Ennis of 407 Paris Ave. was arrested at 2 p.m. for breal^, entering and larceny in connecti( with an incident ( Oct. 2 at 504-B Watauga Ave.</p>
        <p>' Officer S.A. Person said Michael Stevenson of 404 Gum Rd. was arrested at 4 p.m. for possession of a vehicle stolen on Oct. 28 from the lot of the Department of ices.</p>
        <p>Officer J.G. Jeidns said Michael Thorpe Pierce of 510 Ringold Towers was arrested at 8:30 p.m. on three counts (rf making harrassing phone calls.</p>
        <p>Officer R.L. Smith said Jeffrey Alten Fisher 504 N. Church St., Farmvilte, was arrested for the theft of a beer from Red Oak C^venient Mart at 10:32 p.m.</p>
        <p>Meeting Scheduled</p>
        <p>The Second Uni( of the Central Conference of Original Free Will Baptists and the Second Union Sunday C(vention will meet Sunday at 3 p.m. at WintervUle Free WUl Church.</p>
        <p>The church choir will sing a portion of My Tribute, byTomFettke.</p>
        <p>Benefit Concert</p>
        <p>White Oak Missionary Baptist Church WUl have a gospel concert Sunday at 3 p.m. Guests include the Gospd C(solators, Delnra Leathers and the Original Flames of Joy. Proceeds will used for repairing the church roof.</p>
        <p>Instructional Session</p>
        <p>Dr. James F. Bowman of Greenville recenUy attended an instructional meeting about foot and ankle diseases in San Di^o.</p>
        <p>Treatment methods, especially new and advance sureery techniques, were taught during the meeting. The course was sjMnsored jointly by the American Foot and Ankle Society and the American Academy of Orthop^c Surgery.</p>
        <p>Bowman practices orthopedic surgery in Greenville.</p>
        <p>Honor Society</p>
        <p>The Society of Distin^hed American High School Students has announced that six students from Grace Church have been selected as members oi its h(or society!(1987.</p>
        <p>t</p>
        <p>&amp;gt;Authorities Probe ILocal Incidents</p>
        <p> Greenville pc^ce said 13 incidents reported to the (j^rtment on Friday re under investigati&amp;lt;.</p>
        <p>, Officer S.B. Pass said the theft of |70 firom a purse at Wahl-Coates jSdiool was r^rted at 9 a.m., while &amp;lt;)fficer T.E. Elvans said damage to a car at 1609 Hoi^ins Drive was reported at 9:53 a.m. Evans said the ^*s tires were cut, resulting in $400 damage.</p>
        <p>Officer D.R. Wyrick said $25 in damage to lights at the King and Queen Restaurant was reported at 12:20 p.m., while Officer J.G. Bridges said the theft of three .;w(miens coats wcnrth $450 from ^Carolina East Mall was reported at ;i2:4^.m.</p>
        <p>Officer R.J. Brewington said the larceny of a license plate worth $20 at Ringold</p>
        <p>The students sponsor, Jeff Heath, received the societys National Ap-iti( Award for devotion to the lent and encouragement of [leaders.</p>
        <p>Students acknowledged were Sheila Byrd, Kristi Overton, Penny McLawhom, Sonya Daniels, Becky SUx^ and John B^n.</p>
        <p>In order to be accepted for membership in the 19-year-old society, candidates must excel in academics, extracurricular or civic activities.</p>
        <p>Scholarships Given</p>
        <p>The Free WUl Baptist Churches of Pitt County contributed $23,705.93 at the annual Mount Olive College dinner held at D.H. Conley High School.</p>
        <p>Three $100 scholar^ps to the collie were presented to churches at the dinner. Receiving scholarships were Kings Crossroads FWB Church, Reedy Branch FWB Church and Ayden FWB Church.</p>
        <p>Hietoricaf Society</p>
        <p>The WintervUle Histrica) and Arts Society wUl meet at its museum buUding on Church Street in Winter-vUteTitesdayatV:30p.m. "</p>
        <p>'Planters Santa'</p>
        <p>Planters National Bank is coUec-tii% non-perishable food !( the needy through its annual Planters Santa program, according to James B. Powers, PNB chairman and chief executive officer.</p>
        <p>Powers said that food wUl be collected at Planters Bank offices around the state between Monday and Dec. 23 and wUl be distributed to</p>
        <p>Journalism Grants</p>
        <p>EUen Ringer of Rose High School and Jean Komedy (tf N(H&amp;amp; Rowan High School in Spencer are among 66 high school journalism teachers to be awarded a $350 grant to attend college courses and journalism workshops this summer.</p>
        <p>Master's Degree</p>
        <p>Alayna Jane KeUer of Greenville received a masters degree from the Spanish School at Middlebury College during the summer.</p>
        <p>Licenses Granted</p>
        <p>David K. Brese and Pat White, both of GreenvUle, recently received a liceme to enga^ in the business of heating contracting, group 1, class I from the State Boara of ehcaminers of Plumbing and Heating Contractors.</p>
        <p>In addition, Stuart M. Shinn of GreenvUle received a license to engage in the business of contracting, groups, class I.</p>
        <p>PubHe Hearing</p>
        <p>The proposed annexation of 583 acres ofBrook Valley wUl be the subject of a pubUc hearing before the Greenville City CouncU during a special can meeting on Momtey.</p>
        <p>The meeting ^ be held at 5: p.m. in the third floor councU chambers of City HaU.</p>
        <p>Welding Society</p>
        <p>The American Welding SocieW wUl</p>
        <p>meet Tuesday at 7 p.m. at the Three</p>
        <p>Steers Restaurant.</p>
        <p>Bob Wiswessor wUl speak on Welding Qualification Tests. For more ir^rmation caU Roy Lanier at 756^130.</p>
        <p>Assistance Funds</p>
        <p>state Commerce Secretary Claude E. Pope has announced that his department is accepting applications for more than $5 mUlion m business develofunrat assistance funds for low-income North Carolina counties.</p>
        <p>AppUcations for up to $250,000 per project wUl be takoi firom 50 counties, including Beaufort, Carteret, Greene and Martin counties. Pope said.</p>
        <p>Local agencies wishing to apply for grants under the program should contact the Commerce Finance Center, N.C. Dmuirtment of Commerce, 430 N. Salisbury St., Rateighr 27603, or caU 733-5297.</p>
        <p>ACC Scholarship</p>
        <p>Pamela Dawn Savage of Green-vUte has been awarded a $1,000 Transfer Honors Scholarship at</p>
        <p>from a car</p>
        <p>Towers was</p>
        <p>!reported at 12:50 p.m., white Officer M.R. Benton said $25 in damage occurred when someone knocked a side window off of a car at a private park</p>
        <p>ing lot in an incident reported at 3:10 p.m.</p>
        <p>Officer J.A. Bartlett said the right</p>
        <p>rear window of a car parked at 1908 B  wai  Ahari*i  anH</p>
        <p>Kennedy St. was broken in an inci- ^ ne^ through local chanties and</p>
        <p>dent reported at 3:50 p.m., whUe $15 non-profit organizations.</p>
        <p>in damage to a window at 1506 E. 5th</p>
        <p>St. was reported at 8:30 p.m.</p>
        <p>Officer T.E. Nevelte said the passenger-side window a car at Gamer Wholesale Warehouse was broken in an incident reported at 4:47 p.m., whUe Officer R.L. Smith said the larceny of a bottle of wine fnun Harris Supermarket was reported at 8:42 p.m.</p>
        <p>Officer J.E. Woolard said $75 in damage was done when sevml chairs were thrown from the patio at the Fizz Restaurant into an adjacent parking lot. The incident was reported at 8:25 p.m.</p>
        <p>Officer E.E. Laughinghouse said a car window was broken at lOth Street Bingo resulting in $75 damage in an incidoit reported at 6:35 p.m.</p>
        <p>Solicitation Permit</p>
        <p>Greenville Police have issued a solicitation permit to Friends of the Theater Inc. for a fiind-raing project from 9 a.m. to 9 p.m. through Dec. 5.</p>
        <p>Appmimately 40 v(dunteers will be involved in the project throughout Greenville to benefit the organization.</p>
        <p>REGISTER TO WIN A  \a</p>
        <p>FREE</p>
        <p>GRANDFATHER CLOCK</p>
        <p>TO BE GIVEN AWAY DECEMBER 23RD</p>
        <p>No purchase neceisary. You need not be present to win.</p>
        <p>Large Selection Of Paper Lampshades Now In Stock</p>
        <p>Personalized House Signs Only $13.95 Candles, Country Furniture And More Mon.-Sat. 10-9 Sunday 1-5</p>
        <p>COUNTRY STORE</p>
        <p>Red Oak Plaza  264 ByPaaa</p>
        <p>1 Mile West Of Carolina East Mall 756-1081  ^</p>
        <p>CksjJiLn^  Varice.!</p>
        <p>*[[ [fi you wiift Eociyonc nauykiy and nica!</p>
        <p>ynsons^</p>
        <p>1720 W. Fifth Street (919) 793 9I9S</p>
        <p>FLORAL GALLERY / STATIONER / CH&amp;lt;X:OLATIER</p>
        <p>Dot tkt mo txeliin^, most untuual, iuu/y</p>
        <p>oxi^UuI, MfinUdtf L%%uUtlU ylfii, in town!</p>
        <p>Atlantic Christian College in Wilson. Now enrolled in Pitt Communite</p>
        <p>^OC</p>
        <p>Odtege, Ms. Savage will enter A</p>
        <p>Students Nominated</p>
        <p>The Susanna Coutanch Evans Chapter of the Daughters of the American Revolution is sponsoring four area students for the national DAR Good Gtizen scholarship award.</p>
        <p>Nominees are Ed West, D.H. CoP' ley High School, son of Dr. and Mrs.: Edwin West; Shannon Rloward, J.1L Rose High School, daughter of Mr.; and Mrs. Malcolm Howard; Laura Tripp, North Pitt High School, daughter of Dr. and Mrs. William Tripp Jr., and Rob Rodebaugb, Ayom-Griftim High School, son (d lr. and Mrs. Richard Rodebaugh.</p>
        <p>The students wUl be guests of the Greenville DAR chapter it District DAR Good Citizens Day in Mur-fireesboroJan.9. 4:  /</p>
        <p>REACH Meeting</p>
        <p>REACH, an organizabQO of families and friends of the thronicaUy mentaUy ill, will meet at 130 p.m. on Tuesday in the Pitt Coupty Mental Health Center, 306 Stimtoosburg Road.</p>
        <p>David Leach, attornev, will give a presentation on Legal Issues Concerning the Chronically Mentally</p>
        <p>m.</p>
        <p>F&amp;lt;ht m&amp;lt;Hre inf(Nrmati&amp;lt; call ^-7151. (Please torn to A-5)</p>
        <p>Special Use Case To Be Considered</p>
        <p>Although the Greenville Board of Adjustment denied a re(juest to renew a special use permit which allows the operation of a local ni^tclub, the ownm* still has mi opportunity to have the request ap-ivoved, according to a city olficial.</p>
        <p>The board denied the orating request of Beaus nightclub owner, James A. Arnold Jr., because he did not appear before the board at the time his request was heard Thursday ni^t.</p>
        <p>Jack Simoneau, city planner, said Arnold has indicate he did not receive a letter informing him of the Board of Adjustment meeting.</p>
        <p>Simoneau said Arnold will be allowed to make his request again d^^ the Dec. 17 meeting of the</p>
        <p>The denial of Thursdays request wiU not affect the establishments current operations, Simoneau said.</p>
        <p>Design Perspectives, Inc.</p>
        <p>Michele Arrowood &amp;amp; Associates Announces Our</p>
        <p>2nd Designers Attic Inventory Sale!</p>
        <p>Monday thru Friday, Nov. 16-30th from 9:00 a.m. to 5:00 p.m. All Inventory Items At Cost Or Below</p>
        <p>Baskets, pillows, lamps, accent tables, dhurrie rugs, artwork and accessories.</p>
        <p>All Items Reduced Additional 20%</p>
        <p>Great Items - Fantastic Savings!</p>
        <p>Come and see us on the 2nd floor of the Coffman Building Evans Street Mall</p>
        <p>752-2015</p>
        <p>^e</p>
        <p>ctrolln 9st</p>
        <p>ctrolln 9st mtll gtPMvllld</p>
        <p>20% Savings On Pfaltzgraff Christmas Heritage Dinnerware!</p>
        <p>3-Pieca Place Setting Regular $15</p>
        <p>*12</p>
        <p>Open Stock 3.20 to 18.40 Reg. $4 to $23</p>
        <p>Dress your table for the holiday season and share the tradition of Pfaltzgraff I The three-piece place setting includes one dinner plate, cup and saucer.</p>
        <p>PFALTZGRAFF</p>
        <p>Shop Camlini ast Mall, Qmmille, Monday ThmgFSMu Sunday 1:30pM TU&amp;amp;OQpM-Phooe 756S&amp;gt;E</p>
        <p>a.m. Until 9 PM,</p>
        <p>(mm</p>
        <pb facs="00096780_0005" />
        <p>' ' . ' \ The Daily Reftectof, Qrewville, N.C.</p>
        <p>Sunday, November 22,1967</p>
        <p>As Key 1988 Issue</p>
        <p>ByCLAYDEANHARDT Reflector Staff Writer</p>
        <p>for North Carolinas future Is the. main issue in the 1968 rac for lieutenant governor, according to candidate Tony Rand.</p>
        <p>Rsmd, a Democratic state senator from Fayetteville, was in Greenville Friday for a reception given by Sen. Tom Taft.</p>
        <p>*Within that (the future of North Carolina) the problems or the oppor</p>
        <p>tunities or the main areas d interest, I suppose, are education, economic devdq&amp;gt;ment and transportation, Raiul said in an interview.</p>
        <p>T think the main problems that we face in education, Rand said, are the fact that we are losing our g^ teachers and we are having smne difficulty attracting quality teachers to the classroom. We are going to teve to replace half of our teachers within the next ten years, and half of those</p>
        <p>We need to do somettiing in a meaningful way to improve the lot of the classroom teacher and remove as much as we can the sense of frustration the teachers feel and to and help teaching become a meanmgful profession.</p>
        <p>Rand said the state has been doing , well in areas of economics and that it nee^ to continue the trend. He cited</p>
        <p>FELLOWSHIP RECIPIENT - Joshua R. Sonett, center, accepts the Rock Sleyster Fellowship check of $2,500 from Dr. William E. Laupus, dean of the East .Carolina University School of Medicine and vice</p>
        <p>chancellor for heattli services. On the left is Dr. James Mathis, chairman of the psychiatric medicine department, who nominated Sonett fr the award. (ECU News Bureau Photo)</p>
        <p>the Rural Economic Development Cwporation and the Growth Oppor-tum^ Counties, and the Committee on Jobs and'Economic Growth as ways the state government is leading the states economy in positive directions.</p>
        <p>In addition, to expand on that, we need to put a special emfdiasis, I f^eel, on smaU business. Most of the kd are created in small business and we need to create siHue kind of clearinghouse for small businesses to help them with their paperwoit and help them gain access to the latest technology, Rand said.</p>
        <p>He mentioned the abundance of high technology North Carolina enjoys through the Research Triante and the states universities. He said the state needs to make all of those resources available to small businesses.</p>
        <p>Rand said 1m thinks eastern Nmrth (Carolina is in a period of transition.</p>
        <p>The state has a very vital role to play in tjiat. We need to do all we can with those involved in agriculture to think about alternative crops, think about alternative uses of tne land, acmculture, that sort of thing.</p>
        <p>The flavor of North Carolina is in small towns, Rand said. He said the state needs to do all is can to keep jobs in small towns and create new jobs there so young people dont have to move to the cities for decent opportunities.</p>
        <p>Rand said Greenville is a center for this part of eastern North Carolina. What happens in the smaller towns in the rural areas sorrounding Greenville wUl have tremendous impact on the quality of life in Greenville, he said.</p>
        <p>RtiH said the lieutenant governor should insure tiiat the finances are there for transportation in the state and that he should use his one appointment on the transportation bMurd to carry across his views.</p>
        <p>I think m most important that</p>
        <p>we open up eastern Nmlh Carolina, particuOarly some route to northeastern North Carolina to tie all sections of our state together, Rand said.</p>
        <p>He said he believed jobs follow highways and that all areas of the state shMild have access to transpor-tatiwj arteries for the diipment of go(kb.</p>
        <p>Rand said he felt the state shmdd employ a balanced ajproach in at-</p>
        <p>Tlit</p>
        <p>In The Area</p>
        <p>Fellowship Is Awarded</p>
        <p>(Continued from A-4)  Unit  On  Jopon</p>
        <p>Dorie Harrells third-grade class at Sadie Saulter Element^ School recently completed a unit on Japan iffl^r tlM supervisiim of studmt teacher Maiy Garbett. The students woe divided into fve groups, where they researched their topics and wrote a report.</p>
        <p>The students correlated their research of Japan with National Education Week by having a Japanese Matsuri (festival) Day for students in the school.</p>
        <p>The class finished the day by participating in the paper folding art, Ori^mi, and tasting food with</p>
        <p>'Library Scheduie</p>
        <p>Shei^Kurd Memorial Libraiy and Its branches will be closed on'Thurs-:day for Thanksgiving. The library -yrifi resume its nmmal hours m operation on Friday.</p>
        <p>Speciai Guests</p>
        <p>Vlhe^ Roanoke Consistory No. 248 Golden Circle will be guts of the Mount Shiloh Baptist Church, Wilhamston, at a 6 pjn. father, son Mad Holy Ghost pre-Thanksgiving jKrvke Sunday.</p>
        <p>tlmhurst Activities</p>
        <p> Elmhurst lementary School celebrated Childrens Book Week using the theme, Free to Read. There were guest storytellers and students were read stories about animals, blueberries, folktales and bubbles.</p>
        <p>also were shown films.</p>
        <p>! An awards assembly will be held day to announce winners of the we^ cmtests. The Elmhurst</p>
        <p>..itters will make their first appearance for the schod year, and several</p>
        <p>Tedtations.</p>
        <p>Postai Scheduie</p>
        <p>The Greenville Post Office and ECU Station will be closed to observe the Thanksgiving holiday on Thursday.</p>
        <p>While express mail will be delivered, no regular, residential, business or rural delivery will be provided. No mail will be placed in post office boxes and no mail wiU be dispatched fronf the Greenville office.</p>
        <p>Joshua R. Sonett, a fourth-y^ medical student at the East Carolina University ScImoI of Medicine, has been awarded the Rock Sleyster Fellowship.</p>
        <p>The award, sponsored by the American Medical Association, is presented annually to up to 25 deserv-ing senior medical students who exr hibit exigence in scholarship and an interest in psychiatric medicine.</p>
        <p>Named for a former president of the AMA, the Sleyster Fellowship includes a stipend of $2,500.</p>
        <p>Sonett is the first student at the</p>
        <p>Lunch Menus</p>
        <p>Lunch menus for Pitt C(Hinty schoote tilts week, as announced, are:</p>
        <p>Monday: stew beef with onions and carrots, potatoes or rice, seasoned green beans, cranberry sauce, hot rolls and milk.</p>
        <p>Tuesday: baked turkey with dressing, candied yams, garden peas, cranberry sauce, hot rolls and milk.</p>
        <p>Wednesday: vegetable beef soup, crackers, bolo^ sandwich, ai^le wedges and mim.</p>
        <p>Thursday: Thanksgiving Day.</p>
        <p>Friday: Thanksgiving holiday.</p>
        <p>ECU School of Medidiie to receive the award, accordiiig to Dr. James</p>
        <p>WOTHMW  -w  "</p>
        <p>of psychiatric medicine, the nomination.</p>
        <p>Sonett is the son of Mrs. Alan Sonett of New Bern.</p>
        <p>NEW 14K GOLD</p>
        <p>^16 Per Gram</p>
        <p>SOOTHtRK GUN &amp;amp; PAWN. INC.</p>
        <p>^00 NOPPH GRf f NE ST GRFFNVIH f</p>
        <p>tracting new business and industry into the state.</p>
        <p>He said that environmental issues often have an effect on economic ones, noting that maintaining clean water and air are important to the future of N(Hlh Carolina.</p>
        <p>The state should act as a guardian of those things, he said, and enact responsible legislaticm so we do not defile our own nest.</p>
        <p>Rand is a graduate of the University d North Carolina at Chapel ifill and the UNC School of Law. The Senate majority leader, he is chairman of the Base Budget and Aj^ro-inriations Ckimmittee and has served on committees dealing with law enforcement and manufacturing. He has been a senator since his ap-KHntment in December 1981.</p>
        <p>For Christmas.. Choose Scenes from Eastern North Carolina</p>
        <p>Custom framing at reasonable prices.</p>
        <p>r Gallery</p>
        <p>642 Arlington Blvd.</p>
        <p>Insida STEMOECKS MENS SHOV</p>
        <p>SINGLE VISION LENSES</p>
        <p>*12.95</p>
        <p>Ho other purdioso nacossonf.</p>
        <p>UNE BIFOCALS</p>
        <p>*39.95</p>
        <p>No other purchase necessary. Not volld with guy othf ceupon.</p>
        <p>PROGRESSIVE N04JNE BIFOCALS</p>
        <p>*79.95</p>
        <p>No other purchose necessary</p>
        <p>Not valid with any othor oowpon.1</p>
        <p>ONE HOUR SERVICE</p>
        <p>SeiQLE VISION  GLASS  PLASTIC ONE DAY SERVICE ON BIFOCALS</p>
        <p>-Proaerlpllon Range-Up to a plus or minu LMSyhetltoalNCyL</p>
        <p>OFFER GOOD THRU NOV. 30,1987</p>
        <p>CLEAR VUE OPTICIANS</p>
        <p>u  2484 STANTONSBURG ROAD</p>
        <p>  STANTON SQUARE 752-1446</p>
        <p>COUPON</p>
        <p>COUPON</p>
        <p>COUPON</p>
        <p>wMaresf</p>
        <p>gallera</p>
        <p>10* ANNIVERSARY CELEBRATION SALE J</p>
        <p>10 piece Wok Sets VVWok</p>
        <p>$30 value</p>
        <p> Non Stick Surface e Red Enamel Bottom</p>
        <p>Solid Brass DeskLompS Youf Choice</p>
        <p>Bkms Bamboo CockkHI ft Lamp Glass Top Tables</p>
        <p>lamp table $75 value</p>
        <p>39.99- laauerfmiih</p>
        <p>Stainless aeel Flatware Sets</p>
        <p>70 bc Seivlce lot 8</p>
        <p>2999sei</p>
        <p>$100 value</p>
        <p>Stainlett Steel KnIteSets</p>
        <p>4pc.Stec*KnNeSelt 19.50 value</p>
        <p>,999set</p>
        <p>5pc.CutleiySett $30 value</p>
        <p>14.99set</p>
        <p> Wood Handles</p>
        <p>Seograss Doormats</p>
        <p>Hall Round</p>
        <p>$14 value /.yy</p>
        <p>Rectangular $12 value</p>
        <p>6.99</p>
        <p>Solid Brass Wall Swingers</p>
        <p>$75 value</p>
        <p>19.99</p>
        <p>e 3-virav SwBch</p>
        <p>Register to Win:</p>
        <p>e lamps e Choir ft Ottoman Sets eFutans eSotaSleepeit e Crystal e Houiewaies e Gittwore</p>
        <p>e Over $5000</p>
        <p>In Total "Value" e 50 Individual Wlnnen [Must be IB-One Regltliatlor Per Stole VWI)</p>
        <p>Solid Brass Candlestick Lamps Your Choice</p>
        <p>$100 Values</p>
        <p>39.99</p>
        <p>Full sue lOOt Cotton</p>
        <p>Futons</p>
        <p> loti otSoMCokM and Oawgnaf Pimti</p>
        <p>$200 Yol</p>
        <p>BtockftBrau Octagonal Mirrors $200volue</p>
        <p> NaiuiaillgMColat  SotoOyOoy rmiBMtalMgM</p>
        <p>36"X 36"</p>
        <p>Solid Brass Champagne Buckets</p>
        <p>24.99</p>
        <p>Solid Bioss Ifodltionoi Wall Sconces</p>
        <p>Single $26 value</p>
        <p>Swing Aim Floor lamps</p>
        <p>SolK]S&amp;lt;qii 54 rgn</p>
        <p>SnlvStau</p>
        <p>INtcUd</p>
        <p>SSNgn</p>
        <p>A</p>
        <p>Solid Color Torchiers 4  $100 value</p>
        <p>39.99</p>
        <p> nmwlioeii</p>
        <p> toiKWNaw *N4ouveGiv</p>
        <p>6 65 high</p>
        <p>Plus Much Much Moiel</p>
        <p>3Hr\</p>
        <p>All Pom Open MgltHv ft Sundays RALEIGH  Cameron vniage ft North Rklge DURHAM Northaole Mall GREENVILLE IhtPkao</p>
        <p>CiedlAUiycNoyPkins AYoNobte</p>
        <p>Restful Electric Blankets! Twin, Full And King Sizes</p>
        <p>24.99.58.99</p>
        <p>Automatically adjusts to changes in room temperature. Machine washable. One-year warranty. In burgundy, light blue and champagne.</p>
        <p>Save $S-$7 On Fieldcrest Velplush BlanketsI</p>
        <p>19,99.32.99</p>
        <p>Twin, fuli, queen and king sizes, In Ivory, light blue, rose, coffee or burgundy.</p>
        <p>Royal Velvet Thermal Blankets From Fieldcrest</p>
        <p>28.00.56.00</p>
        <p>OfMVo wool/40% acrylic with nylon satin binding. Moth-proof. Machine washable. All sizes!</p>
        <p>Fieldcrest Corsair Electric Blankets! Save!</p>
        <p>  ...  26.99.65.99</p>
        <p>BOH polyeeleitBOH acrylic loom-woven shell, In champagne, ocean blue and coffee. All sizes.</p>
        <p>ShopCamllnaEast Mali, Gmenville, Monday Through Saturday 10a.m. Unlil9p.m., Sunday 1:30 p.m. til 5:30 p.m.  Phone 756-B-E-L-K (756-2355)</p>
        <pb facs="00096780_0006" />
        <p>Propo^rts</p>
        <p>Refh</p>
        <p>Proposals</p>
        <p>downrawna</p>
        <p>thejaawe</p>
        <p>By STUART SAVAGE Reflector Staff Writer _ for new office and for impr^em were</p>
        <p>Sion about Pitt Counto Mem^ Hospital or the East (Mna Urn-</p>
        <p>worfidiop meeting of the Pitt County Board 01 Commissioners Friday. But no concf" was reached on either</p>
        <p>For the post year or more, the board has been looking at ways to</p>
        <p>meet an increamng demand fiH* more</p>
        <p>offlce space and earlier ^tto yem pimdiaaed a triock boun^ by Fwt, Washington. Second and Evans</p>
        <p>(ice space  veisity School of Meficine aoo^</p>
        <p>cements at  the j^esott county cSct building m</p>
        <p>at a iMxm West Fifth Street</p>
        <p>Friday, County Blanaj Jackson opened the disa thepossibSitvofmovingi offices back downtown if</p>
        <p>^tapnoessiiiguidemef^  S!Sk."2!,^^*^TWrt</p>
        <p>wilhthei</p>
        <p>t court bone.</p>
        <p> Kramer</p>
        <p>discussion about most county   thehoffl^tal</p>
        <p>w meihcid schod acquiies the West Fifth Street bitlding by saying *%e need some direction. Is there any in-terestwhatsoever?</p>
        <p>Ar^tect Jimmy Ifite of Ifite Associates suggested the most eco-</p>
        <p>hejreaent-------</p>
        <p>And H&amp;amp;estimatod that the cost of such a bcffity would be in the neigli-bQrhQodoflSinilliootolSmimoii.</p>
        <p>iCmiiiiMitinfl 'ihese are ideas, concepts... not anything but iden,^ Hite said other alterntives could include a five-story extension of the pnseot courthouse annex on the courthouse block and across Second Street onto the property the counto bht earlier thb year, which would mean the now-county-owned</p>
        <p>present dty hall  on the other half of the new property.</p>
        <p>*T oiler these as food for thou^t, Hite said. But the concensus among commisBioners seemed to favor con-ttaned use of the three buildings pur-diasedtt^iyear.</p>
        <p>**Youie wasting my time talking about desttbying what the county just bought, Cominissioner Eugene jatnim said. But C(Hnmissi(Nier Tmn Johuon suggei^ Td jike to see</p>
        <p>The board instructed Jackson to talk with school officials about any plans the board of education might have to relocate the school administrative offices, which are now located in the countys West Fifth StreetbuUding.</p>
        <p>mte, as part of efforts to develop a master plan for the county, said at present the county, and state offices which the county provides office for, now employs 474 people</p>
        <p>And there has been some discus-</p>
        <p>niiaavA</p>
        <p>jail space ai er. finance</p>
        <p>IMIKM MM Vaw/</p>
        <p>i possibUities, Ihe^ - wl</p>
        <p>IQ  IQT UR; UmUaK" nimua oauciihiuvvi m   ui  i.</p>
        <p>officer, engineer, idan- be to include a fivestory dty &amp;lt;rf re^ owns a pmtmi of the block </p>
        <p>Exceptions Made For Athletes</p>
        <p>CHAPEL HILL, N.C. (AP) - Nineteen athletes were amwg the 56 students who did not meet minimim standards but were granted special ^iHmisginn to the Univesity of Nmrth Carolina at diapel Hill, ad school officials say thats a good score.</p>
        <p>The figures on student-athletes show that UNC-Qmpel Hill coaches **understand the academic expecta-tioBS of this institution, and Im confident that will continue, said Gillian T. Cell, the dean of the universitys College of Arts and Sciences.</p>
        <p>The 54 students were enrolled as teeshmen this year even thou^ they dki not meet standards established by the schools board of trustees, who require in part that students score at lesst 800 on the Scholastic Aptitude</p>
        <p>The average SAT score Chapd H1 fi^en this</p>
        <p>year was</p>
        <p>In a separate report, faculty members released figures on the graduatioa rates d tM 122 student athletes recruited by the university in 1961. Seventy-eipt percent of those athletes have graduated - a figure that does not include athletes who wittehew fim school wUle still academically eMle.</p>
        <p>For aU freshmen entering the university in 1961, the mraduatton rate was 67 percent. That figure also does not indude students who withdrew while still academkally eligible.</p>
        <p>The grade-point average of athletes and non-athletes who are</p>
        <p>sophomoies, iunion and senkn ato were released. On a four-point scale, female athletes in the senior class had a higher average, 2.80, than noiKithletes, whose average was 171.</p>
        <p>Blale athletes who were seniors had a 2.45 average, lower than the 168 average maintained by nonathletes. In other classes, botti male and female athletes grades lagged slightly below their non-atUete countoparts.</p>
        <p>The report on athletes also included informatkm from a survey of athletes in mens baseball, womens softball and mens and womois track, golf and cross country. The survey found that athletes spent about 90 to 35 hours per week on ttieir sport and they generaUy gave</p>
        <p>coaches high marks for their attention and concmm fw their academic poformance. Concerns that existed ^tend to be expressed by student-athletes with higher ade-point averages, according to the report.</p>
        <p>VkkDies</p>
        <p>RALEIGH, N.C. (P) - Harold Vick, a nationally renowned tenor saxophonist and Rocky Mount native, has died of a heart attack at his home in New York. He was 51.</p>
        <p>Vick played with jazz greats and' vocalists such as Lena Horne, Ray Charles, Dizw Gillespie, Aretha Franklin and woody Shaw. He appeared in the movie The Cotton Chib, made numerous albums and wrote more than 50 songs.</p>
        <p>Vicks funeral was held Thursday at the Abinsea Baptist Church in Harlem.</p>
        <p>increase to and estiiniated that 143,719 square feet or more will be ne&amp;lt;^ tohouse them effectively.</p>
        <p>CMnrntoiooers also talked with Tom Ritter and Bob Lewis of the Draartment of Human Resources jail mul (tetentian Inanch about conditions at the county jail, built in 1965 to house 83 prisoners.</p>
        <p>Ritter, who heads the jail and detention branch, told commissioners the jail here is at capacity ri^t now, while Lewis, a jail inspects, said the facitity is being ovs-used.</p>
        <p>Saying the jail was built three years before minimum standards were adopted, Ritter suggested you can ttJce 40 pMple opt ofuiat jail and</p>
        <p>youstill haviaan antiquated jail. WhUe the averageM^ populatioii averages about 96 peicent of capacity, Jitto said that in 1966, the daily capacity reached 126 percent, whe so far this year, the nig^ daily capacity has been 117 percent.</p>
        <p>There has been a change m the fiiiKtisi in jails ovs the past 15 years, Ritter said, from detention (facilities fs persons awaiting trial) to community-based confinement (fs people saving relatively short sentences).  ^  .</p>
        <p>Both Ritter and Lewis suggested that the best solution tolie problem woidd te to build a new jail. But firi-lowing the meeting, Ritt^ said some renovations of the present jail could be made to make it nidre serviceable.  I</p>
        <p>In the meantime, both men suggested that a committee be estab-Ushed - including jix^, repre^i soitatives of the sheriffs deput-ment and county commissioners - to wwk out measures to prevent ovr-crow(fing.</p>
        <p>saao-sshMMPA</p>
        <p>Quality Sim n^ring___</p>
        <p>113 Qranda Aw.</p>
        <p>Cormr of DIcMmon A 10th St PaiWng In Front** ' Mon.-Frt. M  SM. M</p>
        <p>Ctordi</p>
        <p>On WGHB Radio 1250 AM</p>
        <p>11d)0-12:00 Noon Each Sunday</p>
        <p>Before your family travels this holiday</p>
        <p>STUDENTS INTERVIEWED--Ite UK. DnartiMra csteteee tbdr edroatto. Sttoroti receattytetervtewedllhinilfippfiittoftei ap|tythriillhBCU*scep^.I raient ring Bs first visit to East CanBaa  Saam. a kmi jabs rcnrit, ai</p>
        <p>. Job openings for handicapped stadetes la  frsyKwa^aClteyaphin^ei</p>
        <p>University. Job opeaiags for hairfteapped itadeati ia techaology aad scientific aad sapport podtisas hKladiag etmpater sdeace are offered throng the federsBy-faaded Cooperative Edacation Program, seeUag to place 2,SN students in career-related johs while they</p>
        <p>with any autjor aiay Piclarcd are Margaret as she interviews Geof-native and human resources in the ECU School of Basiaess. Ms. I Tayior Naval Ship Research and Devetowat CeTOer in AanapoUs, mI (ECU News BarroPMhyTsayRample)</p>
        <p>OPEN ALL DAY THANKSGIVING DAY</p>
        <p>11 a.m. until 7 p.m.</p>
        <p>featuring...A Traditiortal Thanksgiving Feast</p>
        <p>$R89</p>
        <p>HI^Bi Per Person</p>
        <p>One Low Price Does It All! No Surprises</p>
        <p>Kids eight and under.-------------------*1.99</p>
        <p>Kids under three........................eat PRII</p>
        <p>500 West Qreenville  Blvd.</p>
        <p>Jtehesmi</p>
        <p>FAMILY BUFFET</p>
        <p>Phone</p>
        <p>355-2172</p>
        <p>Jiffy Lubek</p>
        <p>dicntosite'</p>
        <p>chongos its</p>
        <p>eee</p>
        <p>Jiffy Lube is Americas leader in auto fluid maintenance. The J-team at Jiffy Lube makes cars 14 ways better! For one low price and no appointment (for most cars, foreign or domestic), heres what we do in 10 minutes:</p>
        <p>1. Change your oil with a major brand!</p>
        <p>2. Install a new oil filter!</p>
        <p>3. Lubricate the chassis!</p>
        <p>4. Check and fill transmission fluid!</p>
        <p>5. Check and fill differential fluid!</p>
        <p>6. Check and fill brake fluid!</p>
        <p>7. Check and fill power steering fluid!</p>
        <p>8. Check and fill window washer fluid!</p>
        <p>9. Check and fill battery!</p>
        <p>10. Check the air filter!</p>
        <p>11. Check the wiper blades!</p>
        <p>12. Inflate the tires to proper pressure!</p>
        <p>13. Vacuum the interior!</p>
        <p>14. Wash your exterior windows!</p>
        <p>PLUS a mil Car Wash with Full Service!!</p>
        <p>Welcome to Jiffy Lube.</p>
        <p>We'll take core of you like family!</p>
        <p>124 Qratnvllla Blvd.</p>
        <p>(Aoroee From QoWan Corral Steak House) PhOfia 756-2579</p>
        <p>Hourc Monday thru Friday 7:30 a.m. Ill 6:30</p>
        <p>SMurday 7:30 a.m. Ill no.</p>
        <pb facs="00096780_0007" />
        <p>1  '  *  t  A  \  *.  t,  ;  .  I    4  \  '  A  '*</p>
        <p>A  ^ V '% i</p>
        <p>4 i A A \ I</p>
        <p>The Day Rflectof. QiyanvMf, W.C.</p>
        <p>N</p>
        <p>)  A""  '*^''  ^48'  '</p>
        <p>,-;! '^V</p>
        <p>QUARTERLY BANKING SUMMARY</p>
        <p>A comprehensive quarterly summary of your Wachovia accounts provided In addition to your regular account activity statements, fcspecially useful for tax planning.</p>
        <p>(I S URif</p>
        <p>NOKEVWCHOVIAMASIBCARD</p>
        <p>Noonnualfeeoneither Regular or Gold MasterCard. T</p>
        <p>L30O</p>
        <p>FREE AMERICAN EXPRESS TRAVELKSCHECKS</p>
        <p>Plus official checks, notary services, and a $500.000 commoTKXirrler travel accident policy. preferred I0ANRA1B When you borrow, you are entitled to preferred loan rotes.</p>
        <p>Introducing the Wachovia Crown Accounf A package of 10 banking services free of charge. Including services no other bank offers.</p>
        <p>You may qualify for the Crown Account if you have a Wachovia Statement Savings Account of S2.500 or Wachovia CDs a a Cash Investment Accounf of S10/XX). Or you may qualify based on your line of credit: a Wachovia BankLlne* or Equity BankLine of $15,000 a mae.</p>
        <p>(You do not have to borrow.)'</p>
        <p>Talk to a Personal Bankd* about how your deposits or your line of credit can entitle you to North Carolina's unique banking package. Only at Wachovia.</p>
        <p>Member F.QIC</p>
        <pb facs="00096780_0008" />
        <p>\  ''"v</p>
        <p>A-8 DaitHWiiiHor. Qreen^ll.^ N  Sunday.  November  22,1967</p>
        <p>Ey^s</p>
        <p>v!</p>
        <p>Harringt) said he had been considering retirement fw some time, but held</p>
        <p>back because some of his constituents had encouraged him to run again.</p>
        <p>But to be perfectly frank, Im having a wee bit of heanng oss and thmgg</p>
        <p>lat cne a|^ With age, and 1 have a district that demands a lot of activity,</p>
        <p>DU said he timed die annoimcement so iat interested potential would have the opportunity to mount a campaign, in was elected to the Senate seat 13 times, and he said that whs his proudestacconmlishm Ive never h^(a) big desire to be in higlMr office, and that let me represent everybody,^rrington said. I even caught myself representmg Republicans now and then.</p>
        <p>in imk/ ne hhchihc uicaiwu* mi v w...___ Ini a low-key pttson.Hie luime of the game is to have friends around and</p>
        <p>esiate!*naieini.n.u.cK.-I"------  .  to re^ts  Piple  and thats wM I tried to do. I feel pretty</p>
        <p>Harrington, a retired tobacco equipment manufacturer, said he would con- satisfied. tinue to serve as president pro tern until his retiranMit.  ,  .  .    HarringtMi said he believed that Sen. Henson Barnes, D-Wayne, would be</p>
        <p>It is with a great sense of sadness that I announce this is my last session,  considered the front-runner for the president pro tern position.</p>
        <p>**^MhStSie US oraratuto^ thank all who have voted for and sup-  1 think that Senator Barnes certainly has the lead and hes certoinly a fiM</p>
        <p>iJ^meovei^y^S!^!^^  man and he has a mighfiy good chance to be the senator pro tern,Harnngton</p>
        <p>SUPP.O. But oow its time to more on let. younger porson ^^^^^^s,^y^^,,^tereachedfmcomment.</p>
        <p>Board Says Action Was Justified</p>
        <p>By JODY TAYLOR Associated Press Writer .  ,  x</p>
        <p>RALEIGH (AP) - North Carolina Senate Presidimt I^em J. J. Monk Harrington, a 25-year legislative veteran, announced Saturday that he wouw</p>
        <p>retirewhenhistermendsinDecember 1988.  ^  nrottv</p>
        <p>You know Ive been up there 25 years, going on 26. Id be wis^i^ close to 70 years old when I (to retire, HarringUm pd in a tdqphoito m^ view. Its just time for younger blood to move m. Im going to miss Kaieign</p>
        <p>because Ive been there ever since we opened the State House.</p>
        <p>Ivejustbeentherelongenough,Harringtonsaid.  . , _ , _  .. .</p>
        <p>Harrington, a Democrat representing the 2nil Senatorial Distnct wtoch C(miprises Hertford and Northampton counties and parte of Bere,</p>
        <p>Edgoml,Gatre,Balita, Martin and WaiTMa)iiptire.wmflrm</p>
        <p>the state Senate in 1962. He became president pro tern m 1983 and agam in 1985</p>
        <p>HUDSON, N.C. (AP) - CaldweU County commissi(mers say charges that Caldwell Systems Inc. violated ite air (mality permit justifies the c(mimissi(Miers decision to close the chemical-waste incinerator.</p>
        <p>When the Caldwell County com-mtssi(ma^ voted last wedi to close the county-owned incinerator and evict CSI, they charged the company had violated a provision of the lease requiring them to comply with all air ana water pollution laws.</p>
        <p>I think this Imds credence to our decision to cancel the lease, com-</p>
        <p>mwsinners* \fice CSiairman John Beall told The Charlotte Observer.</p>
        <p>The lease states that if CSI violates state and federal air qualitv standards, the lease is terminated, Beall said. This is additional (xoof. I think its sifpiificant.</p>
        <p>The violation, however, isnt grounds finr tte state to cIom the in-cinerahNT. CSI (rfficials said opm-tions will resume in about a week, once damage is rqiaired fnnn a chemical ^osion Tuesday in a storage taidi.</p>
        <p>CSI owner Charles Foushee Friday</p>
        <p>____________plans  as  60  feet,  but</p>
        <p>the incinerators stack is only 56 feet</p>
        <p>called the violation a technical ad- The hei^t of the smidiestack is justmentonly.  '  shown in Mse</p>
        <p>Hie North Carolina Division of En-vironmoital Management sent CSI the pmnit-vi(dation notice Monday.</p>
        <p>The. letter says CSls air quality  ,-------  ^  </p>
        <p>Dermit issued last year, is based on wrote: I would tterefore expect maxrect infiHrmatiim submitted by  that ccxTMt^ modeling would likelj^</p>
        <p>Tl^^/officials submitted their api^cation for the permit in 1986, they were required to include plans of the facility and computer-generated modeling that would predict the incinerators emissions.</p>
        <p>... a letter Monday to Foushee, air quality secti(m chief Ogden Gerald</p>
        <p>predict higher concentrations of pollutants than previously demonstrated. Accordingly, I conclude that Caldwell Systems Inc. did not construct the facility in accordance with</p>
        <p>PARKING PROBLEM ~ Kindergarten puptt Fofo TnMemota wades into a sea of bkyeles as he parks his own ontoide Menriv Park Elementary School at Goose</p>
        <p>Creek, S.C. Like rahber boots on a rainy day, the trick is fignring ont which belongs to whom when its time to go home. (APLaserpboto)</p>
        <p>N.C. Firm Sued Over Gas Leak</p>
        <p>FAYETTEVILLE (AP) - A Fayetteville couple and their rfiifarftn say they had to be hosfntal-ixed for carbon monoxide poisoning dpite two visits from gas company servicemen that failed to find a gas leak.</p>
        <p>Frank Hogan and Barbara Polan-slty are seeking 170,000 in damages from North Carolina Natural Gas Co. in a lawsuit filed in Cumberland County. Frank Barragan, chairman of Norai (Carolina Natural Gas, said Friday that he was not aware of the lawsuit and doesnt recall having been served with any papers.</p>
        <p>Among the allegations are that Hoffim suffered functional damage to his brain and vision and tissue damage to his head, arms, chest and legs.</p>
        <p>Ho^ who works for the U.S. Army, nas not lost wages yet, but he witi probably be discharged from the miliary because of his medical condition, the lawsuit says.</p>
        <p>Hogan and Ms. Polansity said they noticed a strong odor of gas after lea^ig their home from Mutual Ltd., and were told by their real estate agent to contact N.C. Natural Gas.</p>
        <p>Hie gas company sent</p>
        <p>a ser</p>
        <p>viceman to inspect the house and gas lines, and he Im a note for Hogan and Ms. Polansky saying the house was safe, the lawsuit chaiges.</p>
        <p>But the plaintifto continued to smell the gas, so they called the Bonnie Doone Fire Department. Firefighters checked the fittings on the gas furnace and could not find a leak, but told the couple that because gas odor was nesent there could be a to. Firefighters turned the gas to the stove (m and tcdd the coiqple to have the gas company examine it</p>
        <p>and Ms. Polansky again contocted N.C. Natural Gas, and the firm sent a serviceman to the house a second time.</p>
        <p>Hm lawsuit alleges the serviceman spent 15 minutes examining the furnace, failed to determine the source of the gas odor and told the two there was no gas leakage.</p>
        <p>Hie serviceman told them the fiir-! was operating properly and that might continue to smeO gas in ' home because the furnace had not been operated in some time, the lawsuit said.</p>
        <p>For the next several days, the family stoyed in the lunne, believing the</p>
        <p>io%</p>
        <p>OFF DrydMning</p>
        <p>WITH THIS COUPON</p>
        <p>205 E. 10th StrMt</p>
        <p>(NmToHiidM'itMcOoniUs) OpMiMon.fil.7aiii.'6|uii. S. 7 &amp;amp;m.4 (MB. 75^2701</p>
        <p>nace was I</p>
        <p>SHIRT COUPON</p>
        <p>This ooupon must be presented with shirt order.</p>
        <p>SHIRT COUPON</p>
        <p>= 1</p>
        <p> *.</p>
        <p>
        </p>
        <p> *</p>
        <p>J i.</p>
        <p>A BEniR WAY TO LOOK AT THE WORLD AT A BETTER PRICE</p>
        <p>ANNOUNCING A</p>
        <p>CONTACT LENS SAa</p>
        <p>Thara's Navar Baan A Battar Tima To Saa Battar, Faal Battar And Look Batter With Contact Lanaaa. Our Profaaalonal Feea Hava Baan Tamporarlly Reduced 15-28% On (tom-plata Contact Lana FIttlnga For Our Dally Wear, Extended Wear, Tinted And Topic Contacta For Aatlgmatlam. Thia Sale Starta Today And Only Runa To The End Of The Year So You Batter Hurry If You Want To Sava Money 3, Faallno &amp;amp; Looklno Battar In</p>
        <p>While Seeing. _______</p>
        <p>The Procesa With Contact Lanaaa.</p>
        <p>'aallng &amp;amp; Looking Battar</p>
        <p>Caf8Iina EyeCentef</p>
        <p>Stsnton Square</p>
        <p>24S4 atantoniburg</p>
        <p>Christmas Qlft Cartif icatas Avallabla</p>
        <p>Ora. tmtnhtW. MWiihsll A SMHtnh</p>
        <p>the approved plans ... and is consequently operating in violation of this permit.</p>
        <p>The first key was our meteorologist notified us that he thought the way they built it was not the way he saw it in the model, Gerald said Friday. We asked them (CSI), and they told us it was built to 56 feet. They sent us the plans and we turned armind and immediately sent them the notice of violation.</p>
        <p>Tte original air modeling study done for the air quality permit re-(lutoed estimates to be made of the stack height, Foushee said. The actual height of the stock was 56 feet and the hei^t used in the modeling roundup to 60 feet.</p>
        <p>DEM gave the company until Dec. 15 to sutonit a corrected model.</p>
        <p>We have been wfurking in good faith with the state on mowying the model..., Foushee said. This is a technical adjustment only, and should be completed within me time requested by the state.</p>
        <p>was I</p>
        <p>smeU would go away, as they had been told by the serviceman.</p>
        <p>752-080</p>
        <p>Lose wei^t in 88 with our 8 weeks for</p>
        <p>Temptation. It comes with the holidays. And in many cases, it lingers on in the form of unwanted pounds in the months to follow.</p>
        <p>Well youre in luck. Because with PhjTsicians WEIGHT LOSS Centers, you can enroll now and diet after the holidays with ( our 8 Weeks for $88.00* Holiday Weight Loss Special.</p>
        <p>Its the veiy same foll-service wei^t loss program thats helped so many lose so much. And at significant savings.</p>
        <p>Our professionally supervised, nutritionally sound, real food diet assures you the wei^t loss of up to 4 pounds per week.</p>
        <p>Whats more, our wei^t loss counselors support you every day, eveiy pound of the way. They help you keep the wei^t off, too.</p>
        <p>So dont let temptation put a damper on your holiday. Call Physicians WEIGHT LOSS Centers for your appointment today. After aU, our 8 Weeks for $88.00* Holiday Weight Loss Special is a gift worth giving-to yourself.</p>
        <p>$</p>
        <p>PARLIAMENT PLACE 300 E. ARLINGTON BLVD.</p>
        <p>SUITE B</p>
        <p>fSft-MIO ^</p>
        <p>GREENVILLE SB</p>
        <p>RALEIGH RALEIGH I CARY GARNER 7B1-79S2 CtotdmoorCTOMlng 401-1919  772&amp;lt;0OOO</p>
        <p>7I7-0488</p>
        <p>FAYETTEVHIE</p>
        <p>323-1717</p>
        <p>DURHAM ^ ASHEBORO</p>
        <p>471-1S03</p>
        <p>S20-22S2</p>
        <p>NotvNMwMianroltwroltor. mMm RIOdliOM MMf mwtlMlf^</p>
        <p>Physicians WEiGHTiiOSS Ceniers.</p>
        <p>With you every day, eveiy pound of the way iach^toTidtpt^^</p>
        <p>V</p>
        <p>Oftor Expiras: Ose. 4,1987  1&amp;lt;71 ii,.vrighl fliyiriciAiM WEIGHT LOSS Onttn ol America, Inc. - Akron, Ohio 4313</p>
        <pb facs="00096780_0009" />
        <p>W</p>
        <p>" g;</p>
        <p>Meefihjff Requested</p>
        <p>of</p>
        <p>RALEIGH (AP) - Sui POW-MIA activist Ted SamL asked Saturday for a meeting wii Gov. Jim Martm to discuss what they called a gross miscarriage of justice that led to Samplers jailing on a 1962 misdemeanor conviction.</p>
        <p>Sampley was ordered Monday serve a.6(klay sentence for a 1961 Iffawl vnth a court bailiff and two Wilmin(|ton police officers. He re- mained in jail Saturday.</p>
        <p>We realize that the governor cannot involve himself in every case in which someone feels he has been treated unjustly, said Robin Owen Bell, c(H:hairman of the American League of Families of Prisoners of War in Loas. However, this case is remarkable and we want an opportunity to show Governor Martm that this is one of those rare cases in vdiich justice has not been achieved by the courts. We believe Ted SamplOy should be pardoned and released so he can continue his important work for his fellow veterans and his comrades who were left behind in enemy hands at the end of the Vietnam War.</p>
        <p>didates to vote. Timothy Thomas, who filed the challenges, had appealed the rulings to the county Elections Bowd. Thomas is the twin brother of losing town Council candidate Todd Thoma$.</p>
        <p>Security Needs</p>
        <p>HEiIdeRSON  Problems ranging from drunken driving and drug amse' to vandalism and assaulte have brou^t a need for better security at Jotmn and Kerr lakes, say of-</p>
        <p>layof-</p>
        <p>fickls from Vance and Chatham counties.</p>
        <p>On Saturday evening at sundown at Jordan Lake, arresting people for driving while impaired would be like shooting fish in a banrel, Chatham County Blanager Marvin K. Hoffman</p>
        <p>No Nearings</p>
        <p>WILMINGTON (AP) - The Pender County Board of Elections has canceled hearings it was to herid Monday; and Tuesday on six challenged ballots from the Nov. 3 election for the Surf City Town Council.</p>
        <p>Pender Cenrnty Attorney Clifton L. Moore Jr. said he checked state election laws and spoke to State Board of Elections director Alex Brock before he advised the Elections Board to cancel the hearings. The local board notified those requesting the hearings that they have until Dec. 3 to decide whether to take their cases to court. If the board does not hear from them, it will certify the election results.</p>
        <p>The hearings were canceled because state law does not empower local elections boards to hear appeals of residency challenges made at the polls, Moore said. The law directs local boards to hear residency challenges only when they are made before election day, he said.</p>
        <p>The residencies of Surf City Town Council candidates Kenneth D. Batts and Doug Medlin and of five voters were challenged at the polls Nov. 3. Poll offcials overruled all but two of the challenges and allowed both cah-</p>
        <p>The Vance County Sheriffs Deoartment is plannii^ to buy a bugetproof vest and drug-testing equipment to combat problems there, officials said.</p>
        <p>Offcials from the counties in which the two lakes are located told a legislative panel Thursday how they were using state funds to beef up pabrols as beer drinking, crime and accidents increase.</p>
        <p>Hoffman told the Joint Legislative Commission on Governmental Operations that deputies had responded to 649 inciaents at Jordan Jie from Jan. 1 to Nov. 10. They inclu assaults, robberies and two</p>
        <p>The General Assembly has provided Chatham and Vance counties with $50,000 each during the past two years to improve law enforcement activities at tne lakes.</p>
        <p>Lawsuit Filed</p>
        <p>FRANKLINTON (AP) - The mother of a Franklin County child</p>
        <p>her sm was viciously mauled by a neighbors three jpit bull terriers.</p>
        <p>The suit said that Staron T. Perry, 12, was attacked by the dogs near Franklinton in September as he walked through a trailer park where he and his mother live. Staron Perry was stalked by one of three pit bulls owned by Frank Perry, a n^bor, and was knocked to the ground, the suit said. Frank Perry is not related to the boy or to his mother.</p>
        <p>The complaint said two other dogs</p>
        <p>had escaped from a nearby pen and, along with the stalking^ aog.</p>
        <p>had</p>
        <p>attacked the boy.</p>
        <p>Easy Automatic Cooking with Automatic</p>
        <p>COOKING CONTROL</p>
        <p>The Best GE Microware</p>
        <p>Model JE1465</p>
        <p> Dual Wave ll microwave systemdesigned for good, fast cooking resuits.</p>
        <p> Spacious 1.4 cu. ft. oven cavity.</p>
        <p> Automatic Cooking Control featuring Auto Cook, Auto Roast and Auto Defrost.</p>
        <p> Word Prompting Display provides</p>
        <p>programming instructions.  was..... ....... 349.95</p>
        <p> Temp Cook/Hold maintains tempera-  ooo oit</p>
        <p>ture until CLEAR/OFF is touched.  .............</p>
        <p>SAVE..............50.00</p>
        <p>or 20.00 per month</p>
        <p> Removable Double Duty* shelf.</p>
        <p> 10 Power Levels.</p>
        <p>Microwaves start at.</p>
        <p>9995</p>
        <p>GE. We bring good things to life.</p>
        <p>Solo Ends November 25th</p>
        <p>Layaway Now For Christmas</p>
        <p>V.A. Merritt &amp;amp; Sons</p>
        <p>"Electrical Appliances Since 1028"</p>
        <p>**WE KEEP OUR PRICES LOW AND SERVICE WHAT WE SELL'*</p>
        <p>DOWNTOWN QREENVILLE 762&amp;gt;3736 8:30 a.m.-S:30 p.m. Monday-Friday, 9:00 am-1:00 p.m. Saturday</p>
        <p>rr*Rnciinn</p>
        <p>r*CTM*TMMDIIIWICI</p>
        <p>NMUiMrUN</p>
        <p>iMrnNMCM</p>
        <p>MottorCofO</p>
        <p>&amp;gt;CAF</p>
        <p>Winter Quarter, 1987-88</p>
        <p>on-Credit Courses</p>
        <p>noih:redit courses</p>
        <p>REGISTRATION INFORMATION</p>
        <p>STUDENTS WILL REGISTER FOR NON-CREDIT COURSES AT II !H FIRST</p>
        <p>MECTi^JG</p>
        <p>Thare is a small Raglstration Fee for all non-credit courses with the excapt.tw of An- ^' l jucation and Adult Hl^ School for which there is no cost. There Is no charge for Senior Citizens 65 or 0 der. a 1 i of ^40.00 is charge^ adult students enrolling In the AduH Drivers Training. (High School students sixteen years of ^9^ or oider are PrmiM to enroll with written approval from the appropriate public school official m any cwr M ,) pm so Adu t Driver s Tralmng.) Tuition for a Non-Resident of North Carolina for Non-Credit pourses is the same ..n ho .u. ^  .  Nodh Carolina.</p>
        <p>NON-CREDIT COURSES CAMPUS A^EA -</p>
        <p>Course Title</p>
        <p>Cost</p>
        <p>Hours</p>
        <p>Begins</p>
        <p>Tima</p>
        <p>Day(s)</p>
        <p>Room</p>
        <p>Course title</p>
        <p>..ost r*</p>
        <p>.;r .</p>
        <p>-iegins</p>
        <p>Time</p>
        <p>Naoai</p>
        <p>AduK Basic Education</p>
        <p>Nona</p>
        <p>06</p>
        <p>12n</p>
        <p>8:30 am</p>
        <p>M&amp;amp;W</p>
        <p>T-14</p>
        <p>Auto Safety Inspec or Tram ng</p>
        <p>i: </p>
        <p>1/13</p>
        <p>1-4</p>
        <p>W</p>
        <p>IM66B</p>
        <p>12:30</p>
        <p>Auto Safely lu'-pecte Tra'i"o</p>
        <p>f.r</p>
        <p>2/10</p>
        <p>1-4</p>
        <p>HI</p>
        <p>-105B</p>
        <p>Adult Basic Education</p>
        <p>Nona</p>
        <p>54</p>
        <p>12</p>
        <p>8-6pm</p>
        <p>M&amp;amp;W</p>
        <p>T-14</p>
        <p>Aviation Groun'1&amp;lt;Si,nooi</p>
        <p>1 w- .</p>
        <p>CiiJ</p>
        <p>1/12</p>
        <p>7-10</p>
        <p>TtIN</p>
        <p>IM13</p>
        <p>Adult Basic Education</p>
        <p>Nona</p>
        <p>54</p>
        <p>12/2</p>
        <p>8-10 pm</p>
        <p>M&amp;amp;W</p>
        <p>T-14</p>
        <p>Bo'it.rg al</p>
        <p>-."j</p>
        <p>/</p>
        <p>1/12</p>
        <p>7:30-</p>
        <p>TU</p>
        <p>T2t*1</p>
        <p>Adult Basle Education</p>
        <p>Nona</p>
        <p>66</p>
        <p>12/1</p>
        <p>8:30 am</p>
        <p>T&amp;amp;TH</p>
        <p>T-14</p>
        <p>. r</p>
        <p>9:30 pm</p>
        <p>M02</p>
        <p>12:30</p>
        <p>Caup O'C^.ionq ' </p>
        <p>30</p>
        <p>14</p>
        <p>7-10</p>
        <p>M</p>
        <p>AduH Basic Education</p>
        <p>Nona</p>
        <p>54</p>
        <p>12/3</p>
        <p>oepm</p>
        <p>T&amp;amp;TH</p>
        <p>T-14</p>
        <p>CPR  ^</p>
        <p>0</p>
        <p>1/11</p>
        <p>7-10</p>
        <p>M,T&amp;amp;TN</p>
        <p>MM</p>
        <p>Adult Baaic Education</p>
        <p>NOM</p>
        <p>54</p>
        <p>12.</p>
        <p>8-10 pm</p>
        <p>T&amp;amp;TH</p>
        <p>T-14</p>
        <p>Creative #n;ing  ' - -</p>
        <p>?ilC </p>
        <p>30</p>
        <p>1/7</p>
        <p>7-10</p>
        <p>7H^</p>
        <p>mMo</p>
        <p>(Th# above are PLATGBasad program^</p>
        <p>Crea' vP .Vfitm.g, .&amp;gt;^uelry - . a</p>
        <p>2 uC</p>
        <p>30</p>
        <p>1/5</p>
        <p>7-10</p>
        <p>W</p>
        <p>Vi.</p>
        <p>AduK Basic Education</p>
        <p>Nona</p>
        <p>60</p>
        <p>12/2</p>
        <p>7-10 pm</p>
        <p>M&amp;amp;W</p>
        <p>H-123</p>
        <p>Bas.c</p>
        <p>pwo</p>
        <p>AduH Basic Education</p>
        <p>Nona</p>
        <p>60</p>
        <p>12/1</p>
        <p>7-10 pm</p>
        <p>T&amp;amp;TH</p>
        <p>T-16</p>
        <p>Elfective 'eachino T iinq</p>
        <p>1 hp.</p>
        <p>30</p>
        <p>1/4</p>
        <p>7-10</p>
        <p>M</p>
        <p>H41S</p>
        <p>AduH Basic Education</p>
        <p>Nona</p>
        <p>46</p>
        <p>1/6</p>
        <p>8:30 am</p>
        <p>F</p>
        <p>T-14</p>
        <p>Effective Tea'h ng Tfar nq</p>
        <p>30</p>
        <p>1/6</p>
        <p>4-7</p>
        <p>V</p>
        <p>(M2t</p>
        <p>12:30</p>
        <p>EMT (Basic; V</p>
        <p>16 Ct'</p>
        <p>124</p>
        <p>2/2</p>
        <p>7-10</p>
        <p>fum</p>
        <p>21</p>
        <p>AduH Basic Education</p>
        <p>Nona</p>
        <p>64</p>
        <p>12/1</p>
        <p>8am-12</p>
        <p>M-F</p>
        <p>E-LC</p>
        <p>FMf (=&amp;gt;eire'f&amp;gt;e*</p>
        <p>- *0</p>
        <p>3*1</p>
        <p>11/5</p>
        <p>7-10 </p>
        <p>t&amp;amp;tm</p>
        <p>W221</p>
        <p>AduH Basic Education</p>
        <p>Nona</p>
        <p>164</p>
        <p>1/4 .</p>
        <p>8am-12</p>
        <p>M-F</p>
        <p>E-LC ! </p>
        <p>Fiff? A.' ;</p>
        <p>U ,i </p>
        <p>. 9</p>
        <p>1/16</p>
        <p>7-10</p>
        <p>M.TITH</p>
        <p>T17-1</p>
        <p>AduH Driver Training</p>
        <p>40.00</p>
        <p>60</p>
        <p>1/4</p>
        <p>7-10</p>
        <p>M&amp;amp;W</p>
        <p>T-13</p>
        <p>/</p>
        <p>-</p>
        <p>M&amp;amp;W</p>
        <p>N&amp;gt;113</p>
        <p>AduH High School</p>
        <p>Nona</p>
        <p>64</p>
        <p>12/1</p>
        <p>8am-12</p>
        <p>M-F</p>
        <p>E-LC '</p>
        <p>l.ncorue jos irersunoii</p>
        <p>..'11</p>
        <p>7-10</p>
        <p>AduH High School</p>
        <p>Nona</p>
        <p>24</p>
        <p>12</p>
        <p>5:30-</p>
        <p>M&amp;amp;W</p>
        <p>E-LC</p>
        <p>liitericr ecoratinq . .</p>
        <p>2 y</p>
        <p>aO</p>
        <p>1/5</p>
        <p>7-10</p>
        <p>TU</p>
        <p>T2t-2</p>
        <p>9:30 pm</p>
        <p>fmro %M)eiCgmputefe</p>
        <p>15 00 '</p>
        <p>12</p>
        <p>11/30</p>
        <p>3-5</p>
        <p>H434</p>
        <p>AduH High School</p>
        <p>Nona</p>
        <p>26</p>
        <p>12/1</p>
        <p>5:30-</p>
        <p>T&amp;amp;TH</p>
        <p>E-LC</p>
        <p>Investments Securit.</p>
        <p>'&amp;gt;n no</p>
        <p>12</p>
        <p>1/11</p>
        <p>2-4</p>
        <p>M</p>
        <p>H-123</p>
        <p>9:30 pm</p>
        <p>,</p>
        <p>Inveatments &amp;amp; S9curi..s.".</p>
        <p>?5 3</p>
        <p>12</p>
        <p>1/11</p>
        <p>^9 w</p>
        <p>H-2N</p>
        <p>AduH High School</p>
        <p>Nona</p>
        <p>164</p>
        <p>1/4</p>
        <p>8am-12</p>
        <p>M-F</p>
        <p>E-LC</p>
        <p>Prepared Childbrntt'Pliase CjaH</p>
        <p>'56-3130</p>
        <p>. Ext.</p>
        <p>317 to preroglster.</p>
        <p>11461</p>
        <p>AduH High School</p>
        <p>Nona</p>
        <p>66</p>
        <p>1/4</p>
        <p>5:30-</p>
        <p>M&amp;amp;W</p>
        <p>E-LC</p>
        <p>Sevring I</p>
        <p>30</p>
        <p>1/6</p>
        <p>6:30-</p>
        <p>W</p>
        <p>9:30 pm</p>
        <p>9:30</p>
        <p>AduH High School</p>
        <p>Nona</p>
        <p>64</p>
        <p>1/5</p>
        <p>5:30-</p>
        <p>T&amp;amp;TH</p>
        <p>E-IC</p>
        <p>Seeing ii .</p>
        <p>114</p>
        <p>6:30-</p>
        <p>M</p>
        <p>9:30 pm</p>
        <p>9:30</p>
        <p>W4B1</p>
        <p>AduH High School '</p>
        <p>Nona</p>
        <p>54</p>
        <p>12/3</p>
        <p>7-10 pm</p>
        <p>T&amp;amp;TH</p>
        <p>T-13</p>
        <p>Sewing (Advanced)</p>
        <p>3C</p>
        <p>1/5</p>
        <p>6:30-</p>
        <p>TO</p>
        <p>Art: Oil Painting</p>
        <p>25.00</p>
        <p>30</p>
        <p>1/4</p>
        <p>7-10</p>
        <p>M</p>
        <p>W-215</p>
        <p>9:30</p>
        <p>VW23</p>
        <p>Auto Safety Inspector Training15.00</p>
        <p>4</p>
        <p>12</p>
        <p>1-4</p>
        <p>W</p>
        <p>W-105B</p>
        <p>Small Engine Reoair</p>
        <p>li.Oh</p>
        <p>30</p>
        <p>1/6</p>
        <p>7-10</p>
        <p>W</p>
        <p>THE SMALL BUSINESS CENTER</p>
        <p>The Small Business Center is preparing Workshops and Courses for Cosmetologists, Child Cafi Attendants and persons working in the Hotel/Motei industry,</p>
        <p>FOR FURTHER INFORMATION P F AS: Al</p>
        <p>756-3130 Ext. T'</p>
        <p>NOtK:REOIT COURSES CAMPUS AREA</p>
        <p>Course THIe</p>
        <p>Coat</p>
        <p>Hours</p>
        <p>Begins</p>
        <p>Time 1</p>
        <p>Day(s)</p>
        <p>Room</p>
        <p>SMALL BUSINESS CLASSES</p>
        <p>IRS Business Tax Seminar</p>
        <p>Nona</p>
        <p>6</p>
        <p>2/4</p>
        <p>TH</p>
        <p>E-14S</p>
        <p>IRS Business Tax Seminar</p>
        <p>Nonv</p>
        <p>6</p>
        <p>3/3</p>
        <p>94</p>
        <p>TH</p>
        <p>E-145</p>
        <p>Notary Public Education</p>
        <p>15.00</p>
        <p>4</p>
        <p>12/1</p>
        <p>6-10</p>
        <p>TU</p>
        <p>W-213</p>
        <p>Notary Public Education</p>
        <p>15.00</p>
        <p>4</p>
        <p>1/5</p>
        <p>6-10</p>
        <p>TU</p>
        <p>W-221</p>
        <p>Notary Public Education</p>
        <p>15.00</p>
        <p>4</p>
        <p>2/2</p>
        <p>6-10</p>
        <p>TU</p>
        <p>W-221</p>
        <p>Notary Public Education</p>
        <p>15.00</p>
        <p>4</p>
        <p>3/8</p>
        <p>6-10</p>
        <p>TU</p>
        <p>W-221</p>
        <p>Marketing For Small Bus.</p>
        <p>15.00</p>
        <p>18</p>
        <p>1/13</p>
        <p>7-10</p>
        <p>W</p>
        <p>VW-07</p>
        <p>Salosmanship</p>
        <p>15.00</p>
        <p>18</p>
        <p>1/14</p>
        <p>7-10</p>
        <p>TH</p>
        <p>T21-2</p>
        <p>Starting A Small Bus.</p>
        <p>15.00</p>
        <p>18</p>
        <p>1/11</p>
        <p>7-10</p>
        <p>M</p>
        <p>VW-10</p>
        <p>Small Bus. Bookkaaping</p>
        <p>15.00</p>
        <p>18</p>
        <p>1/12</p>
        <p>7-10</p>
        <p>TU</p>
        <p>VW-10</p>
        <p>NON-CREDIT COURSES GREENVILLE AREA</p>
        <p>Course THIa</p>
        <p>Cost</p>
        <p>Hours</p>
        <p>Bogins</p>
        <p>Time</p>
        <p>Day(8)</p>
        <p>Site</p>
        <p>AduH Basle Education</p>
        <p>Non#</p>
        <p>54</p>
        <p>12</p>
        <p>3:30-</p>
        <p>5:30</p>
        <p>M&amp;amp;W</p>
        <p>ECU-</p>
        <p>B103C</p>
        <p>AduH Basic Education</p>
        <p>Nont</p>
        <p>60</p>
        <p>11/30</p>
        <p>9-12</p>
        <p>M&amp;amp;W</p>
        <p>SGRD</p>
        <p>AduH Basic Education</p>
        <p>Nonv</p>
        <p>60</p>
        <p>12/7</p>
        <p>6:30-</p>
        <p>9:30</p>
        <p>M&amp;amp;W</p>
        <p>SGRO</p>
        <p>AduH Basic Education</p>
        <p>Nono</p>
        <p>60</p>
        <p>12/1</p>
        <p>9-12</p>
        <p>T&amp;amp;TH</p>
        <p>SGRD</p>
        <p>AduH Basic Education</p>
        <p>Nono</p>
        <p>60</p>
        <p>110</p>
        <p>6:30-</p>
        <p>9:30</p>
        <p>T&amp;amp;W</p>
        <p>FCH</p>
        <p>AduH Basic Education</p>
        <p>Nono</p>
        <p>60</p>
        <p>12/1</p>
        <p>6:30-</p>
        <p>9:30</p>
        <p>T&amp;amp;TH</p>
        <p>WMS</p>
        <p>AduH High School</p>
        <p>Nono</p>
        <p>60</p>
        <p>12/7</p>
        <p>6:30-</p>
        <p>9:30</p>
        <p>M&amp;amp;W</p>
        <p>SGRD</p>
        <p>AduH High School</p>
        <p>Nono</p>
        <p>60</p>
        <p>12rt</p>
        <p>6:30-</p>
        <p>T&amp;amp;TH</p>
        <p>WMS</p>
        <p>)</p>
        <p>9:30</p>
        <p>Arfc Calligraphy</p>
        <p>25.00</p>
        <p>24</p>
        <p>1/14</p>
        <p>6:30-</p>
        <p>9:30</p>
        <p>TH</p>
        <p>GRD</p>
        <p>Art Drawing &amp;amp; Painting</p>
        <p>25.00</p>
        <p>36</p>
        <p>1/14</p>
        <p>6:30-</p>
        <p>9:30</p>
        <p>TH</p>
        <p>GRD</p>
        <p>Art Drawing &amp;amp; Patiala</p>
        <p>25.00</p>
        <p>36</p>
        <p>1/12</p>
        <p>9-12</p>
        <p>TU</p>
        <p>GRD</p>
        <p>Art Oil Painting</p>
        <p>25.00</p>
        <p>36</p>
        <p>1/11</p>
        <p>9-12</p>
        <p>12:30-2:30</p>
        <p>M</p>
        <p>GRD</p>
        <p>Art: Oil Painting</p>
        <p>25.00</p>
        <p>36</p>
        <p>1/14</p>
        <p>9-12</p>
        <p>12:30-2:30</p>
        <p>TH</p>
        <p>GRD</p>
        <p>Art: Stained Glass</p>
        <p>25.00</p>
        <p>36</p>
        <p>1/12</p>
        <p>6:30-</p>
        <p>9:30</p>
        <p>TU</p>
        <p>GRD</p>
        <p>Art Watar Color Painting</p>
        <p>25.00</p>
        <p>38</p>
        <p>1/11</p>
        <p>6:30-</p>
        <p>9:30</p>
        <p>M</p>
        <p>GRD</p>
        <p>Art Watar Color Painting</p>
        <p>25.00</p>
        <p>36</p>
        <p>1/13</p>
        <p>9-12</p>
        <p>W</p>
        <p>GRD</p>
        <p>Baakot Making &amp;amp; Chair Making</p>
        <p>25.00</p>
        <p>36</p>
        <p>1/11</p>
        <p>6:30-</p>
        <p>9:30</p>
        <p>M</p>
        <p>GRD</p>
        <p>Cooking: 60 Minuto</p>
        <p>25.00</p>
        <p>24</p>
        <p>1/12</p>
        <p>7-10</p>
        <p>TU</p>
        <p>KC</p>
        <p>Cooking: 60 Minute</p>
        <p>25.00</p>
        <p>24</p>
        <p>1/14</p>
        <p>10-1</p>
        <p>TH</p>
        <p>KC</p>
        <p>FumHuro Uphoiilary</p>
        <p>60</p>
        <p>1/4</p>
        <p>7-10</p>
        <p>M&amp;amp;W</p>
        <p>PCC 5lh St. Annex</p>
        <p>FumHuro Upholatery</p>
        <p>60</p>
        <p>1/5</p>
        <p>7-10</p>
        <p>T&amp;amp;TH</p>
        <p>PCC 5lh St. Annex</p>
        <p>Pottery</p>
        <p>25.00</p>
        <p>30</p>
        <p>1/4</p>
        <p>7-10</p>
        <p>M</p>
        <p>RHS</p>
        <p>Sowing</p>
        <p>25.00</p>
        <p>40</p>
        <p>1/4</p>
        <p>9-12</p>
        <p>M</p>
        <p>SGRO</p>
        <p>12:30-U0</p>
        <p>Sowing</p>
        <p>25.00</p>
        <p>40</p>
        <p>1/5</p>
        <p>10-12</p>
        <p>TU</p>
        <p>SGRD</p>
        <p>12:30-2:30</p>
        <p>Sowing</p>
        <p>25.00</p>
        <p>40</p>
        <p>1/7</p>
        <p>9-12</p>
        <p>TH</p>
        <p>SGRD</p>
        <p>12:30-10</p>
        <p>Watving</p>
        <p>25.00</p>
        <p>40</p>
        <p>1/11</p>
        <p>19-12</p>
        <p>M</p>
        <p>GRD</p>
        <p>A</p>
        <p>12:30-2:30</p>
        <p>Waaving</p>
        <p>25.00</p>
        <p>40</p>
        <p>1/13</p>
        <p>10-12</p>
        <p>W</p>
        <p>GRD</p>
        <p>KC-Kltehan Cupboard</p>
        <p>12:30-2:30</p>
        <p>N</p>
        <p>.-F.-COURSES AYDEN AREA</p>
        <p>CoufMf J.itle 1</p>
        <p>Cost</p>
        <p>Hours</p>
        <p>Begins</p>
        <p>ThM</p>
        <p>Adult Basi</p>
        <p>4</p>
        <p>1/6</p>
        <p>1M2 :</p>
        <p>(AduWiiiasic .-n</p>
        <p>.  None</p>
        <p>to</p>
        <p>12/1</p>
        <p>64</p>
        <p>Adult HiC' '</p>
        <p>f.ne</p>
        <p>60</p>
        <p>12/1</p>
        <p>64 .</p>
        <p>Sewing</p>
        <p>36</p>
        <p>1/7</p>
        <p>6-10</p>
        <p>ACB\ 'f AHA---.</p>
        <p>OAC .</p>
        <p>I r</p>
        <p>Co.,r':v Adult I33--</p>
        <p>Acu ' '</p>
        <p>SQRO-South OrNiwilto Racraation DapL WMS-Wallcoma MIddIa School ' RHS-Rom High School-Art Roqai PCH-FlynnChriatlonHoiiia ECU-Brataalor RulMtaa, NmbMIM PCC-r**  T</p>
        <p>ecu ' Adi Eg</p>
        <p>ftON CREDIT COURSES CHICOD AR'V ^</p>
        <p>Cost</p>
        <p>Ncir</p>
        <p>Houfs B^ins  Timo _</p>
        <p>60  12J3  S;30&amp;gt;</p>
        <p>CES</p>
        <p>di'</p>
        <p>60</p>
        <p>12/3</p>
        <p>PEC</p>
        <p>' !'v SchoT</p>
        <p>9:30 CA</p>
        <p>CN CRtQ., COURSES FARMVILLE AREA</p>
        <p>c.</p>
        <p>Course</p>
        <p>'  Cost</p>
        <p>Hours</p>
        <p>Begins</p>
        <p>timm d</p>
        <p>Adult B ^ :; '*ii,it)on</p>
        <p>None</p>
        <p>60</p>
        <p>11/30</p>
        <p>9-1t"|</p>
        <p>Adult F '' - .-Iira'ion</p>
        <p>None</p>
        <p>60</p>
        <p>12rt ^</p>
        <p>7-10 r i</p>
        <p>Adult Hiq.n Sc-hoOl</p>
        <p>None</p>
        <p>60</p>
        <p>12rt</p>
        <p>7-10 . j</p>
        <p>Sewing</p>
        <p>25.00</p>
        <p>36</p>
        <p>1/14</p>
        <p>9-12 m</p>
        <p>Sewing</p>
        <p>2S.00</p>
        <p>36</p>
        <p>1/11</p>
        <p>7-10 "</p>
        <p>FCB~Fa,'riviilii Coningudtt,</p>
        <p>SuUdirq</p>
        <p>Cl EDIT COURSES PACTOLUS AREA</p>
        <p>Adua 6.i&amp;gt; .  .</p>
        <p>Ayaii ah r 'H.' PEs- oil) r</p>
        <p>"Dst-  Hours  Begins</p>
        <p>'^one  60.  1/13</p>
        <p>Ncne  SO  1/13</p>
        <p>Ti</p>
        <p>hoo</p>
        <p>NON-CREDIT COURSES SIMPSON AREA Course Title  _  Cost  Hours  Begins</p>
        <p>Adult Basic E:liiC1)0n  None  60  1/11</p>
        <p>Adult HIgti Scnooi  None  60  1/11</p>
        <p>SCBSimpscn Community Building</p>
        <p>NON CREDIT COURSES GRIFTON AREA</p>
        <p>Course tme</p>
        <p>Cost</p>
        <p>Hours</p>
        <p>Begins</p>
        <p>Tim*.</p>
        <p>A tF ''</p>
        <p>None</p>
        <p>66</p>
        <p>11/30</p>
        <p>9a&amp;lt;w1|</p>
        <p>Alui (  ic durgt L 1</p>
        <p>None</p>
        <p>wt, 1 e</p>
        <p>Adult Hlqh School</p>
        <p>unmo-</p>
        <p>Basket Making</p>
        <p>25 0)</p>
        <p>60</p>
        <p>12/1</p>
        <p>m</p>
        <p>Oil Painting</p>
        <p>25.00</p>
        <p>30</p>
        <p>TBA</p>
        <p>QCCGnfton Civic Centef</p>
        <p>GES-Griflt'P Elcmentarv School</p>
        <pb facs="00096780_0010" />
        <p>1</p>
        <p>iiM Pitt Community</p>
        <p>Coilese</p>
        <p>^pMduig Com Clioim Schedule of_Courses</p>
        <p>Day and Evening</p>
        <p>Winter Quarter</p>
        <p>1987 -1988</p>
        <p>Monday, Novenbei 30,1987</p>
        <p>through Thursday, February 25,1988</p>
        <p>756-3130</p>
        <p> Pitt Community CoHege-</p>
        <p>PerniHs An Individual To:</p>
        <p> Enroll in selected short courses.</p>
        <p> Enroll In a combination of regular quarter length courses and selected short courses.</p>
        <p> Enroll in a program that can result in a reduced course load in the quarters that follow.</p>
        <p> Enroll in a course to remove a deficiency that would prevent you from entering a four year school</p>
        <p> Enroll In ^ many or as few courses as you wish .</p>
        <p>Day Registration</p>
        <p>Registration: Monday, November 30, 1087 Through Thursday, December 3,1087.</p>
        <p>Late Registration Fee Of $5.00 Beginning Wedneeday, December 2,1087.</p>
        <p>Last Day To Register Thursday, December 3,1087.</p>
        <p>First Day Of Ciass: Tuesday, December 1,1087.</p>
        <p>Day And Evening Tuition:</p>
        <p>$6.25 Per Credit Hour. $75 Maximum Tuition.</p>
        <p>For Non-Resident Of N.C.: $58.50 Per Credit Hour. $702.01 Maximum Tuition.</p>
        <p>Activity Fee: $6.00</p>
        <p>Students May Register For As Many Or As Few Courses As They Wish.</p>
        <p>Technicai And Vocationai Courses.</p>
        <p>Curriculum Courses Approved For V.A. Benefits.</p>
        <p> Evening Credit Courses-</p>
        <p>Registration informotion</p>
        <p>1. Evening Registration And Payment Of Fees Is On ber 30,1087 From 6 p.m. To 8:15 p.m.</p>
        <p>2. Registration Location For December 1-3 Is In The Student Lounge Of Vernon White Building.</p>
        <p>3. Late Registration And Drop Add Begins In The Evening On December 2,1987 From 6 p.m. To 8:15 p.m.</p>
        <p>4. Last Evening To Register Or Drop Add Is December 3 From 6 p.m. To 8:15 p.m.</p>
        <p>5. Evening Classes Begin On December 1,1087.</p>
        <p>6. It Is Important To Como Prepared To Pay Foes At The Time Of Registration.</p>
        <p>Evening counaeUDglSJnnllableJorboth preeenlendtutuiwehi-dsnts to aaalst them in course selection and career planning on Monday through Thursday evenings from 5KN) p.m. to 8:30 pjOL For more Information call PHt Community College, 768-3130, ext 246.</p>
        <p>.rmt</p>
        <p>llBLAX..JIIDBOReAT</p>
        <p>hworoatbm</p>
        <p>TAiiiPMiPOC</p>
        <p>nr 7iM!S4S 9:M ;1MS;1I:M    1  S</p>
        <p>rmm tm \m ism lUiSi I iet tise I i:se t eiss</p>
        <p>DDfl'f</p>
        <p>Forget</p>
        <p>i</p>
        <p>RMiiMilMr I Mfig yw SeeM SMufNy Nm nSftM.</p>
        <p>Title DC omI 604 CoofdlMtore Per Omdt  .</p>
        <p>rt IfT*"* ^  ^</p>
        <p>' fmdrnm Acf 8illHy Be ef AiMtHhMim Swvlcet</p>
        <p>' . ')</p>
        <p>COUTM</p>
        <p>Cram</p>
        <p>TMt</p>
        <p>AGRICULTURE</p>
        <p>AOniie  FtmiWvldtao..............  J  TTJi</p>
        <p>AOnin%  Far* And Hone ConUrveUoM..........I  M</p>
        <p>AOniU  Oontiol MomcnNnrn...........  9  W  6:8M:20ra</p>
        <p>AOnaiS  FamillaoMmrynipilrAllilnL........3  W  MOaSOPM</p>
        <p>-AIR CONDITIONINQ, HEATING &amp;amp; REPRIGERATIQN</p>
        <p>AHR106  Arch Utoch Equip............  .4  TTh  1*^</p>
        <p>rnnOipiM Ul nNlmM   ...............^</p>
        <p>Intro TO Cool A Heat Systems.........6</p>
        <p>AHnZOI</p>
        <p>AHR1102</p>
        <p>AHR1115  FufklamePtals Of Heating  .....4</p>
        <p>AHR 1123  Principles Of Air Conditioning........7</p>
        <p>DFT1116  BIprt Read: Air Condition.............2</p>
        <p>0R111I  BIpftlbadrAlrCendWon..............2</p>
        <p>-Anthropology, history</p>
        <p>MF 8:00-11:50 AM W mia-iOAM TTh, 8.-00-11:50AM MWF 8.-00-12:50AM TTh 12)-1:50PM TH - 8:30-10:20 PM</p>
        <p>ANT 150* HIS 150* HIS 151* HIS 161* H101* POL 102 POL 102 POL 150*</p>
        <p>REL150*</p>
        <p>POLITICAL SCIENCE A RELIGION</p>
        <p>Intro To Anthropotogy...............5 M-F 9:00-9:50 AM</p>
        <p>American History 1..................5</p>
        <p>American History II.................5</p>
        <p>History Of Europa Since 1500.........5</p>
        <p>Hielory Of Europe Sinee 1500..........S</p>
        <p>National Qovemnent. ...........3</p>
        <p>National Government................3</p>
        <p>Intro To U.S. Government............5</p>
        <p>Intro To Religion...................5</p>
        <p>ARCHITECTURE</p>
        <p>M-F 9:004:50 AM M-F 10:00-10:50 AM M-F 12:00-12:50 PM TTh</p>
        <p>MWF 10^)0-10:50 AM TWTh 3^103:50 PM MTThF 100-10:50AM W 10:00-10:50 AM M-F 1:00-1:50 PM</p>
        <p>ARC 104  Afch Drafting.......................2</p>
        <p>ARC 106  ArchDiatling.......................2</p>
        <p>ARC 107  Architectural  Drafting...............4</p>
        <p>ARC 221  ArchitacturU  Drafting...............5</p>
        <p>T  Od)04:SOPM</p>
        <p>T  O.'OOASOPM</p>
        <p>MW  1:004:50 PM</p>
        <p>F  1)-2)PM</p>
        <p>MW  8K)0-11:50AM</p>
        <p>F  8^)0-10:50 AM</p>
        <p>TTh 11:00-11:50 AM TTh  0K)M:50PM</p>
        <p>M-F 12:00-12:50 PM TTh 8;(I0-10:50AM</p>
        <p>PME1100</p>
        <p>PME1102</p>
        <p>Basic Auto Mainlananea..............1</p>
        <p>Electrical Systems  ............9</p>
        <p>ARC 233  Office Practice Seminw..............2</p>
        <p>aVIOl  Surveying..........................4</p>
        <p>CIV 216  Strength Of Materials................4</p>
        <p>DR 235  Codes, Specif, &amp;amp; Contract Daeum 4</p>
        <p>-AUTOMOTIVE, DIESEL MECHANICS-</p>
        <p>PME1046  ShopPracAToolOper...............5  ^  i^lloPM</p>
        <p>F  1040-11:50 AM</p>
        <p>T  7404:50 PM</p>
        <p>TTh  840-9:50 AM</p>
        <p>F 8404.-50AM MW  840-1140 AM</p>
        <p>TTh  1040-1140 AM</p>
        <p>MWTh  1040-1140 AM</p>
        <p>T  1040-10:50 AM</p>
        <p>W  7404:50 PM</p>
        <p>M-F  840450 AM</p>
        <p>M  8404:50 AM</p>
        <p>TTh  1140-11:50 AM</p>
        <p>W  840-9:50 AM</p>
        <p>TThF  840-10:50 AM</p>
        <p>M  940-1140 AM</p>
        <p>M  740450 PM</p>
        <p>M-F 240450PM MW  140-2:50 PM</p>
        <p>PME1106  Fund Of Diesel Engines..............3</p>
        <p>PME1120  Computar Whsel AMgnmem...........1</p>
        <p>PME 1137  Basic Power Transmissions..........6</p>
        <p>PME 1202  Electricity Electronics...............8</p>
        <p>PME 1208  Specialized Auto Electronics.........2</p>
        <p>PME1209  SpedaNndAtttaEleclronlesN.........2</p>
        <p>MAT 1101  Fundamentals Of Math..............5</p>
        <p>MEC1112  Mach Shop Ptocass.................2</p>
        <p>Principles Of  Accounting............4</p>
        <p>Principles Of  Accounting............4</p>
        <p>Principles Of  Accounting............4</p>
        <p>Principles Of  Accounting............4</p>
        <p>ACT 150* ACT 150* ACT 150* ACT 150*</p>
        <p>ACT150* Principles Of /</p>
        <p>ACT 151*  Principles Of Accounting............4</p>
        <p>ACT 151 *  Principies Of Accounting............4</p>
        <p>ACT 151*  Prlneiptas Of AcoounUng.............4</p>
        <p>ACT 152*  Principles Of Accounting............4</p>
        <p>ACT 152*  Prlneiptas 01 Acoounliiig.............4</p>
        <p>BUS 102%  Beginning Typewriting...............3</p>
        <p>8118102%  Beginning TypewrMng...............8</p>
        <p>BUS 103 BUS 103 BUS 104 BUS 106</p>
        <p>Intermediate Typewriting............3</p>
        <p>Tawi^^ralilfhfi  S</p>
        <p>lyywwmn^.</p>
        <p>Advanced Typewriting...............3</p>
        <p>Beginning Shorthand................7</p>
        <p>BUS 110%  Electronic Calculator................3</p>
        <p>BUS 110%  Eieetionie CUeutalor.................3</p>
        <p>8118110%  Etoctionic Caleutatar.................3</p>
        <p>BUS 110%  Eloclranie Catailetar.................3</p>
        <p>BUS 110%  Etoekonic Caleutatar.................3</p>
        <p>BUS 113  Machine Transcription I..............5</p>
        <p>BUS 113  Machine Transcription 1..............5</p>
        <p>BUS 114  Machina Transcription II.............5</p>
        <p>BUS 117  Electronic Calculator. Sec............3</p>
        <p>BUS 117  Electronic Calculator Sec............3</p>
        <p>BUS 123  Business Finance............  3</p>
        <p>BUS 140  Lotas 1-24.........................3</p>
        <p>BUS 140  Lotas 1-24.........................3</p>
        <p>BUS 141  Dbase III..........................3</p>
        <p>BU8148  Risk MgnUbiK CiedN UnioiM..........3</p>
        <p>BU8140  Economics: CredU Unions.............4</p>
        <p>BUS 156  Cash Register Electonic.............1</p>
        <p>BU81S5  Cish Reglstar EtaeUenlc.............1</p>
        <p>BUS 155  Cash RogiataR EtoeMaie.............1</p>
        <p>BUS 155  Caah RagtataR Etadrwilc.............1</p>
        <p>BU8155  Cash RegletaR Eleelroaie.............1</p>
        <p>BUS 165*  Introduction To Businees............5</p>
        <p>BUS 166  Business Law 1.....................3</p>
        <p>BUS 186*  Business Law 1.....................3</p>
        <p>BUS 166*  Business Law I.............  3</p>
        <p>BUS 101  BusinassLawl......................3</p>
        <p>BUS 167*  Business Law II....................3</p>
        <p>BUS 117*  Bustaasa Law I. ...................3</p>
        <p>BUS 170  Intro To Micro Comp Application......3</p>
        <p>BUS 170  Intro To Micro Comp A^lcation......3</p>
        <p>BUS170  Intro To Micro Comp Application......3</p>
        <p>BUS 171  WordProclBhVPCDia^aywiVII.......3</p>
        <p>BU8171  WtadPtoeMIIPCOIipiaywrW.........3</p>
        <p>BUS184M  Term &amp;amp;Vocab: Medical 1.............3</p>
        <p>MI184M  TanB.AndVeoafeclladteall..%.........3</p>
        <p>BU818SM  TanaAadVeeabclladtaall............3</p>
        <p>BUS 188  Medical Transcription 1..............5</p>
        <p>BUS 189  Medical Transcription II..............5</p>
        <p>IU6191  Etaetronle Kayhoardtag...............3</p>
        <p>BU6HI---word Ptocesiing Applications 1.......3</p>
        <p>IUSlt2  Vferd Piaeaasliig AppltaaUem 1........3</p>
        <p>BU8192  word Proeaialag ApsBeaUena 1........3</p>
        <p>IU8192  Word Frocooileg AppOcaUooo 1........3</p>
        <p>M8192  WordProoaadauApsitealloml........3</p>
        <p>BUS 193  Word Procasaing ^ic II............3</p>
        <p>BUS193  WordPtooaaoingAi^l.............3</p>
        <p>UUS133  ward PioeeeMag Apple I ....3</p>
        <p>UUS133  Word Proemial Ipplol.............3</p>
        <p>BUI193  WordPtooaaataiA^I.............3</p>
        <p>BUS 194  Word Processing: Report Pack........3</p>
        <p>maam  iaaam     Imi  Bmmfr  ft</p>
        <p>BUS 114 woiu  iniofi  rm.........</p>
        <p>BU8194  Word ProeaMiiiffltapart Pack.........3</p>
        <p>BUS 214  Buslrwat Samlnar..................2</p>
        <p>BUS 216  Offica Procadurw..................5</p>
        <p>BUS 216'  Office Prooaduraa..................5</p>
        <p>BUS 222  Intennadlata Accounting.............6</p>
        <p>Mil 222 BUS 225 BUS 232 BUS 235 MIS 231 BUS 241 8111341 BUS 243 MIS 241 BUS 248</p>
        <p>Cost Accotaitlng Oamtap</p>
        <p>Businees Managamant..............3</p>
        <p>MnJngAnd MarehiiiMMM^^^  .3</p>
        <p>ARQ  ft</p>
        <p>Arhmlalng........................4</p>
        <p>AdwiUidag  .................4</p>
        <p>Medicai Insurance..................3</p>
        <p>EC0150%*  Eoonomica 1.......................3</p>
        <p>EC0151*  Eoonomica.N.......................3</p>
        <p>EG0181*  Econmica H.......................3</p>
        <p>K01I1*</p>
        <p>1........................1</p>
        <p>M-F</p>
        <p>*008:50 AM</p>
        <p>M-F</p>
        <p>10801080AM</p>
        <p>MF</p>
        <p>18O180PM</p>
        <p>MT</p>
        <p>10801080AM</p>
        <p>WF</p>
        <p>108010:50 AM</p>
        <p>Th</p>
        <p>10801080AM</p>
        <p>TTh</p>
        <p>780*30 PM</p>
        <p>M-F</p>
        <p>108010-80AM</p>
        <p>M-F</p>
        <p>18O180PM</p>
        <p>MW</p>
        <p>780*30 PM</p>
        <p>M-F</p>
        <p>128012:50 PM</p>
        <p>MW</p>
        <p>780*30 PM</p>
        <p>M-F</p>
        <p>8808:50 AM</p>
        <p>MW</p>
        <p>780*30 PM</p>
        <p>MW</p>
        <p>4.80*30 PM</p>
        <p>M-F</p>
        <p>118011:50 AM</p>
        <p>M-F</p>
        <p>18O180PM</p>
        <p>TTh</p>
        <p>780*30 PM</p>
        <p>M-F</p>
        <p>10801080AM</p>
        <p>M-F</p>
        <p>980*50 AM</p>
        <p>M-F</p>
        <p>128O1280PM</p>
        <p>TBA</p>
        <p>M</p>
        <p>680*50 PM</p>
        <p>T</p>
        <p>680*50 PM</p>
        <p>W</p>
        <p>680*60 PM</p>
        <p>Th</p>
        <p>680*50 PM</p>
        <p>M-F</p>
        <p>*00*50 AM</p>
        <p>M-F</p>
        <p>10801*50 AM</p>
        <p>F</p>
        <p>1801:50 PM</p>
        <p>MW</p>
        <p>180-280 PM</p>
        <p>M-F</p>
        <p>880*50 AM</p>
        <p>M-F</p>
        <p>128012-80 PM</p>
        <p>MWF</p>
        <p>10801*50 AM</p>
        <p>TTh</p>
        <p>*30780 PM</p>
        <p>TTh</p>
        <p>7:90*20 PM</p>
        <p>MW</p>
        <p>880*50 AM</p>
        <p>Th</p>
        <p>4.-00*50 PM</p>
        <p>T</p>
        <p>*10*48 PM</p>
        <p>Th</p>
        <p>780*30 PM</p>
        <p>TBA</p>
        <p>M</p>
        <p>780*00 PM</p>
        <p>T</p>
        <p>780480PM</p>
        <p>W</p>
        <p>780480PM</p>
        <p>Th</p>
        <p>780480PM</p>
        <p>M-F</p>
        <p>28O280PM</p>
        <p>M</p>
        <p>*00980 AM</p>
        <p>Th</p>
        <p>98O980AM</p>
        <p>MWF</p>
        <p>28O280PM</p>
        <p>MWF</p>
        <p>1*001080 AM</p>
        <p>Th</p>
        <p>780080PM</p>
        <p>MWF</p>
        <p>118O1T80AM</p>
        <p>Th</p>
        <p>780480PM</p>
        <p>TTh</p>
        <p>1*001180 AM</p>
        <p>TTh</p>
        <p>128O180PM</p>
        <p>MW</p>
        <p>10801180AM</p>
        <p>TTh</p>
        <p>*00980 AM</p>
        <p>MW</p>
        <p>*80*50 PM</p>
        <p>MWF</p>
        <p>18O180PM</p>
        <p>W</p>
        <p>780*50 PM</p>
        <p>M</p>
        <p>780*50 PM</p>
        <p>TTh</p>
        <p>*001*90 AM</p>
        <p>TTh</p>
        <p>8801*90 AM</p>
        <p>MW</p>
        <p>V80889PM</p>
        <p>MW</p>
        <p>*00*50 PM</p>
        <p> '</p>
        <p>TBA</p>
        <p>MW</p>
        <p>88O780PM</p>
        <p>TTh</p>
        <p>0:00780 PM</p>
        <p>MW</p>
        <p>7801080 PM</p>
        <p>TTh</p>
        <p>7801080PM</p>
        <p>TBA</p>
        <p>MW</p>
        <p>*80780 PM</p>
        <p>TTh</p>
        <p>*80780 PM</p>
        <p>MW</p>
        <p>7801080PM</p>
        <p>TTh</p>
        <p>r801080PM</p>
        <p>TBA</p>
        <p>TTh</p>
        <p>88O780PM</p>
        <p>m</p>
        <p>780080PM</p>
        <p>TBA</p>
        <p>MW</p>
        <p>9801*50 AM</p>
        <p>F</p>
        <p>10801*90 AM</p>
        <p>TTTi</p>
        <p>118O1280AM</p>
        <p>F</p>
        <p>118O1180AM</p>
        <p>MTWF</p>
        <p>98O980AM</p>
        <p>T</p>
        <p>880*50 AM</p>
        <p>Th</p>
        <p>880480 AM</p>
        <p>TTh</p>
        <p>I801080PM</p>
        <p>M-F</p>
        <p>128O1280PM</p>
        <p>T</p>
        <p>780*00 PM</p>
        <p>TWF</p>
        <p>118O1180AM</p>
        <p>MW</p>
        <p>780*00 PM</p>
        <p>TVIfTh</p>
        <p>18O180PM</p>
        <p>T</p>
        <p>780080PM</p>
        <p>M-F</p>
        <p>98O980AM</p>
        <p>MW</p>
        <p>780*10 PM</p>
        <p>M</p>
        <p>118O1180AM</p>
        <p>W</p>
        <p>1180-1180 AM</p>
        <p>F .</p>
        <p>llsOO-IIMOAM</p>
        <p>MWF</p>
        <p>*00*50 AM</p>
        <p>MWF</p>
        <p>iODOO-IOflOAM</p>
        <p>M</p>
        <p>*00*50 AM</p>
        <p>7!#</p>
        <p>*00*90 AM</p>
        <p>IWa</p>
        <p>Hdin</p>
        <p>Am a rmysioi ....  ^    i(h00-10a0  AM</p>
        <p>Anat&amp;amp;PMolll :......  *</p>
        <p>AnatA Physiol II Lab .......0</p>
        <p>Anat &amp;amp; Pt^ol II Lab................0</p>
        <p>Human Anatomy &amp;amp; Phys I .......4</p>
        <p>j^NumanAimoiaylPhytl ^......4</p>
        <p>Human Anat &amp;amp; Phy I Lab .....0</p>
        <p>HpmanAiiatAPlivllJb.,.............0</p>
        <p>fiffiCSWli:;:;::::</p>
        <p>Human Anatomy A Phys II Lab........0</p>
        <p>Human Anatomy A Phys II Lab........0</p>
        <p>General Biology II...................</p>
        <p>OaiWfalMologyl....................4</p>
        <p>General Biology II Lab...............0</p>
        <p>General Biology II Lab ......0</p>
        <p>Qanaral Biology N Lab................9</p>
        <p>Chemistry For Allied Health..........4</p>
        <p>Cham For AWad Health Lab..........0</p>
        <p>Chem For AlliedJ^th Lab..........0</p>
        <p>Inorganic Chemistry Ltib.............0</p>
        <p>  .0</p>
        <p>.5</p>
        <p>BIO108</p>
        <p>BIO106</p>
        <p>BIO108L BIO106L BIO180 M0160</p>
        <p>BI01501 MO II BI0151 BK) 151L BIO 151L BK) 151L BIO 251*</p>
        <p>MO 201*</p>
        <p>BI0251L*</p>
        <p>BI0251L*</p>
        <p>M0261L*</p>
        <p>CHM110 CHM110L-CHM110L CHM250*</p>
        <p>CNM280*</p>
        <p>CHM250L*</p>
        <p>CHM2S0L*</p>
        <p>PHY 101</p>
        <p>PHY 101  Technical Physics..................5</p>
        <p>PHY 101L  Technical Physlce Lab...............0</p>
        <p>PHY lOlL  Technical Physics Lab...............0</p>
        <p>PHY 101L  Technical Physics Lab. ........0</p>
        <p>PHY 281*  Physics A Environment II.............4</p>
        <p>PHY261L* Physlce And Environment II Lab 0</p>
        <p>PHY 1101  Applied Science.......... 4</p>
        <p>PHY 1101  Applied Science....................4</p>
        <p>PHY 1101L  Applied Science Lab................0</p>
        <p>PHY 1101L  Applied Sciancai Lab................0</p>
        <p>PHY 1103  Principles Of Electricity  .....4</p>
        <p>PHY 1103L  Principlee Of Electricity Lab..........0</p>
        <p>1:00-1:50 PM W 2K)M50PM ; Tb i 2:0M:50PM I MWF  9:0060AM &amp;lt; T. n 7M4mm -Th I 7:00-7:50 PM T 9:00-10:50AM . Th 4 0M4MPM ; MTW $8:004:50 AM , M 4 3:004:50 PM T 3K)04:50PM W t^11:S0AM MWF 12:00-12:50 PM MW 6:30-7:50 PM T 1:002:50 PM ;</p>
        <p>Th 12:00-1:50 PM ^ W 0.004:80PM . MVifF 8:008.*50AM T 8.1)0-10:50 AM Th 91)0-11:50 AM MWF 121)0-12:50 PM , MW 8:30-7:80 PM T ' 111)0-12:90 AM W OD04'.50PM MTF 8D04:50AM Th 101)0-10:50 AM MW lODO-IO-jOAM T 11DO-12SOAM T 9DO-10JOAM F 91)0-10:50 AM Th 111)0-12:50 AM MW 11D0-11:50AM F 111)0-11:90 AM Th 2D04:50PM MT 8D04:S0AM Th 8D050AM MWF 2D0-2:50PM, W 8D050AM T 11D0-2JDAM MW 12D0-1240PM Th 12D0-121K) PM F 111)0-12:50 AM</p>
        <p>DR 101 DR 102 DR 100</p>
        <p>DR 107</p>
        <p>BtaaprlnlltaadlngASkatahlng.</p>
        <p>Technical Drafting..........</p>
        <p>DR 107 Techrilcar Draftln|.</p>
        <p>DR 1110 DR 1110 DR 1110 DR 1111 OR 1111 DR 235 DR 1104* DR 1105 DR 1110* DR 1110 DR 1111 DR 1111 DR 1112 DR 1113 DR 1113 DR 1114 DR 1116 OR 1118 DR 1117 OR 1117</p>
        <p>ComputerAidad DR ComputatAldadORR</p>
        <p>BIprt Read: Air Condition.</p>
        <p>-CARPENTRY</p>
        <p>CAR 1102 Carpentry: Millwk A Cabntmkg 8</p>
        <p>CAR 1110 DR 1110 DR 1111 MAT 1112 MAT 1112</p>
        <p>BIdg Trade Math.</p>
        <p>CAT 103 Drawing II................... 3</p>
        <p>CAT 112 CAT 112L CAT 122 CAT 122L CAT 213</p>
        <p>Advertising Illustration.</p>
        <p>CAT 214 CAT 225</p>
        <p>PH0114% PHD 114% PN0114% PH0114% PH0115 PNG 118 PHD 118</p>
        <p>PN0118 PH021S FH0218 FN0218 FN0216 PHD 210 PHD 210 PHO210 PHD 210</p>
        <p>Phetagiaphy</p>
        <p>,..........</p>
        <p>Phalognpliy-</p>
        <p>Photography.</p>
        <p>2</p>
        <p>M</p>
        <p>*30-1ft20PM</p>
        <p>.2</p>
        <p>W</p>
        <p>*30-1*20 PM</p>
        <p>.3</p>
        <p>M</p>
        <p>7:00*50 PM</p>
        <p>.2</p>
        <p>T</p>
        <p>180480 PM</p>
        <p>M</p>
        <p>18O180PM</p>
        <p>.2</p>
        <p>M</p>
        <p>180-180PM -* </p>
        <p>Th</p>
        <p>180480 PM</p>
        <p>.2</p>
        <p>MW</p>
        <p>88O980AM</p>
        <p>.2</p>
        <p>W</p>
        <p>*00*80 PM</p>
        <p>2</p>
        <p>Th</p>
        <p>*00*50 PM</p>
        <p>.2</p>
        <p>TTh</p>
        <p>88O980AM</p>
        <p>2</p>
        <p>M</p>
        <p>*00*50 PM</p>
        <p>.4</p>
        <p>TTh</p>
        <p>*801*90 AM</p>
        <p>3</p>
        <p>MWF</p>
        <p>180180 PM</p>
        <p>3</p>
        <p>MWF</p>
        <p>118O1180AM</p>
        <p>3</p>
        <p>M</p>
        <p>98O1180AM</p>
        <p>.3</p>
        <p>Th</p>
        <p>780*80 PM</p>
        <p>.3</p>
        <p>MWF</p>
        <p>*00480 AM</p>
        <p>.3</p>
        <p>M</p>
        <p>98O1180AM</p>
        <p>3</p>
        <p>M</p>
        <p>98O1180AM</p>
        <p>3</p>
        <p>F</p>
        <p>1*001280 AM</p>
        <p>.1</p>
        <p>. M</p>
        <p>780*80 PM</p>
        <p>,3</p>
        <p>M .</p>
        <p>98011:50 AM</p>
        <p>.2</p>
        <p>, TTh</p>
        <p>12.80180 PM</p>
        <p>2</p>
        <p>Th</p>
        <p>*30-1*20 PM</p>
        <p>.3</p>
        <p>MWF</p>
        <p>280280 PM</p>
        <p>3</p>
        <p>M</p>
        <p>*30*20 PM</p>
        <p>.8</p>
        <p>MWF</p>
        <p>9801080AM</p>
        <p>TTh</p>
        <p>88O180AM</p>
        <p>2</p>
        <p>TTh</p>
        <p>7:00*50 PM</p>
        <p>.3</p>
        <p>M</p>
        <p>980-11:50 AM</p>
        <p>3</p>
        <p>MWF</p>
        <p>*00*50 AM</p>
        <p>MWF</p>
        <p>128012:50 PM</p>
        <p>.3</p>
        <p>M</p>
        <p>T28O280PM</p>
        <p>3T0QRAPHY </p>
        <p>.3</p>
        <p>m</p>
        <p>9801*50 AM</p>
        <p>F</p>
        <p>10801*50 AM</p>
        <p>.4</p>
        <p>MW</p>
        <p>128012:50 PM</p>
        <p>.0</p>
        <p>*</p>
        <p>TBA</p>
        <p>.6</p>
        <p>MWF</p>
        <p>980*50 AM</p>
        <p>.0</p>
        <p>*</p>
        <p>TBA</p>
        <p>,3</p>
        <p>T</p>
        <p>1280480 PM</p>
        <p>F</p>
        <p>118O1180AM</p>
        <p>.3</p>
        <p>Th</p>
        <p>1280480 PM</p>
        <p>F</p>
        <p>980*50 AM</p>
        <p>.6</p>
        <p>TTh</p>
        <p>98O1180AM</p>
        <p>F</p>
        <p>10801*50 AM</p>
        <p>. I'</p>
        <p>W</p>
        <p>9801*50 AM</p>
        <p>.2</p>
        <p>M</p>
        <p>780*50 PM</p>
        <p>.2</p>
        <p>T</p>
        <p>780480 PM</p>
        <p>.2</p>
        <p>W</p>
        <p>780480 PM</p>
        <p>Th</p>
        <p>780*50 PM</p>
        <p>M</p>
        <p>780480 PM</p>
        <p>,.2 </p>
        <p>T</p>
        <p>780080PH</p>
        <p>W</p>
        <p>7.80480 PM</p>
        <p>..2 </p>
        <p>Th</p>
        <p>780480 PM</p>
        <p>M</p>
        <p>780*80 PM</p>
        <p>.v2 &amp;gt;</p>
        <p>T</p>
        <p>780480 PM</p>
        <p>.i2 '</p>
        <p>W</p>
        <p>780480 PM</p>
        <p>..2</p>
        <p>Th</p>
        <p>78O480PM</p>
        <p>..2</p>
        <p>7.80480 PM</p>
        <p>. 1</p>
        <p>T</p>
        <p>780480 PM '</p>
        <p>..2</p>
        <p>V w</p>
        <p>780480 PM,</p>
        <p>iTt.</p>
        <p>780480PM^</p>
        <p>-COOPERATIVE EDUCATION-</p>
        <p>iforgoal-</p>
        <p>CooparaUva EducaUon oHan aeadtaaie ciidR taewd aiadwlii oftantadstady relatad wwkwpaflaiioa. Earn wMta yen &amp;gt;Mwr lor 2 ciadRs par quartar.</p>
        <p>CORRECTIONS, PARALEGAL &amp;amp;</p>
        <p>LAW ENFORCEMENT ,</p>
        <p>Interviewing.......................3</p>
        <p>CJC109</p>
        <p>CJC109 CJC100 CJC115 CJC115 CJC115 CJC151-6 CJC181-8 CJC 204</p>
        <p>CJC 204</p>
        <p>Interviewing.....</p>
        <p>wiewtaB.</p>
        <p>.....3</p>
        <p>.....I</p>
        <p>T  10^0-10:50 AM</p>
        <p>Th ,10:00-11:50 AM TWTh 20(^PM M 7:0iOPM MWF 8.-00*50 AM</p>
        <p>Criminal Law 1......................3</p>
        <p>CriminMLawl......................3  vi, MWF  9:000:90 AM</p>
        <p>Criminal Law I......................3  TWTh  iGOIOPM</p>
        <p>Read In Criminal Juatica.............1  MTh  1GO1:50PM</p>
        <p>naad In Criminal JiMioa..............1  . TTfi  AOOO:OOPM</p>
        <p>Evidence Photography...............4  MWF  ll JfJlSOAM</p>
        <p>f ; T' ' 1:00*50 PM EvidancaPhotography...........MWF  IlflOIISOAM</p>
        <p>CSC 207 Confinamant Facilities Admin 3</p>
        <p>CSC 213 LEC211</p>
        <p>LEC211</p>
        <p>LEC211</p>
        <p>LEC229</p>
        <p>LEC232</p>
        <p>LEC2S0 PSC110 PIC 110 PSC200</p>
        <p>P8C213</p>
        <p>PIC 213</p>
        <p>PSC220</p>
        <p>Dynamia Of Subatanca Abuse 3</p>
        <p>Real Prop A TKIa Abstract II..........3</p>
        <p>RaalPrapATMaAbmtacll  ......1</p>
        <p>RaMPrapATWaAlNlraelR............1</p>
        <p>Taxes.............................3</p>
        <p>Eatete Admlnlatralion...............3</p>
        <p>Paralagai Intamsblp.................4</p>
        <p>JuvanileDalinquancy................5</p>
        <p>Juvanlla OaUnquaney  .......5</p>
        <p>Police Academy........... .23</p>
        <p>Identificallon Techrdquee............4</p>
        <p>Police Administration...............3</p>
        <p>. Th , 1GO3:50 PM WT 8GO8:50AM 0 M 1GO1:90 PM MThF *008:50 AM .Ti *009:50 AM Fr *009:90AM .</p>
        <p>'m* l:OOiiUF W 1M80FM *WI' *00-7:80ra</p>
        <p>TWDi 10:0010:50 AM *008:50 AM 8GO9:S0AM 4GO5:50PM Mf i' 9G09A)AM Wf ' 7d)08MFM m| ',*0011:50 am M8 n:0O4:50PM MWF lOGOIO^AM T 10GO11:S0AM TTh' 7ri)0*IOFM T 1 12M)-12A0PM Th 12K)01A)PM</p>
        <p>iwin 1</p>
        <p>I'':</p>
        <p>-COSMETOLOGY-</p>
        <p>cos 1101-4 Cosmetology I  ..........12</p>
        <p>cot 1106-12 CosmatataiykA.....................6</p>
        <p>lET</p>
        <p>T-Fi</p>
        <p>S</p>
        <p>.8</p>
        <p>T-F</p>
        <p>T-F</p>
        <p>,S</p>
        <p>s</p>
        <p>EOF 101%</p>
        <p>E0P101L%</p>
        <p>DP1Ufk%.</p>
        <p>nni6iL%</p>
        <p>OP 1011%</p>
        <p>EDP112%</p>
        <p>E0P112%</p>
        <p>EDP112%</p>
        <p>IDP112%</p>
        <p>DATA PROCESSING ANI&amp;gt; COMPUTER PROGRAMMING</p>
        <p>Fma.CampMlitFpaiMlW Fare Compatar tab. FilsOmwwtarFamillab.</p>
        <p>Pm Computar taW lab.</p>
        <p>Pars Ceamutaf FamM Lab.</p>
        <p>*3012:20 AM 180480 PM *00-1180 AM 1280480 PM 689-780 PM 780*00 FM 6801180 AM 1286480 FM</p>
        <p>......,.0</p>
        <p>T</p>
        <p>180480PM</p>
        <p>........0</p>
        <p>W</p>
        <p>080480PM</p>
        <p>........0</p>
        <p>W</p>
        <p>*90-1080 PM</p>
        <p>,&amp;gt;t......O</p>
        <p>Th</p>
        <p>089480PM</p>
        <p>........0</p>
        <p>Th</p>
        <p>*101080 PM</p>
        <p>.it......3</p>
        <p>TTh</p>
        <p>*00980 AM</p>
        <p>,.l.....3</p>
        <p>TTh</p>
        <p>1180-1180AM</p>
        <p>..  l... .3</p>
        <p>MW</p>
        <p>3.80480 PM</p>
        <p>T</p>
        <p>*30181 PM</p>
        <pb facs="00096780_0011" />
        <p>Th Datly fteflector, Qiynvilto, N.C.  Sunday, Novmbf22,1967  A.-|i</p>
        <p>   ........</p>
        <p>OoMi ' \  OmR  ~</p>
        <p>wT mu it -_ Mii  m</p>
        <p>::-^OinA procsnq anm --</p>
        <p>COMPUTER PROQRAMMINQ</p>
        <p>EDP112%  IM^I.............................3  TU  1:30*20 PM</p>
        <p>EDP112L%  BMtolUb....................,....0  ,  *  ^  _</p>
        <p>EDP112L%  BMtelUb.........................O  &amp;gt; Th  MMaOPM</p>
        <p>EDP112L%  BMlelLab.........................O  TU  MO-IOaOMI</p>
        <p>EDP1ia%  BMielUb.........................O  T  0:30*20W-</p>
        <p>E0P1ia%  MelUO........... .............0  T  l:IO-1(fc20PII</p>
        <p>^  EDP112L%  MelUb,.................. .....O  . II  5;0O^PM</p>
        <p>EDP113  BmcH............................4 &amp;gt;f TTh  10K)0-10:SO AM</p>
        <p>'  EDP113  Baile II................. ..........4  MW  1:00-1:50PM</p>
        <p>SpiII  BHtell............................4  ^ M  6:80*20 PM</p>
        <p>EDP113L  Basic II Lab............ ...........O  ^  *  TBA</p>
        <p> , :</p>
        <p>'  EDP114%  lntroToComputirConci|&amp;gt;ts..........3  MWF</p>
        <p>  EDP114%  Intro To Computir Concepts..........3  MWF  12-12-^PM</p>
        <p>*  EDP11416  taboTcCoBipalsrCoiicspls...........3  W  ^SS!!!</p>
        <p>......................  ^  T  SS^iK</p>
        <p>'  iR  iJSSSiTl</p>
        <p>  SpIIO  ,  Cobolll..... ...................4,  MTTb  1(W-1150AM</p>
        <p>E0P11 I vCobMI............................4*^  MW 70*60PM</p>
        <p>E0P146  ,  Profliammino With Obesa III..........3.  MW  WXMtMAM</p>
        <p>E0P146L  *  ProgrammlnflWHhDbassIIILab O  *</p>
        <p>EDP140    Adv PfOQ With Dbase III  .....3  M  IJJf  -g AM</p>
        <p>'N  ii!v"ll*5u APh</p>
        <p>BIP141 ^  AdvPragWMhObesaM...............3  W  oao*MPM</p>
        <p>EOF 148L  AdvProg With ObasaIII Lab..........O  TBA</p>
        <p>EDP146L i  AdsPiagWlthDlissalllLab............O  M  JJJftMPM</p>
        <p>EDP211 1  Appllcatlens.l.............  i  MTHi  IjOO-^PM</p>
        <p>EDP212 ?  ApplicationsII...............:......4  TWF  8c00-90AM</p>
        <p>EDP212 ^  Appieallaas R......................4  MW  7KI00:MPM</p>
        <p>EDP4 !T  Sinputoi^tamsi ..... ,3  M-Th  120-12;50PM</p>
        <p>E0P2   Introduction To RPQII  U  MTTh  10-20PM</p>
        <p>EOP224t|.  RPQII..............................4  MTTh  8)*50AM</p>
        <p>OP 224   RPQ I.......... f4  TTh  7dX&amp;gt;*50PM</p>
        <p>EDP230  Data Procassino Practica I.........^.5  M#  T</p>
        <p>EDP231  ,  Data Procassing Practica II..........5  M-F  TBA</p>
        <p>EOP233 * CustomarInformComputarSystam....4  T-F  10:00-10:50AM</p>
        <p>'  ,    *  ,  TBA</p>
        <p>EDP233  Customar Inform Computar Oyslsm...|..4  MW  7KXM-.50PM</p>
        <p>  EDP234  Interactiva Work Station ProQ 1.4  ' WF  ft00-9i50AM</p>
        <p>. r  t  *1  TBA</p>
        <p>EDP240    Intamship I........................1  M-F  TBA</p>
        <p>EOP241  iMntamshlpll............... ......;..1  M</p>
        <p>HAT 111  '  CwwiMiltf twr  ..............S  Tul  7^)00:30PM</p>
        <p> EAHY CHILDHOOD AHD TEACHER ASSI^NJ</p>
        <p>EDU103 i  Preschool Orientation ........3  F  12.*0W|MPM</p>
        <p>u l  M-Th  TBA</p>
        <p>EDU104  i  Preschool Observation ........3  ^F</p>
        <p>  iTTh  9)-100AM</p>
        <p>EDU100 v:rPracticumIn ElamantaiySchool......6  &amp;gt; M-F  TBA</p>
        <p>EDU107  PracInPre^hoolExpor.............6  M  ,</p>
        <p>ED0111  Language Arts Tech I............J...3  jMWF</p>
        <p>EDU115  Audiovisual &amp;amp; Media Instruct.........3  TTh  12:00-1:30 PM</p>
        <p>EDU204  Pent Education...................1  *  TBA</p>
        <p>EDU22SA Smn-Prac: Preschool................6  M-F  TBA</p>
        <p>EDU225B Sam-Prac: Preschool................6  M-F  TBA</p>
        <p>EDU 225C Sem-Prac: Preschool............i.. -6  ^</p>
        <p>EDU229  infant Care Activities................3  MWF  12:00-12:50^</p>
        <p>EDU211  Creativa AcMvMas...............'....5   TTh  7dlM:30PM</p>
        <p>P8Y116  ChlIdGiowthADevelopll............3  MWF  11)-11:50 AM</p>
        <p>PtYllf CMdOrmvIhAOavalopI.........'....3  W  7:00*50PM</p>
        <p>-aECTRICAL INSTAUATION A-</p>
        <p>MAINTEHANCE: ELECTBOrSECHAmCAL</p>
        <p>ELC1113 AeDCMidi*contioi OT  5S2;iS,*Jf.</p>
        <p>W 10:00-12:90 AH -  i  Th  lOKW-lOAM</p>
        <p>r  ^  8:00*50 AM</p>
        <p>ELC1180 NalioiMl Electric Cada................4  T  8d)0*50PM</p>
        <p>MK11 Electrical Mechanical Malnt...^:...5  T  ^llOAM</p>
        <p>Th  8KW-12S0 AM</p>
        <p>MEC1147%  Sys Of Meas Meas Tools...........2  F  ^^lO^AM</p>
        <p>DFT1113  BIpmt ReadSketch: Elect..........3  F  10:00-12:50 AM</p>
        <p>DFT1118 Mprm Raed Sketch: Elael............3  M  7d)M:S0PM</p>
        <p>-tr-r-ELECTRONICS ENQINKRINQ TECHNOLOGY-</p>
        <p>ELC101 Fund Of Electricity 1.................8  MW  M0-950AM</p>
        <p>Th 9:00*50 AM W 1K-1:50PM Th 1M30PM</p>
        <p>ELC101 Fund Of Electricity 1.................6  1^</p>
        <p>Th 9:00*50 AM W 1)-1)PM</p>
        <p>'  T  1M30PM</p>
        <p>ELN 210  Semiconduct Circuit Analysis........7 M  AM</p>
        <p>WF lliOO-llO AM T  IMW-IISOAM</p>
        <p>Th 11)-1230AM ELN 211P  Communication Circuits. .........8  M\ph-</p>
        <p>W 1-004:50 PM</p>
        <p>ELN 215 FurnlaOf Digital Electro II............4  MW  9)-9:50AM</p>
        <p>Th 9KX)*50AM Th 1.C0*) PM</p>
        <p>DRIM  Tachnicsl DrWtlno...................2  M  6:30-1*20  PM</p>
        <p>PHY101  Technical Phystes..................5  MTF  552^;50  AM</p>
        <p>Th 10:00-10-^0 AM</p>
        <p>PHY 101  Technical Physics..................5  MW  100-10OAM</p>
        <p>T 1100-12:50 AM</p>
        <p>PHY101L  Technical Pkysics Lab...............O  T  900-1000  AM</p>
        <p>PHY101L Technical Physics Lab...............O  F  MO-IO^^</p>
        <p>PHY101L  Technical Rrysics Lab...............O  Th  1100-12:50  AM</p>
        <p> -ELECTRONIC  SERVICING-</p>
        <p>ELC1103 FundOfBssIeliaGl..................3  T  7.O0:S0PM</p>
        <p>ELC1104 FundOIO^Ariaiyais..............3  T  700*50PM</p>
        <p>ELC1105 FundOf ACCirAiiaIyais..............3  T  700*50PM</p>
        <p> ELC1111  ACTheoIyaSaSSr.............9  ^F  1^AM</p>
        <p>,  ,1  TTh  800-1000AM</p>
        <p>M-F 1100-1100 AM</p>
        <p>ELN 1105  Circuit Appllc II.....................7  MWF  900-10:50  AM</p>
        <p>Th  800-10:50 AM</p>
        <p>M-Th 100-100 PM</p>
        <p>ELN 1110  Digitai Concepts II..................4  MWF  1100-11:50  AM</p>
        <p>T  800-1000 AM</p>
        <p>EUI1181  FundOtEInOevioae..................3  T  700*80  PM</p>
        <p>ELN 1122  FundOfDigilalCItcuRs...............2  T  700*50  PM</p>
        <p>ELN112S Futid 01 Opera AmpR.................3  T  700*80PM</p>
        <p>ELN 1134  Futid Of Mtoepwcesssts.............2  T  700*10  PM</p>
        <p>ELN 1131  Finid OIMfCompulMarlsoing..........2  T  700*50  PM</p>
        <p>ELN 1137  FundOflndusI^...................3  T  700*50  PM</p>
        <p>MAT 1103  Basic Geometiy And Trigonometry....5  M-F  100-100 PM</p>
        <p>-^-ENGLISH: SPEECH-</p>
        <p>nsiiiiui ffirtiitrmtn iT-iio ir *  **</p>
        <p>Sevaial Lvete As Roth Osy And Evetibig OeseesL Cal 75*2180. Ext 30*</p>
        <p>ENaOW   s  &amp;lt;f  'Sil"*</p>
        <p>EN0100  Onmmr ........................3  MWF  MOJSOAM</p>
        <p>........................  ,</p>
        <p>ENS100   3  jW</p>
        <p>ENQIOO Grammar ........................3  SJlSSSi!</p>
        <p>ENG 100  Grammar II........................3  MWF  IMM^PM</p>
        <p>ana tea  GraaMMrl................  2  M  700*50  PM</p>
        <p>ENQIflvi Granmar Lab......................1  TTh  800*80AM</p>
        <p>IE  -SKM-</p>
        <p>IS3188a  ?  M/Sy</p>
        <p>ggiSS  m</p>
        <p>T- ENG100A  GrMnmer Lab...............  1  TJ</p>
        <p>HaQiana  (NaaMiiar Lab.   .................1  w  500*50 PM</p>
        <p>ENG 101%  Grammar Composition 1............3  MWF  MJJJJAM</p>
        <p>ENG 101% GiammarOCompoeltlonl............3  ^  imiSaM</p>
        <p>ENG 101%  Grammar CompoaHlon 1............3  MWF  IMfJ^AM</p>
        <p>ENG 101% Grammar Composition 1............3  MWF</p>
        <p>eng 101% iQrMwnar Composition 1............3  MWF  ^J^AM</p>
        <p>0(0101%^  Granmar Composition I .......3  ^  ^iSam</p>
        <p> ENQIOIH   OraliimarSCempeiRleal..'...........2  M</p>
        <p>ENG101A  Grammar Composition I Lab........1  TTh  JW-^AM</p>
        <p>ENG101A  Grammar Composition I Lab........1  TTh  ^WO^AM</p>
        <p>BIQIOIA.  Grammar Compoeltlon I Ub........1  TTh</p>
        <p>ENG101A."'  Grammar Cornpoeltlon I Lab........1  TTh</p>
        <p>ENQIOlAi Granmar Composition I Ub........1  T  ^|HJA{j</p>
        <p>ENGIOIA  Grammar Composition I Ub........1  JR</p>
        <p>ENG10U Grammar CcmpoaHlon I Ub........1  TTh</p>
        <p>ENGIOIA^ Grammar Composition I Lab........1  TTh</p>
        <p>BM10IA OtaauaariCeiapeallnarlLab...... .,.1  M</p>
        <p>ENG 1018% Grammar...........   .5  M-F  IJJJ-llgAM</p>
        <p>ENG 1018% Grammar...........1...... .......5  Mi</p>
        <p>ENQ1018% QraauRar.......................,..  W  7^20PM</p>
        <p>ENG102 Grammar Composition I...........3  MW</p>
        <p>ENG 102 Grammar Cornpoeltlon II.......i...3  W  MO^AM</p>
        <p>ENQ102 &amp;gt; GrammarCompositionII......t....3  M  11^1^2!</p>
        <p>f  TTh  12^12:50  PM</p>
        <p>ENG 102 GrammarComposHlonH...........3  MWF</p>
        <p>B4Q102 GrammarCompoalllonn...........3  MWF</p>
        <p>END 102 Grammar CompoeHionH...........3  MWF  100-1:50^</p>
        <p>EN0102 OraHawSOeiBpeeRleel.............2  M  7:00*80  PM</p>
        <p>Caerae</p>
        <p>TMe</p>
        <p>Natrm Osya</p>
        <p>ENGLISH: SPEECH</p>
        <p>ENG 102A Grammar Composition II Lab........1</p>
        <p>ENG102A Grammar Composition NUb........1</p>
        <p>ENG102A  Grammar Com^k)n II Ub........1</p>
        <p>ENG102A  Grammar Composition II Lab........1</p>
        <p>ENG 102A  Granwnar Composition II Lab........1</p>
        <p>ENG102A  Grammar Composition II Lab........1</p>
        <p>ENG102A  Grammar Composition II Lab........1</p>
        <p>ENGIfSA  Grammar Composition II Lab 1</p>
        <p>ENQ102A  QtammerOsmpositlonHLab.........1</p>
        <p>ENG 103  Report Writing.....................3</p>
        <p>ENG 103  Report Writing............ 3</p>
        <p>ENQ103  Repet WrMIng......................3</p>
        <p>ENG 106%  Spelling Techniques.............  .3</p>
        <p>ENG 106%  Spelling Techniques................3</p>
        <p>ENG 150%*  Composition I............... 3</p>
        <p>ENG 150%*  Composition 1......................3</p>
        <p>ENG 150%*  Composition I.,....................3</p>
        <p>ENG 151*  Composition II.....................3</p>
        <p>ENG 151*  Composition II.  .........3</p>
        <p>ENQ181*  CompoaWonH......................3</p>
        <p>ENG 152*  Composition III.....................3</p>
        <p>ENG 204%  Oral Communications.  ............3</p>
        <p>ENQ 204  Oral Communications................3</p>
        <p>ENQ 204  Oral Communlcstiona................3</p>
        <p>ENG 206  Business Communications...........3</p>
        <p>ENG 217  Childrens Uterature................3</p>
        <p>BIQ260*  American Uterature I ..........3</p>
        <p>ENG 261*  American Uterature II...............3</p>
        <p>ENG 1102  Communication Skills...............3</p>
        <p>ENG 1102  Communication Skills...............3</p>
        <p>SPH150  Voice Diction ........ 3</p>
        <p>8PH160  Public Speaking  ...........3</p>
        <p>SPH160  Public Speaking....................3</p>
        <p>LIB 150  Library Research Skills..............2</p>
        <p>LIB 150  Ubrary Research Skills.............2</p>
        <p>health &amp;amp; PHYSICAL EDUCATION</p>
        <p>TTh 8:008:80AM TTh 900*80AM TTh 100010:80 AM TTh 11O1130AM T 90010:50 AM Th 9001000 AM TTh 12001200 PM TTh 100100PM M *0*80PM MWF 800800 AM MWF 12001200 PM M *3O*20PM MW 12001200W F 12001*601^ MWF *e02^PM -T-^10001000 AM Th 10001100AM T 10001000AM Th 100011-00 AM MWF 1001:50 PM MWF 800800 AM MWF 120012-00 PM W 7OO*50PM T 1002-00 PM Th 100100 PM MWF 11001100AM W 700*00 PM T 700000PM MWF  100100PM TTh 1002-00 PM W 700*50 PM MWF 8.00800 AM MWF 800800 AM TTh 200300 PM T 110011:50 AM Th 11001200 AM MW 11001100AM F 11001100AM MWF 2002:50 PM T 100200 PM Th 1002:50 PM</p>
        <p>HEA 111,1-5 Cardiopulmonary Resuscitation 1</p>
        <p>HEA150*  Personal Commun Health  .3</p>
        <p>HEA 150*  Personal Commun Health..........3</p>
        <p>HEA 150%*  PersonalCommunHaaHh............3</p>
        <p>PED150%*  Foundations In Phys Ed..............2</p>
        <p>PED150*  Foundations In Phys Ed..............2</p>
        <p>PED 165%*  Physical Conditioning...............1</p>
        <p>PED 165%*  Physical Conditioning...............1</p>
        <p>PEDIOS*  Physical Conditioning................1</p>
        <p>HUMAN SERVICES</p>
        <p>TBA</p>
        <p>M  9:009:50 AM</p>
        <p>WF  9:009:50 AM</p>
        <p>MWF 12:0012-.50PM T 7K)O*.50PM WF 11K)O11:50AM TTh  12:0012:50 PM</p>
        <p>m  11^)011:50 AM</p>
        <p>TTh 1)-1:50PM TTh SdlOOrSOPM</p>
        <p>HSA112P Practlcum 1........................3</p>
        <p>HSA112P Practicum I ................3</p>
        <p>HSA113 HSA113 HSA 113 HSA 115</p>
        <p>HSA 131 HSA 132 HSA 132 HSA 133 HSA 201</p>
        <p>Group Processes II. Group Processes II. Group Processes II.</p>
        <p>Readings In Human Serv. Readings in Human Serv. Readings In Human Serv. Readings In Human Serv.</p>
        <p>HSA 220 Activities In Human Services 3</p>
        <p>HSA 231 HSA 232 HSA 232 HSA 233 PSY221</p>
        <p>Research In Human Serv. Research In Human Serv. Research In Human Serv. Research In Human Serv.</p>
        <p>PSY22S</p>
        <p>Psychological Assessments...........3</p>
        <p>.3</p>
        <p>Th</p>
        <p>840-1140 AM</p>
        <p>Th</p>
        <p>140-240 PM</p>
        <p>W</p>
        <p>140-140 PM</p>
        <p>.3</p>
        <p>T</p>
        <p>840-11:50 AM</p>
        <p>T</p>
        <p>140-240 PM</p>
        <p>W</p>
        <p>140-1:50 PM</p>
        <p>.2</p>
        <p>Th'</p>
        <p>940-1240 AM</p>
        <p>.2</p>
        <p>T</p>
        <p>940-1240 AM</p>
        <p>.2</p>
        <p>Th</p>
        <p>940-12:50 AM</p>
        <p>12</p>
        <p>M-F</p>
        <p>840-11:50 AM</p>
        <p>ThF</p>
        <p>1:00-240 PM</p>
        <p>TW</p>
        <p>140840 PM</p>
        <p>M</p>
        <p>1240-1-40 PM</p>
        <p>,1</p>
        <p>M</p>
        <p>3:00440 PM</p>
        <p>1</p>
        <p>W</p>
        <p>340440 PM</p>
        <p>.1</p>
        <p>W</p>
        <p>TBA</p>
        <p>1</p>
        <p>F</p>
        <p>3.40440 PM</p>
        <p>5</p>
        <p>MW</p>
        <p>840-940 AM</p>
        <p>T</p>
        <p>1240-2-40 PM</p>
        <p>3</p>
        <p>MWF</p>
        <p>1040-10:50 AM</p>
        <p>W</p>
        <p>240-240 PM</p>
        <p>1</p>
        <p>M</p>
        <p>3404:50 PM</p>
        <p>1</p>
        <p>W</p>
        <p>340440 PM</p>
        <p>,.1</p>
        <p>Th</p>
        <p>TBA</p>
        <p>1</p>
        <p>F</p>
        <p>3404:50 PM</p>
        <p>MW</p>
        <p>1040-1140 AM</p>
        <p>F</p>
        <p>840-1040 AM</p>
        <p>..3</p>
        <p>W</p>
        <p>*99*50 PM</p>
        <p>AHR201</p>
        <p>ELC113</p>
        <p>MEG 102</p>
        <p>NEC 102 MEC202 MK202 MEC210</p>
        <p>MEC235</p>
        <p>INDUSTRIAL MAINTENANCE TECHNOLOGY*</p>
        <p>Prindplos Of Hooting. ACADCMachAConl. Machine Processes..</p>
        <p>Machine Processes..................4</p>
        <p>Manufacturing ProcH.................3</p>
        <p>Manufacturing ProcH.............v...9</p>
        <p>Physical MataNwgy..................4</p>
        <p>Hydraulics And Pneumatics..........4</p>
        <p>MEC237</p>
        <p>MEC272</p>
        <p>WLD120</p>
        <p>WLD121</p>
        <p>WL0122</p>
        <p>7d)0*50PM MW  *00*50 PM</p>
        <p>MTW  11:0011:50 AM</p>
        <p>Th  11^)0150 AM</p>
        <p>TTh  7KIO*SOPM</p>
        <p>TTh 1*0011:50 AM T  *00*50PM</p>
        <p>TTh  7.-00*50 PM</p>
        <p>MTh  2:002:50PM</p>
        <p>T  1:002:50 PM</p>
        <p>W  2KIO3.-50PM</p>
        <p>TTh  liOMMm</p>
        <p>M  *00*50 PM</p>
        <p>TTh  *00*80PM</p>
        <p>MW  *00*50PM</p>
        <p>TTh  *00*10PM</p>
        <p>Control Systams...................4</p>
        <p>Programming 01CNC Equip...........3</p>
        <p>Oxyacotylono Welding...............3</p>
        <p>Arc WeMng........................4</p>
        <p>Comm AlndPrac....................3</p>
        <p> INDUSTRIAL MANAGEMENT TECHNOLOGY</p>
        <p>ISC 102  Industrial Safely.....................3  W  7KKk*S0PM</p>
        <p>Reed In Indus Mgml..................1  M</p>
        <p>Read In Indus Mgmt..................1  M</p>
        <p>Read in Indus Mgrnt..................1  M</p>
        <p>Economy....................3  M</p>
        <p>-INSURANCE  A  REAL  ESTATE-</p>
        <p>MS215  Ufa, AcddemHealth In.............4  W  *101*20PM</p>
        <p>MS210  Property Casualty Ins...............4  Th  *30-1*20PM</p>
        <p>RLS101  Fund Of Real Estate: Salesman.........4  TTh  7d)O*S0PM</p>
        <p>RU101  Fund Of Reel Estate: Salesman.........4  MW  7dlO*50PM</p>
        <p>RLS104  Fund Of Real EsLRIEst Broker.........3  TTh  7H)0*50PM</p>
        <p>MACHINIST</p>
        <p>ISC 110 I8C120 ISC 120 ISC 203</p>
        <p>*00*50 PM *00*50 PM *00*50 PM 7dl0*80PM</p>
        <p>MEC1101 Mach Shop Theory  Prac............7</p>
        <p>MEC1102 Mach Shop Theory Prac............7</p>
        <p>MEC 1103  Mach Shop Theory   Prac............7</p>
        <p>MEC 1104  Mach Shop Theory  Prac............7</p>
        <p>MEC 1112  Mach Shop Process.................2</p>
        <p>DFT1104  Bipmt Read: Mech..................3</p>
        <p>DFT1106  BIpmt Read: Mechanical.............3</p>
        <p>ISC 1101  Industrial Safety....................3</p>
        <p>MWF 8:008:50 AM MWF 9^)0-10:50 AM TTh 8.-00-10:50 AM MWF 8:00-9:50 AM TTh IM0-100AM MWF 10:00-10:50 AM Mi 8:00-10:50 AM 'M-F 8:00-10:50 AM MW 1:002:50 PM MWF 1:001:50 PM MWF 11)-11OAM MWF 1:001:50 PM</p>
        <p>MASONRY</p>
        <p>MAS 1101  Bricklaying I.</p>
        <p>MAS 1102  Bricklaying I</p>
        <p> 10</p>
        <p> 10</p>
        <p>MAS 1102  BricideyingM......................10</p>
        <p>MAS 1104  BrickleylnglV.......................0</p>
        <p>MAS1113  Masonry Estknattng 1.................2</p>
        <p>MAS 1114  Masonry Eathnaling 0................3</p>
        <p>DFT1114  Bhm^ Reed Sketch: Mason........2</p>
        <p>MAT 1111  BuMlngTradsMmh: Masonry..........2</p>
        <p>MATHEMATICS-</p>
        <p>TTh  *00-11:50 AM</p>
        <p>WF  *00-11^0 AM</p>
        <p>T-F 1d)0*80PM TTh  *00-1140 AM</p>
        <p>WF  *00-1140 AM</p>
        <p>T-F  140*80 PM</p>
        <p>TTh  *00-1140 AM</p>
        <p>WF  *00-11:80 AM</p>
        <p>T-F  140*50 PM</p>
        <p>TTh  *00-11:50 AM</p>
        <p>WF  *00-11:50 AM</p>
        <p>TWTh 14O240PM P  140-140 PM</p>
        <p>MAT 099%  Developmental Math................5</p>
        <p>MAT 100%  Review Of Funda Math...............5</p>
        <p>MAT 100%  Review Of Funda Math...............5</p>
        <p>MAT 100%  Review Of Funda Math...............5</p>
        <p>MAT100R%  Computational Skills................5</p>
        <p>MAT100R%  Computatkmai Skills................5</p>
        <p>MAT 101%  Algebra 1..........................5</p>
        <p>MAT 101%  Algebra 1..........................5</p>
        <p>MAT 101%  Algebra 1..........................5</p>
        <p>MAT 101%  Algebra 1..........................5</p>
        <p>MAT 101%  AMnl...........................8</p>
        <p>MAT 102  Trignometry.......................5</p>
        <p>MAT 102  Trignometry.......................5</p>
        <p>MAT 103  Algebran..........................5</p>
        <p>MAT 103  Algebran..........................6</p>
        <p>MAT 110%  Business Math  ............5</p>
        <p>MAT 110%  Business Math.....................5</p>
        <p>MAT 110%  Business Math.....................5</p>
        <p>MAT 110%  Business MMh......................5</p>
        <p>MAT111  Computsr Math.....................5</p>
        <p>MAT 150*  College Algebra....................5</p>
        <p>MAT 150*  College Algebra....................5</p>
        <p>MAT 150*  CsNegeAlgsbm.....................5</p>
        <p>MAT 1101  Fundamentals Of Math..............5</p>
        <p>MAT 1103  Basic Geometry And Trigonometry....5</p>
        <p>MAT 1111  Building Trade Malh: Masonry 3</p>
        <p>MAT 1112  BIdg Trade MMh....................3</p>
        <p>MAT 1112  Bktg Trade Malh....................3</p>
        <p>MAT 1113  Briii^ Trade Math: Masonry 3</p>
        <p>w * wPtriiOMNiMNMaMK** * *</p>
        <p>M</p>
        <p>1*00*59 FM</p>
        <p>M</p>
        <p>1*99*50 FM</p>
        <p>M</p>
        <p>*00-1140 AM</p>
        <p>M</p>
        <p>1*09*59 FM</p>
        <p>M-F</p>
        <p>1040-1040 AM</p>
        <p>Mi</p>
        <p>94G040AM</p>
        <p>Mi</p>
        <p>1240-1240 PM</p>
        <p>Mi</p>
        <p>240*50 PM</p>
        <p>Mi</p>
        <p>840840 AM</p>
        <p>Mi</p>
        <p>1240-1240 PM</p>
        <p>Mi</p>
        <p>840840 AM</p>
        <p>M-F</p>
        <p>940840 AM</p>
        <p>M-F</p>
        <p>140140 PM</p>
        <p>M-F</p>
        <p>240*50 PM</p>
        <p>TTh</p>
        <p>749*20 FM</p>
        <p>Mi</p>
        <p>840840 AM</p>
        <p>M-F</p>
        <p>11.401140 AM</p>
        <p>MT</p>
        <p>940*50 AM</p>
        <p>WThF</p>
        <p>940*50 AM</p>
        <p>MTThF</p>
        <p>140140 PM</p>
        <p>W</p>
        <p>140140 PM</p>
        <p>Mi</p>
        <p>840840 AM</p>
        <p>Mi</p>
        <p>940940 AM</p>
        <p>M-F</p>
        <p>140140 PM</p>
        <p>TTh</p>
        <p>749*20 FM</p>
        <p>TTh</p>
        <p>749*29 FM</p>
        <p>M-F</p>
        <p>940040 AM</p>
        <p>M-F</p>
        <p>140140 PM</p>
        <p>TTh</p>
        <p>740*20 FM</p>
        <p>M-F</p>
        <p>240*50 PM</p>
        <p>Mi</p>
        <p>140140 PM</p>
        <p>M</p>
        <p>1240240 PM</p>
        <p>MWF</p>
        <p>12401240 PM</p>
        <p>M</p>
        <p>1240*50 PM</p>
        <p>M</p>
        <p>1240240 PM</p>
        <p>Cenree</p>
        <p>m.</p>
        <p>TMe</p>
        <p>CredH</p>
        <p>JHL</p>
        <p>NURSING; NURSING ASSISTANT*</p>
        <p>oat A iCAO tTART On The Nursing Curriculum And Make Veur Clase Ochedule A LMs EACt By RnHMrtWBFTR&amp;gt;R&amp;gt;0*edllslated Courses Offered This WhdsrtCsO Ms. WeR At 7508120. Ext 200.</p>
        <p>ORIENTATION</p>
        <p>V</p>
        <p>OR1100 New Stddent Seminar...............i  m  140-140  PM</p>
        <p>OM100  '    640*80PM</p>
        <p>(Nine Additional Sections Of OR1100 Are Scheduled)</p>
        <p>PERSONNEL MANAGEMENT TECHNOLOGY</p>
        <p>PER 102 PER 102 PER 105 PER201 BUS 170 ISC 102</p>
        <p>...2</p>
        <p>W</p>
        <p>749*50 PM</p>
        <p>...2</p>
        <p>Th</p>
        <p>740840 PM</p>
        <p>. 3</p>
        <p>T</p>
        <p>749940PM</p>
        <p>...3</p>
        <p>M</p>
        <p>749940PM</p>
        <p>...2</p>
        <p>MW</p>
        <p>740840 PM</p>
        <p>...3</p>
        <p>W</p>
        <p>740*50 PM</p>
        <p>P8Y 102%</p>
        <p>PSY102</p>
        <p>PSY103</p>
        <p>P8Y 104%</p>
        <p>PSY115</p>
        <p>PSY116</p>
        <p>P8Y116</p>
        <p>PSY120</p>
        <p>PSY150*</p>
        <p>P8Y151*</p>
        <p>PSY180*</p>
        <p>P8Y180*</p>
        <p>PSY211</p>
        <p>PasptiSkWstlnlMerDyn PaepMikMetlnlMerDyn Cammurn^ Bsnellls...</p>
        <p>STOtwSmpfccs</p>
        <p>IlKlMSlrfSl  *</p>
        <p>-PSYCHOLOGY A SOCIOLOGY</p>
        <p>General Psychology.................3</p>
        <p>General Psychology.................3</p>
        <p>Adolescent PsycfMlogy..............3</p>
        <p>Human ReWlons...................3</p>
        <p>Child Growth Develop 1.............3</p>
        <p>Child Growth Develop H............3</p>
        <p>Child Orawtb Develop B.............2</p>
        <p>Human Growth  Develop............3</p>
        <p>Generd Psychology 1................4</p>
        <p>QensrsI Psychology B................2</p>
        <p>Abnormal Psychology...............3</p>
        <p>Abnormal Psychology...............3</p>
        <p>Behavior Disorders..................5</p>
        <p>PSY 221 Learning  Behavior.................6</p>
        <p>P8Y225</p>
        <p>SOC102%</p>
        <p>8OC102%</p>
        <p>SOC 103% SOC 150%* SOC 150%*</p>
        <p>Psychologlcsl Assossmonts.</p>
        <p>Principles Of Sociology....</p>
        <p>Principles Of Sociology ........3</p>
        <p>Socia Problems....................3</p>
        <p>Sociology 1........................5</p>
        <p>Sociology 1........................5</p>
        <p>SOC 150%* Sodoiogyl.........................5</p>
        <p>RADIOLOGICAL TECHNOLOGY</p>
        <p>MWF</p>
        <p>12401240 PM</p>
        <p>MWF</p>
        <p>140140 PM</p>
        <p>MW</p>
        <p>114011-40 AM</p>
        <p>F</p>
        <p>11401140 AM</p>
        <p>MWF</p>
        <p>240240 PM</p>
        <p>F</p>
        <p>9401140 AM</p>
        <p>MWF</p>
        <p>11401140 AM</p>
        <p>W</p>
        <p>740840 PM</p>
        <p>MWF</p>
        <p>940940 AM</p>
        <p>MT</p>
        <p>940940 AM</p>
        <p>W</p>
        <p>94010:50 AM</p>
        <p>M</p>
        <p>740840 PM</p>
        <p>MTW</p>
        <p>840840 AM</p>
        <p>MTW</p>
        <p>12401*50 PM</p>
        <p>M</p>
        <p>11401140 AM</p>
        <p>WF</p>
        <p>11401240 AM</p>
        <p>MW</p>
        <p>10401140 AM</p>
        <p>F</p>
        <p>8401040 AM</p>
        <p>W</p>
        <p>649840PM</p>
        <p>MF</p>
        <p>140140 PM</p>
        <p>W</p>
        <p>140140 PM</p>
        <p>W</p>
        <p>749940 PM</p>
        <p>MWF</p>
        <p>12401240 PM</p>
        <p>Mi</p>
        <p>840840 AM</p>
        <p>MT</p>
        <p>140240 PM</p>
        <p>W</p>
        <p>104010-40 AM</p>
        <p>TTh</p>
        <p>749940PM</p>
        <p>REDUCE Your Course Load By RegMerifig For Requited ReMed Ceutaes Nonrl CaR Hawaii At 7558130. Ext 2S*</p>
        <p>-RESPIRATORY CARE</p>
        <p>REGISTER For The Required Related Courses Offered TMs Whnor! CsB Ms. WsR At 75S8130, Ext 268.</p>
        <p>-WELDING</p>
        <p>WLD120  Oxyscetylene WehRng...............3</p>
        <p>WL0121  Arc WehBng........................4</p>
        <p>WLD122  CommSlndPrac .............3</p>
        <p>WLD1102  Basic Gas WeMng.............</p>
        <p>WL01102%  Basic Gas WeMhig.............</p>
        <p>WLD1103  Basic Arc Welding............</p>
        <p>WL01103  Basic Arc WeMbig.............</p>
        <p>WLD 1104%  Beginning WsMMg I...........</p>
        <p>WLD 1105  Beginning WeMhig R...........</p>
        <p>WLD 1106  Beginning WekBng W......... 4</p>
        <p>WLD 1107  IntsrmsdMts WsMhig I.........</p>
        <p>WLD 1108  IntsnnedMtsWeMliigB...............3</p>
        <p>WLD 1109  IntsrmsdMts WeMhig IB..............3</p>
        <p>WLD1110  Comm A Indus Prac I...........</p>
        <p>WLD 1111  Comm itndus Prac R...........</p>
        <p>WLD 1112  Mechanicai TestInspection 2</p>
        <p>WLD1112  Mechanical Test Inspection....</p>
        <p>WLD 1113  PipeWehflngl......................3</p>
        <p>WLD 1114  PipeWoMhigR................</p>
        <p>WLD 1122  Commerc Indust Prac........</p>
        <p>WLD 1123  Inert Gas WeM.....................2</p>
        <p>WLD 1123  Inert Gas WeM......................2</p>
        <p>WLD 1124  peWeWIng.................</p>
        <p>WLD 1125  Certification Practices...............5</p>
        <p>WLD113S  CertMcatMn Practices 1...............2</p>
        <p>WLD 1139  Certification Practices H..............2</p>
        <p>WLD 1141  Beginning Welding.................10</p>
        <p>WLD 1142  Intermediate Welding..............10</p>
        <p>-COLLEGE TRANSFER</p>
        <p>ACT 150 ACT 150 ACT 150 ACT 150</p>
        <p>ACT 159</p>
        <p>ACT 151 ACT 151 ACT 151 ACT 152 ACT 152 ANT 150 BI0 251 BIO 251 BI02S1 BI0 251L BI02S1L BI02S1L BI02S1L BI02S1L BUS 165 BUS 166 BUS 166 BUS 166 BUS 166 BUS 167 BUS 167 CHM250 CHM280 CHM250L CHM250L EC0150 EC0151 EC0151</p>
        <p>EC0151</p>
        <p>ENG ISO</p>
        <p>Principles Of Accounting. Principles Of Accounting. Principles Of Accounting. Principles Of Accounting.</p>
        <p>Of Accounting.............4</p>
        <p>Principles Of Arxounting............4</p>
        <p>Principles Of Accounting............4</p>
        <p>Princ^ Of Acoounthig.............4</p>
        <p>Principles Of Accounting......</p>
        <p>Principles Of AcoounBng.......</p>
        <p>Intro to Anthropology.........</p>
        <p>General Biology II.............</p>
        <p>General Biology II.............</p>
        <p>GenoralBMMgyR.............</p>
        <p>General Biology II Lab.  ......</p>
        <p>General Biology II Lab.........</p>
        <p>General Biology II Lab.........</p>
        <p>General Biology II Lab.........</p>
        <p>GensialBiolonRLab......</p>
        <p>Introduction To Business............5</p>
        <p>Business Law 1.....................3</p>
        <p>Business Law 1.....................3</p>
        <p>Business Law 1.....................3</p>
        <p>BushwesLswl......................1</p>
        <p>Business Law II....................3</p>
        <p>Bushwee Law R...............</p>
        <p>Inorganic Chemistry...........</p>
        <p>Inorganic Chemistry Lab.......</p>
        <p>hmgnnic Chemistry Lab........</p>
        <p>Economica 1.......................3</p>
        <p>Economica II.......................3</p>
        <p>Economics II.......................3</p>
        <p>rronnmliTi II.......... .......</p>
        <p>Composition 1......................3</p>
        <p>ENG 150 Composition 1......................3</p>
        <p>ENG 150 ENG 151 ENG 151 ENQ 151 ENG 152</p>
        <p>ENQ 260</p>
        <p>ENG 261 HEA 150</p>
        <p>HEA 150 HEA 150 HIS 150 HIS 151 HIS 161 MS 161 LIB 150 UB 150 MAT 150 MAT 150 MAT 150 PED 150 PED 150 PED 164 PED 165 PED 165 PED 165 PHY 261</p>
        <p>PHY2S1L</p>
        <p>POLI</p>
        <p>PSY 150</p>
        <p>PSY 150</p>
        <p>PSY 181</p>
        <p>PSY 180 PSY 180 REL190 SOC 150 SOC 150</p>
        <p>SOC 150</p>
        <p>SOC 189 SPH150</p>
        <p>Composition 1......................3</p>
        <p>Composition II.....................3</p>
        <p>Composition II.................^...3</p>
        <p>CompoeMow R  ................2</p>
        <p>Composition III.....................3</p>
        <p>AmsrteanUlaratutel...........</p>
        <p>American Uterature II...............3</p>
        <p>Personal Commun Health..........3</p>
        <p>Personal Commun Health..........3</p>
        <p>Personal SCoaununHsoNh......</p>
        <p>American History 1..................5</p>
        <p>American History II...........</p>
        <p>History Of Europe Since 1500. .......5</p>
        <p>Malory Of Eurape Since 1599..........8</p>
        <p>Ubrary Research Skills..............2</p>
        <p>Ubrary Research Skills..............2</p>
        <p>College Algsbra....................5</p>
        <p>College Algebra....................5</p>
        <p>OoBeoe AMakfa.....................5</p>
        <p>FoundMionsIn Phys Ed.  ..........2</p>
        <p>Foundations In Phys Ed..............2</p>
        <p>Bowling.....................</p>
        <p>Physical Conditioning.........</p>
        <p>Physical Conditioning.........</p>
        <p>Physice Environment II.......</p>
        <p>Physice And Environment II Ub.</p>
        <p>Intro To U.S. Government............5</p>
        <p>General Psychology 1................4</p>
        <p>General FMychology 1................4</p>
        <p>   h</p>
        <p>UtiMlll  m..........</p>
        <p>Abnormal. R^fchology.........</p>
        <p>Abnonnel Pndiology.........</p>
        <p>Intro To ReBglonTiT;.......</p>
        <p>Sodoiogy 1........................5</p>
        <p>Sociology 1........................5</p>
        <p>Sociology 1........................5</p>
        <p>SPH150  Voice A Diction.....................3</p>
        <p>SPH190  Public Speaking....................3</p>
        <p>SPH160  &amp;lt;  Public Speaking.................,..3</p>
        <p>3</p>
        <p>TTh</p>
        <p>649840PM</p>
        <p>4</p>
        <p>MW</p>
        <p>649940PM</p>
        <p>3</p>
        <p>TTh</p>
        <p>049940PM</p>
        <p>1</p>
        <p>W</p>
        <p>649840PM</p>
        <p>.1</p>
        <p>T</p>
        <p>749948 PH</p>
        <p>1</p>
        <p>TTh</p>
        <p>140*30 PM</p>
        <p>1</p>
        <p>M</p>
        <p>649940PM</p>
        <p>3</p>
        <p>MW</p>
        <p>649940PM</p>
        <p>.3</p>
        <p>TTh</p>
        <p>649040 PM</p>
        <p>4</p>
        <p>MW</p>
        <p>649940PM</p>
        <p>.4</p>
        <p>TTh</p>
        <p>649040 PH</p>
        <p>3</p>
        <p>MW</p>
        <p>649840PM</p>
        <p>.3</p>
        <p>TTh</p>
        <p>649940PM</p>
        <p>.3</p>
        <p>MW</p>
        <p>649940PM</p>
        <p>.2</p>
        <p>TTh</p>
        <p>649940 PM</p>
        <p>.2</p>
        <p>M-Th</p>
        <p>1*001*50 PM</p>
        <p>.2</p>
        <p>T</p>
        <p>649040 PM</p>
        <p>.3</p>
        <p>MW</p>
        <p>649040 PM</p>
        <p>4</p>
        <p>TTh</p>
        <p>640040 PM</p>
        <p>6</p>
        <p>MTW</p>
        <p>8401140 AM</p>
        <p>2</p>
        <p>M-Th</p>
        <p>11401140 AM</p>
        <p>2</p>
        <p>Th</p>
        <p>649*50 PM</p>
        <p>,7</p>
        <p>Mi</p>
        <p>8401040 AM</p>
        <p>.5</p>
        <p>Th</p>
        <p>8401140 AM</p>
        <p>F</p>
        <p>8401240 AM</p>
        <p>3</p>
        <p>MW</p>
        <p>149040PM</p>
        <p>2</p>
        <p>TTh</p>
        <p>640740 PM</p>
        <p>10</p>
        <p>Mi</p>
        <p>8401140 AM</p>
        <p>10</p>
        <p>Mi</p>
        <p>8401140 AM</p>
        <p>5FER</p>
        <p>.4</p>
        <p>M-F</p>
        <p>840840 AM</p>
        <p>4</p>
        <p>Mi</p>
        <p>10401040 AM</p>
        <p>.4</p>
        <p>Mi</p>
        <p>140140 PM</p>
        <p>MT</p>
        <p>10401040 AM</p>
        <p>WF</p>
        <p>10401040 AM</p>
        <p>Th</p>
        <p>10401040 AM</p>
        <p>.4</p>
        <p>TTh</p>
        <p>749940PM</p>
        <p>..4</p>
        <p>Mi</p>
        <p>10401040 AM</p>
        <p>..4</p>
        <p>Mi</p>
        <p>140140 PM</p>
        <p>MW</p>
        <p>749940 PM</p>
        <p>M-F</p>
        <p>12401240 PM</p>
        <p>.4</p>
        <p>MW</p>
        <p>749*30 PM</p>
        <p>5 .</p>
        <p>M-F</p>
        <p>940940 AM</p>
        <p>.4</p>
        <p>MWF</p>
        <p>11401140 AM</p>
        <p>4</p>
        <p>MWF</p>
        <p>1*001240 PM</p>
        <p>.4</p>
        <p>MW</p>
        <p>649740 PM</p>
        <p>T</p>
        <p>11401240 AM</p>
        <p>T</p>
        <p>140240 PM</p>
        <p>Th</p>
        <p>10401140 AM</p>
        <p>Th</p>
        <p>1*00140 PM</p>
        <p>W</p>
        <p>249940 PM</p>
        <p>5</p>
        <p>M-F</p>
        <p>240*50 PM</p>
        <p>3</p>
        <p>MWF</p>
        <p>*00240 PM</p>
        <p>.3</p>
        <p>TWF</p>
        <p>11401140 AM</p>
        <p>..3</p>
        <p>MWF</p>
        <p>10401040 AM</p>
        <p>.3</p>
        <p>Th</p>
        <p>749940PM</p>
        <p>..3</p>
        <p>MWF</p>
        <p>11401140 AM</p>
        <p>.2</p>
        <p>Th</p>
        <p>749940 PM</p>
        <p>4</p>
        <p>MWF</p>
        <p>12401240 PM</p>
        <p>4</p>
        <p>MW</p>
        <p>640740 PM</p>
        <p>T</p>
        <p>11401240 AM</p>
        <p>W</p>
        <p>149940 PM</p>
        <p>3</p>
        <p>MWF</p>
        <p>840840 AM</p>
        <p>.3</p>
        <p>MWF</p>
        <p>10401040 AM</p>
        <p>.3</p>
        <p>M</p>
        <p>849840 AM</p>
        <p>ThF</p>
        <p>849840 AM</p>
        <p>.2</p>
        <p>W</p>
        <p>*29*10 PM</p>
        <p>3</p>
        <p>T</p>
        <p>10401040 AM</p>
        <p>Th</p>
        <p>10401140 AM</p>
        <p>3</p>
        <p>T</p>
        <p>10401040 AM</p>
        <p>Th</p>
        <p>10401140 AM</p>
        <p>.3</p>
        <p>MWF</p>
        <p>140140 PM</p>
        <p>.3</p>
        <p>MWF</p>
        <p>849840 AM</p>
        <p>.3</p>
        <p>MWF</p>
        <p>12401240 PM</p>
        <p>2</p>
        <p>W</p>
        <p>749840 PM</p>
        <p>.3</p>
        <p>T</p>
        <p>149*50 PM</p>
        <p>Th</p>
        <p>140140 PM</p>
        <p>.2</p>
        <p>W</p>
        <p>749940 PM</p>
        <p>3</p>
        <p>MWF</p>
        <p>849840 AM</p>
        <p>.3</p>
        <p>M</p>
        <p>949640 AM</p>
        <p>WF</p>
        <p>149940 AM</p>
        <p>3</p>
        <p>MWF</p>
        <p>12401240 PM</p>
        <p>2</p>
        <p>T</p>
        <p>74994SPM</p>
        <p>.5</p>
        <p>Mi</p>
        <p>940940 AM</p>
        <p>.5</p>
        <p>M-F</p>
        <p>10401040 AM</p>
        <p>5</p>
        <p>Mi</p>
        <p>12401240 PM</p>
        <p>.8</p>
        <p>TTh</p>
        <p>749940PM</p>
        <p>2</p>
        <p>T</p>
        <p>149240 PM</p>
        <p>.2</p>
        <p>Th</p>
        <p>149240 PM</p>
        <p>.5</p>
        <p>Mi</p>
        <p>949940 AM</p>
        <p>.5</p>
        <p>Mi</p>
        <p>140140 PM</p>
        <p>.5</p>
        <p>TTh</p>
        <p>749*20 PM</p>
        <p>2</p>
        <p>WF</p>
        <p>11401140 AM</p>
        <p>.2</p>
        <p>TTh</p>
        <p>12401240 PM</p>
        <p>TTh</p>
        <p>940940 AM</p>
        <p>TTh</p>
        <p>11401140 AM</p>
        <p>.1</p>
        <p>TTh</p>
        <p>140140 PM</p>
        <p>1</p>
        <p>TTh</p>
        <p>*09*60 PM</p>
        <p>.4</p>
        <p>MW</p>
        <p>11401140 AM</p>
        <p>F</p>
        <p>11401140 AM</p>
        <p>Th</p>
        <p>249840 PM</p>
        <p>5</p>
        <p>MTThF</p>
        <p>10401040 AM</p>
        <p>W</p>
        <p>10401040 AM</p>
        <p>,4</p>
        <p>MT</p>
        <p>049940 AM</p>
        <p>W</p>
        <p>9401040 AM</p>
        <p>4</p>
        <p>M</p>
        <p>10401040 AM</p>
        <p>T</p>
        <p>10401040 AM</p>
        <p>ThF</p>
        <p>10401040 AM</p>
        <p>..3</p>
        <p>M</p>
        <p>749*19 PM</p>
        <p>3</p>
        <p>MTW</p>
        <p>849840 AM</p>
        <p>.3</p>
        <p>MTW</p>
        <p>12401240 PM</p>
        <p>..5</p>
        <p>M-F</p>
        <p>140140 PM</p>
        <p>5</p>
        <p>Mi</p>
        <p>840840 AM</p>
        <p>,.5</p>
        <p>MTW</p>
        <p>11401140 AM</p>
        <p>ThF</p>
        <p>11401140 AM</p>
        <p>MT</p>
        <p>149240 PM</p>
        <p>W</p>
        <p>10401040 AM</p>
        <p>TTh</p>
        <p>749*29 PM</p>
        <p>MW</p>
        <p>10401040 AM</p>
        <p>F</p>
        <p>10401040 AM</p>
        <p>..3</p>
        <p>T</p>
        <p>11401140 AM</p>
        <p>Th</p>
        <p>11401240 AM</p>
        <p>MW</p>
        <p>11401140 AM</p>
        <p>F</p>
        <p>11401140 AM</p>
        <p>MWF</p>
        <p>*00*80 PM</p>
        <p>756-3130</p>
        <pb facs="00096780_0012" />
        <p>r</p>
        <p>f i'</p>
        <p>ik</p>
        <p>h</p>
        <p>Ebard Says Fund Wbbid Help State iure Research Centers</p>
        <p>RALEIGH (AP) - The General Assembly should consider following the lead of other states by establishing a permanent revolving fund of no less than $5 million to make Not Carolina a more attractive candidate for multimillion-dollar research centers, officials say.</p>
        <p>That amount, according to a N.C. Board of Science and Technology committee, would allow the state to pledge 25 percent to 35 percent of overall funding for centere that would receive at least $1 million a year from outside sources.</p>
        <p>Other states have established such dowries, said Earl R. Mac Cormac, the science adviser to Gov. Jim Martin. Virginia, for example, has set up a $10 i^ion fund and Tennessee a $10 million to $15 million fund, Mac Cormac told bom^ members.</p>
        <p>The board did not mention any specific amounts in a resolution it adopted Friday, but asked the General Assembly to consider providing</p>
        <p>state matching funds on a case-by-case basis for proposed research centers that the'board considers meritorious.</p>
        <p>prestigious engineering research centers.</p>
        <p>A committee report said that federal agencies were funneling support for research projects at universities into large programs with many researcters rather than into the projects of individual scientists.  :</p>
        <p>Those institutions who are successful in developing a reasonable number of federally sponsored research centers will most likely be the strongest contenders to continue as majiff research institutions, the committee report said.</p>
        <p>It is theretore a particularly critical time for the development of state research support to our major academic institutiims, it said.</p>
        <p>Last year, three North Carolina proposals became finalists in the National Science Foundations annual competition for funding of</p>
        <p>The NSF ultimately decided not to fund two of those proposals, both of which would have been based at N.C. St&amp;amp;Uidversity.</p>
        <p>One proposal was for about $10 million in foundation ^,suppmrt fmr a center for advanced electronic materials processine. The other would have {NTOvided al^t $10 million fhim the NSF for a center for research in apparels, fibers and textiles.</p>
        <p>Both proposals had offered some in-kincT contributions from N.C. State Universitys own budget, such as d(mations of equipment and faculty time.</p>
        <p>Franklin D. Har^, N.C. State University vice chancellor for research, said it would be difficult to say whether those bids had suffered from a lack of funding pledges by the state.</p>
        <p>There is certainly no substitute for the green stuff, Hart told the News and Observer of Raleigh. If you have cash, from whatever source, that you can associate with center proposals it would definitely help us. School officials have reapplied for the two projects.</p>
        <p>The foundation did agree to fund an engineering research center for emerging cardiovascular technologies at Duke University, if another agency, the National Institutes of Health, provides one-third of the overall $14 million in federal support.</p>
        <p>Duke has not met those demands, but the foundation a^^ last month to provide the center some startup funds. That decision apparently was based in part on a $1.6 million commitment over a five-year period from the state-supported N.C. Biotechnology Center.</p>
        <p>*ficia[[y ^oa Catering Service</p>
        <p>We caler weddinys, receptions, dinner parties or any special oaasion. We'll work with you to make that day extra special! Call for more information:  (</p>
        <p>756^244</p>
        <p>746^498</p>
        <p>756-1544</p>
        <p>756-8108</p>
        <p>V/</p>
        <p>ATLANTA (AP) - A new s^ says that the number of state prison inmate varies widely across the South, as does the cost of housing them, which can exceed $17,000 per pristmer per year.</p>
        <p>The Southern Legislative Conference, made up of key officers and</p>
        <p>Counts, Costs Vary In South</p>
        <p>CAROLINA PSYCHIATRIC , AND PSYCHOLOGICAL ASSOCIATES</p>
        <p>is pleased to announce the association of</p>
        <p>SANDRA THOMAS. M.S.. C.S.A.C</p>
        <p>Ms. Thomas has a special interest and training in treatin^ persons with Alcohol and Substance Abuse problems ant tbek families. She also treats Adult Children of Alcoholic and Substance Abusers.</p>
        <p>5-A DOCTORS PARK 752-0113</p>
        <p>Sterling Silver Jewelry Show</p>
        <p>QVe u;i(( be shou/ing a (otge seCection (lOhdcitQ^ted steitCihg Qiim dukUng ouA</p>
        <p>OPEN HOUSE</p>
        <p>on</p>
        <p>Sunday Nov. 22 from 1:00-6:00</p>
        <p>Gaijdalfs</p>
        <p>discover the n^agic!</p>
        <p>Open Dally Ml 9 Sunday 1:30-5:2</p>
        <p>other lawmakers from 15 Southern states, found that the cost of housing an inmate in the South today ranges from Marylands high of $17,251 per year to a low of $6,841 in Mississippi.</p>
        <p>Tte r^on-wide average cost of housing one prisoner was $11,6(3 a year.</p>
        <p>Southern legislators, the report said, are increasingly concerned with the fiscal stress being placed on state budgets due to overcrowded state prisons and jails.</p>
        <p>The concern is especially acute in North Carolina, where U.S. District Judge James McMillan signed a consent judgment in September 1985 requiring the state to spend $12.4 mil-hon on 13-overcrowded southern Piedmont prisons. It came as the result of one of several lawsuits filed in North Carolina citing overcrowded and inhumane conditions.</p>
        <p>T)k entire (Hrison systems in 13 states are now under federal court supervision, and N(lh Carolina was threatened with the court-ordered prism imiHrovements in order to avoid a federal takeover.</p>
        <p>Earlier this year, the North Carolina General Assembly appropriated $15.1 million for prison iminvvement, including space for 1,600 new beds. The legislators also set an 18,000 limit on the prison population. Ihe law sets up emergency measures requiring the release of prisons if the prison population exceeds 17,460, or 97 percent of the capacity, for 15 straight days. Such emei^ency measures went into effect briefly in February.</p>
        <p>Meanwhile, state budget officer C.C. Cameron told a legislative commission Friday that emergency {HTison constructim of more than 2,500 beds and the renovation of 51 existing dormitories should be completed by the end of 1988.</p>
        <p>Cameron told the Governmental Operations Commission that contracts totaling more than ^ million have been negotiated to add an extra 2,554 beds to the state prison system, lite Legislature mandated the im |HX&amp;gt;vements when it enacted the emergency prison facilities devel-opmutprogrom this year.</p>
        <p>Southern sttes average yearly pris(ier costs wore, according to the report: Arkansas, $8,486; Florida, $12,164; Georgia, $10,699; Kentucky, $11,813; Loliisiana, $9,575; North Carolina, $12,446; Oklahoma, $10,305; South Carolina, $11,156; Texas, $12,546; Virginia, $16,390; and ^West Virginia, $11,192. Data from Alabama and Tennessee were not available.</p>
        <p>ranged from 1,478 in West Virginia to 38,595 in Texas. Based on population. South Carolina had the highest incarceration rate, according to the report - 390 inmates per 100,000 state residents. West Virginia was lowest at 77 inmates per 100,000.</p>
        <p>The Southern average was 249 inmates per 100,000 people.</p>
        <p>Alleged Bible Sham Probed</p>
        <p>promote China.</p>
        <p>Cottrell said Bakicer asked him after an August 1966 aroearance on the PTL Club television show to intervene with Chinas government so PTL could set up a distribution system for Chinese-language Bibles there.</p>
        <p>&amp;lt;C^stian</p>
        <p>Inmate populations, as of July 1,</p>
        <p>S1500</p>
        <p>Short of winning a lottery, the easiest way to get money in a hurry is a loan from Sovran Credit Corporation. You may not need any collateral for loans under $2500, and in most cases, we can approve your loan in less than a day.</p>
        <p>Best of all, your monthly payments will be low.  ,</p>
        <p>Call or come to Sovran Credit Corporation for a loan today,</p>
        <p>Its the easiest way we know to get that much money that fast |6redit corporation</p>
        <p>1 I4R7 Siman Finamkil (iirpimta&amp;lt;n</p>
        <p>3101 S. Memorial Or. 756-5185</p>
        <p>OK HOUR MliniZIIIG</p>
        <p>FREE STORAGE</p>
        <p>Ofity  OFF REG. PRICE &amp;gt; 011^</p>
        <p>L /O CLEANING  JD /O</p>
        <p>r " "ON HOUR*KORfzNG~  T</p>
        <p>I filio coupon good for 20% OFF tho doonlng | * prleoONLVof mono,womontondehlldron*o . I marino aooaral.  !</p>
        <p>woarlng opporol.</p>
        <p>I  Coupon Good Dec, 5,1987 ..</p>
        <p>  ComonMuMAoeomamyCMi.MToaaHonorad.</p>
        <p>!  FLUFF* FOLD SERVICE</p>
        <p> ProMnt at 2105 Charioa 8L, OroonvHIo</p>
        <p>" " * no DaySoMSiTn'ARofatlona</p>
        <p>EXTRA SPECIAL SAVINGS</p>
        <p>4.</p>
        <p>rSHMTSFOR</p>
        <p>On Hanoers SHIRT COUPON GOOD MONDAY-SATURDAY</p>
        <p>JSS.</p>
        <p>open 7 AM. to 7 pm, Monday thru Saturday CHARLES ST NEXT TO THE PLAZA BEHMO SWEET CAROLINES Orlvoln Door i Window Swvtoo-  76SS54S</p>
        <p>CHICAGO (AP) - Federal authorities are investigating reports that PTL founder Jim Bakker appealed to television audiences for donations to print Chinese-language Bibles, then used the money elsewhere, a newspaper says.</p>
        <p>The allied scheme is being probed by a U.S. Justice Department and Internal Revenue Service inrosecu-tion team headed by special counsel Charles Alexander, the Chicago Sun-Times reported.</p>
        <p>The team is presenting evidence about the financial affairs Bakker and the PTL ministry to a grand jury in Charlotte, N.C., the newspaper said, without citing sources.</p>
        <p>Bakker refused comment, but said through his lawyers that he remembered making the Chinese Bible appeals, the Sun-Times said. He said he did not know how much money was raised or if any Bibles, were printed.</p>
        <p>He disputed suggestions that as much as $4 million bad been raised for the project, the Sun-Times said.</p>
        <p>I dont think it was that much, but I dont really remember, since things really got crazy after that, the newspaper quoted Bakker as saying.</p>
        <p>Baidcer and his wife, Tammy, relinquished control of PTL after he confessed in March to adultery with a former church secretary, Jessica Hahn. As many as 18 investigations Bakker and PTL are being conducted by federal agencies, including the IRS, the Justice Department and the Postal Service, tte Sun-Times said.</p>
        <p>Tte newspaper said Alexander was told the Chinese Bible scheme began when Bakker approached Stan Cot-</p>
        <p>Trell, a man known for attempting to fellowship in</p>
        <p>Is Your TV Remote Lost Or Broken?</p>
        <p>GREAT</p>
        <p>GIFT</p>
        <p>\ECG</p>
        <p>Remote Control Transmitters</p>
        <p>82 EC6 Universal Remote Controls...</p>
        <p> Replace Over 3100 Original Manufacturer's Numbers, 48 Brands</p>
        <p> TV Sets, Cable Converters</p>
        <p> Infrared and Ultrasonic Types</p>
        <p> All-New Construction (Not Rebuilts)</p>
        <p> Key Functions Closely Follow Those of Original</p>
        <p> Available from your nearest authorized Philips ECG Distributor</p>
        <p>Starting From</p>
        <p>Mrs</p>
        <p>M4SrFH|</p>
        <p>m</p>
        <p>ratniHQW a</p>
        <p>107 Trade St. 756-2291 Mon.-Fri. 8:30-5:30 Sat. 9:00-4:00</p>
        <p>Local Resident Lost 22 Lbs.</p>
        <p>Kim Smith lost 22 lbs. and 11 inches. *Tve never felt better in my life about my health and my looksl*</p>
        <p>Without counting calories or weighing portions.</p>
        <p>Dekious variety of Nutri/System meals.</p>
        <p>Caring professional supervision.</p>
        <p>Ask about our new SureStarf" Accelerated Weight Loss Ptogram.</p>
        <p>As people vary, so does the rate of their weight loss.</p>
        <p>We Succeed Where Diets Fail You:</p>
        <p>,TM</p>
        <p>nutri system</p>
        <p>petghl leee medleal eentwrs</p>
        <p>TioH</p>
        <p>I</p>
        <p>I</p>
        <p>Program Cost And 1st Weeks Food Free  I</p>
        <p>Offer expires Nov. 28,1987  |</p>
        <p>Closed Thursday Only For Thanksgiving holiday.</p>
        <p>Happy ThankagMngl</p>
        <pb facs="00096780_0013" />
        <p>V</p>
        <p>By BRYAN BIIMLEY Anoeiated Press Writer /ASHINGTON (AP) - The iagan administration has not taken</p>
        <p>moniUH' Soviet compliance wit  treaties restricting the size of lear test explosions, the House In* ^Jgence Committee said. i^The committee isssued the unusual ^ . at the same time that a U.S. icial announced the two countries J conduct jmnt nuclear tests next ir to detmmiine the best method to mitor compliance with the .aties, which were signed in the d l970s but never ratified.</p>
        <p>Barker, chief U.S. negotiator \ the test talks in Geneva, said that, . experts would visit a Nevada i site to measure underground nu-ear explosions using seismic similar those used to gauge thquakes.</p>
        <p>J.S. experts will travel to jmipalatinsk in Soviet Central Asia measure underground nuclear s usi^ another method, known ^CORRTEX, which administration cials tnsM is needed to determine' the Kremlin is complying I the two treaties.</p>
        <p>House Intelligence report, en-,.d by the Democrats but vigor-ply qiposed by all the Republicans .r the panel, indicated that the kiiriets are correct in arguing that</p>
        <p>seismic means are adequate.</p>
        <p>And it disputed the White House claim that the Soviets have violated one of the pacts by testing nuclear devices larger than ISO kUotons, equal to the explosive power of&amp;lt; 150,000 pounds of TNT, or 10 times the force of the atomic bomb dropped on Hiroshima.</p>
        <p>The preponderance of testimony received did not support executive branch alle^tions that the Soviets have conunitted likely violations of the test treaties, it said.</p>
        <p>The intelligence committee report covered a range of existing and pro* posed arms control agreements, and argued that the Unitea States has the ability to monitor most of them, using technical means such as satet lites, intercepted communications and on-site inspections.</p>
        <p>U.S. ability to verify compliance is at the heart of Senate (febate on whether to ratify an Intermediate Nuclear Force treaty, which President Reagan and Soviet leader Mikhail Gorbachev are expected to sign during the summit in Washington on Dec. 7-10.</p>
        <p>A dissenting GOP report accused the Democratic majority of bending the facts for political ends and warns that U.S. ability to monitor treaties is declining.  ,</p>
        <p> The liberal majoritys main ambition was to discredit prior ad</p>
        <p>ministration compliance jndgments ^ and to reftite any perm^oo that verificatioo difficulties are a real impediment to future treaties, the GOP report said.</p>
        <p>The majority report, released by Intelligence Committee member R). Dave McCurdy, DOkla., said that the U.S. seismic systems for monitoring nuclear testing were found to lag considerably behind the state of tlm art in seimmd^, a point the Republicans disputed.</p>
        <p>The majority report said that U.S.' efforts to address this shortfall were found to be inadequate, agments and to refute any perception that verification difficulties are a real impe^ent to future treaties, the GOPreportsaid.</p>
        <p>Administration officials say that before they send the nuclear test treaties to the Senate for ratification, they want the Soviets to agree to allow the use of CORRIEX. CORR-TEX, which stands for Continuous Refiectometry versus Time Ebqieri-ment, measures electrical si^ials from a cable buried 30 feet fnnn the shaft used for a nuclear test explosion.</p>
        <p>The committee positicm was endorsed by an independent scientist, Lynn Sykes of the Lamont-Doherty Geological Observatory of Columbia University, in Palisades, N.Y.</p>
        <p>paly Time WiU Tell f U.S. Learned Lesson</p>
        <p>ByJIMDRINKARD AsMciated Press Writer WASHINGTON (AP) - Investiga-htqie thmr exhaustive but plain-:en report on the Iran-Contra af-lif has an effect on the way ashington does business, just as the wlations of the Watergate scandal</p>
        <p>u</p>
        <p>Teople in positions of responsibil- the government will remember p long time, said Sen. David en, a member of the Senate in-,.igating cmnmittee and chairman ihe Senate Intelligence Commit-</p>
        <p>e</p>
        <p>Whether the affair will leave a toting impression on the average ^merican is more doubtful, said [ormer Watergate counsel Samuel  *fch, now aprofessor at Georgetown ;!iiversity Law School. Dash said jihat wWle the report lays out the tory in lucid detail, most people will er read it. Instead, most Ameri-' rcans got their information on ie af-Itair from the televised hearings, '^tiere the presentation was less or-; ganized.</p>
        <p>1 Were going to learn le^ fr^ this than we should have, Dash saiid.</p>
        <p>; Selitom in the nations history has a presidit come in for such h^h condemnation from a bipartisan ongressionti committee: .that he misled the American people in word 4nd deed; that he created a White House atmosi^ere that fostered disregard for the law; and that he Sailed his constitutional obligations.</p>
        <p>' ITie idea of monarchy was rejected here 200 years ago and since then the law - not any official or ideology - has been paramount,</p>
        <p>; die report concluded. For not instill-ijig this precept in his staff, for fail-diig to take care that the law reigned l.-mpreme, the president bears the re-;^&amp;gt;onsibility.</p>
        <p>;  But committee members also said (that Reagans failings did not rise to the level that would warrant im-jpeachment. The lawmakers general-*!y agreed that would require that the Ipiesident himself have criminal iilpability, something the report did |iiot establish.</p>
        <p>About 20,000 copies were printed for Congress, and a commercial edition is expected out soon. It may, as Alabama Democratic Sen. Howell Heflin suggested, soon begin gathering dust.</p>
        <p>But those who gave long hours to the investigation hope its overall impact  the images of Lt. Col. Oliver North, national security adviser John M. Poindexter and others that Americans saw on television through the summerwill not soon fade.</p>
        <p>We still remember Watergate, 15 years later, said Rep. Dante Fascell, D-Fla., a member of the House panel. The memory of the Iran affair will last a long time, I hope.</p>
        <p>If you talk now with people in the departments, and in places like the CIA, I think the report has had a profound impact on making them pay much more attention to legal processes, said Rep. Lee Hamilton, D-Ind., chairman of the House investigating panel. My sense is that theyve been sensitized by the hear-</p>
        <p>umer cnanges are uxeiy m me iws governing the export of ad-inced U.S. weaponry. Rep. Howard erman, D-Calif., has proposed leg-</p>
        <p>fttiSIOESNOP</p>
        <p>Glass  Gas</p>
        <p>Doors  Logs</p>
        <p> Orrin Hatch, R-Utah, who</p>
        <p>joined minonty Republicans in filing a dissenting r^rt, agreed that the hearings will have a deterrent effect. But the panels final report, he said, is too political to have a lasting impact. Its an important historical document for political scientists and theorists, but theyll have to read it carefully.</p>
        <p>By refusing comment on the report, the White House is hoping to let the last embers of public controversy die.</p>
        <p>They recognize that no matter how damning the report is, it isnt really going to mean anything to the average American, Dash said.</p>
        <p>To ensure that their investigation has some durability, the panels recommended a series of legislative changes, most of them aimed at giving Congress more direct oversight of secret intelligence operations.</p>
        <p>The chairmen of the congressional</p>
        <p>mm</p>
        <p>FlnpllMACCMMrlN</p>
        <p>TAR ROAD ANTIQUES</p>
        <p>^One mile south of Sunshine! Garden Center</p>
        <p>&amp;gt;355-600:</p>
        <p>Reward</p>
        <p>Offered</p>
        <p>For Information leadliHl to the return of a shotgun taken from a blue A white Ford truck In the parking lot at Roses In Stanton Square, Saturday night, November 14th.</p>
        <p>Call</p>
        <p>Crimestoppers</p>
        <p>758-7777</p>
        <p>Cox Floral Service Invites You To A Christinas</p>
        <p>Open</p>
        <p>Sunday, Nov. 22nd 2:do iintil 5:00 p.m.</p>
        <p> Arlington Village</p>
        <p>intelligence committees, Boren, D-Okla., and Rep. Louis Stokes, D-Ohio, have put th(^ weight behind bills that would require the president to authorize any covert actiim in writing and ten Congress about it within 48 hours; require that the notice include who is carrying out the covert operation; and establish an independent CIA watchdog office at the agency.</p>
        <p>Other changes are likely in the laws vai</p>
        <p>Berman,</p>
        <p>islation to har an administration from secretly seUing arms to countries deemed to be terrorist states, even through private channels.</p>
        <p>I have been on record for over 10 yean claiming that if you do an analysis of So^ tests using several different methods, there is no indication that the Soviets have cheated, Sykes said in an interview.</p>
        <p>Sykes also agreed with the report that the Umted States needs to make a major effort to improve its seismological monitoring capability and hasnt done it.</p>
        <p>MOBILE PET GROOMING</p>
        <p>WcCoimToYm CompM* Shop On Wheels</p>
        <p>756-8233</p>
        <p>LATEST SHPMBTS JUST ARRIVED! PREVIEW TWO WEEKS ONLY</p>
        <p>NOVEMBER e-21,1987</p>
        <p>40% Dlacount Storwwldo</p>
        <p>(Additional Dlicounta To Deatere) (Excluding Wired Lamps &amp;amp; Bases)</p>
        <p>MAHRAMH ANTIOyeS, LTDt</p>
        <p>812 West Pine Strssl. Box 428. FarmMe,N.C.27S28 (818)7534324</p>
        <p>Wholeeale a RataH Loetlad 22 mNee eael Buelnese</p>
        <p>ineve</p>
        <p>Brighten your home for the upcommg holidays daring onr special</p>
        <p>ONE WEEK PRE-SEASON</p>
        <p>^course</p>
        <p>Elegant Battenburg Laces, Exquisite Pointe De Venice cutwork, the ever-pop-ular Irish hemstitched linen, Battenburg Bouquet, Vineyard and Army-Navy Dinner Cloths. Embroidered sheets and piUow case setsaU in time for holiday entertaining and Christmas season. Limited quantities.</p>
        <p>Q^ctttenAurq/KAccessories^  H^enice</p>
        <p>or  -----</p>
        <p>$39.88 $29.88</p>
        <p>Boudoir Pillow Neck RoU Pillow Envelope Pillow 8" Square Pillow 21x26 Cases ... Hostess Apron</p>
        <p>50.00 . .$39.88</p>
        <p>48.00. .$36.88</p>
        <p>46.00. .$36.88</p>
        <p>18.00. .$13.88</p>
        <p>42.00. .$32.88</p>
        <p>25.00. .$14.88</p>
        <p>36x36 with napkins  55.00 . .$29.88</p>
        <p>Dinner Place Mats  ____8.00  .. .$5.25</p>
        <p>Dinner Napkins........5.00  .. .$2.99</p>
        <p>fOO%^^AemsttcAe/j^hen</p>
        <p>Boudoir Pillow Neck RoU PUlow Envelope PiUow</p>
        <p>24" Square Pillow.......</p>
        <p>20x26 PUlow...........</p>
        <p>Dinner Place Mats......</p>
        <p>Dinner Napkins........</p>
        <p>FuU-Queen Sheet Sets ... PUlowcaseSet.........</p>
        <p>50.00</p>
        <p>50.00</p>
        <p>36.00</p>
        <p>50.00</p>
        <p>50.00 .8.00 .5.00 .7.00</p>
        <p>30.00</p>
        <p>$39.88 $39.88 $5.25 . $2.99 .$49.88 .$16.88</p>
        <p>Dinner Place Mat  8.00  $5.25</p>
        <p>Dinner Napkins  5.00  $2.99</p>
        <p>^Aouquet</p>
        <p>49!2L.</p>
        <p>Vktortaii U In eon^Mw with Miento tonnni huU nbni-dor Mihanew V dclMht MlgR.</p>
        <p>MIOILwOnl . . MdNOkLwOnl .11 klllOII.rOnl .11</p>
        <p>.CMfwitIM</p>
        <p>.ChnmtlS</p>
        <p>.CmimIMI</p>
        <p>[or oval.. talMobloogoroval.</p>
        <p>681120 oblong.........</p>
        <p>ear round.............</p>
        <p>egaht ubmyvUaiAi</p>
        <p>CMs</p>
        <p>wMto g( art liMh nMtetb ititdwd and tMnUfttlb dMriM Sdattetto hi Uto ar chanoMae wiOi cator. Tha partact aatUag for )rmvMiplaaaura.</p>
        <p>.....................Comp.  at  160.00</p>
        <p> .................Comp,  at  $92.00</p>
        <p>.............  Comp,  at  $122.00</p>
        <p> ............Comp,  at  $68.00</p>
        <p>SnAroidered ^ ^ Qiumer&amp;amp;oth&amp;amp;</p>
        <p>Vinyard</p>
        <p>19^,-</p>
        <p>Hand drawn openwork, endvoi-day and crocheted detailing add a claaak formal touch to thia tablecloth set. The floral embroi-deiy draws its mspiratkm from n English garden.</p>
        <p>68x86 Obi or Oval.......Compare  |70</p>
        <p>68x106 OU. or Oval......Compare  $80</p>
        <p>68x125 OU...........Compare  $100</p>
        <p>cream 16</p>
        <p>SCegant</p>
        <p>^cai/c uUoMoguimmeoi</p>
        <p>I offer for Uie oerfect ly gift. Efegant</p>
        <p> 100% frin^ acrylic</p>
        <p>ulUa soft Blanket Throws.</p>
        <p>Muy other styles to cbooee from</p>
        <p>$17.00..............</p>
        <p>Add $2.00 for the Singer Monogram cohn- &amp;amp; style of your</p>
        <p>Mst__</p>
        <p>'Garo&amp;amp;t</p>
        <p>88 COMPARE OX lOOxM AT 165</p>
        <p>EMsMe Ruflkd Full-ness with high hesder uid deep pockets  in</p>
        <p>white or natural.</p>
        <p>Comp. Sale</p>
        <p>100X63............$80  29.S8</p>
        <p>100x45............$60  M.8S</p>
        <p>90X20.............$36  17.88</p>
        <p>Filler Valance</p>
        <p>t^^wwaoAK*</p>
        <p>Oil.................</p>
        <p>3ta.VspMvri.</p>
        <p>.AM</p>
        <p>..JJI</p>
        <p>MM</p>
        <p>UghilUBiSM.....</p>
        <p>Copper Pet 9**</p>
        <p>withtll.SI parchase afCWrt Barke Predncti. PeachesXMfiaaiAiiDieJack 5 ChrlMinas Mem^ na-grances.</p>
        <p>&amp;lt;DuiosauJt</p>
        <p>Monogram me for the nwtet Christmas gift. ^ $1.00 for frill name or oo jper sinide Mter. Todtly Bears also available.</p>
        <p>988 788</p>
        <p>atkTswal... 13.00</p>
        <p>HaadTawel...0.00</p>
        <p>Wash CMh....0.00</p>
        <p>488</p>
        <p>^oe</p>
        <p>Your own 3 letter personal-iicd Ituniriotis all cotton kNime robe in fuU htlh. White, U blue.</p>
        <p>ter. A'buUfril. ChrUmasgift</p>
        <p>Compare at 10.00 44"</p>
        <p>Add 0.00 for 3 letter monogram</p>
        <p>iiiSalEd</p>
        <p>Lmee^BBBL</p>
        <p>nO-IBTt</p>
        <p>.-PM. 19-9,Snl. 1U-B,Sm. 1-5</p>
        <p>AiMimrBi</p>
        <p>"- AMMi.</p>
        <p>N.C 14TWH</p>
        <p>Selections may vary with tocatkm.</p>
        <pb facs="00096780_0014" />
        <p>V\fright's Role In CA Peace Effort Spurred By Meeting</p>
        <p>NEW ATTRACTION - Tlie slender, delicate Voyager, whkh flew iinrefueied around the world and Into the record books, has become the newest attraction at the National Air and l^ace Museum in Washington, D.C. It was</p>
        <p>eased into place Friday, just in time fmr neit months anniversary of the Dec. 14-23 flight. The aircraft hangs slif^tly slanted as if it were making a tom. (AP Laser-photo)</p>
        <p>ByRlTABEAMISH Associated Press Writtf WASHINGTON (AP) - House Speaker Jim Wrights controversial role in Central Amorican peace efforts was spurred l)y a chance meeting last summer with the brother of Costa Rican President Oscar Arias.</p>
        <p>Rod^ Arias, who functions as a comUnattm chief &amp;lt;d staff and aime miniater in his brothers administration, was introduced to Wright at a Puerto Rican conference on the Caribbean in July, said Costa Rican Ambassador GuidoFeniandez.</p>
        <p>Fonandez said Rodrigo Arias explained to Wri^t that the Costa Rican president was putting together a peace plan for Central America and explained what the'plan entailed. Wright asked to be kept posted on de-velopments Hie meeting on July 24 came two days after White House lobbyist Tom Loeffler approached Wri^it, D-Texas, with me idea of a Upartisw approach to seeking peace in Iticaragua and othm* Cnitral American countries.</p>
        <p>Initially, Wright was not well-in-</p>
        <p>Ortega in Washington, and administration officials and some Republican members of Congr^ accused 1dm of meddling in ftnreign affairs.</p>
        <p>Some officials said that at one point</p>
        <p>presidential aides shoutod At at tlK White HouseaboiBbtodillMi with Ortega. By</p>
        <p>had patched up matters wtt 8m tary of State eorge P. Sii, wltii thetwovowingauiiitedefforttolidp thepeaceprocess.</p>
        <p>W 752-5251 w</p>
        <p>GnemrUh0 Flaett Bakery ForSSYeate"</p>
        <p>Fruit Cakes</p>
        <p>Just In Time For The Holidays</p>
        <p>815 DIcklnoon Ave. (Dowmtowii)</p>
        <p>Protocol Officials Prepare For Guests</p>
        <p>WASHINGTON (AP) - Three weeks before Raisa and Mikhail Gorbachev are enected, the State Departments chief of protocol is wr-in^ng her hands over how shell make arrangements for the citys most importint diplomatic visit in years.</p>
        <p>**We knew about tiie Chinese visit for months, Ambassador Selwa Roosevelt said. I dont think IU have two weeks for the Soviet visit.</p>
        <p>\(tr</p>
        <p>A-1 Quality Cleaners</p>
        <p>RIvorgato Shopping Center  758-6340  Greenville, NC 27834 Mondey-Saturday 7 a.m. - 6 p.m.</p>
        <p>HAPPY THANKSGIVING</p>
        <p>Shirts Laundered........ ^</p>
        <p>On Hangers  Tax Included In Price Limit 4 Shirts Per Coupon, Please.</p>
        <p>W Do AHontlons And RepaIn  One Diy Sondeo</p>
        <p>I I I I I I</p>
        <p>20% OFF ALL DRY CLEANING</p>
        <p>(Except suede &amp;amp; leather)</p>
        <p>Good Monday. Nov. 23 thru Friday. Nov. 27 This coupon must accompany clothing when brought in.</p>
        <p>We Will Be Closed Thanksgiving Day</p>
        <p>Family Owned &amp;amp; Operated  Quality la Our First Consideration</p>
        <p>ylesociatem</p>
        <p>Regret That An hrcorrectTWephoneNurnber Now Appears hi The YbHow Pages.</p>
        <p>The Correct Number Is</p>
        <p>355-2300</p>
        <p>DC Duane E.KratrerJfDt Laura A Lloyd  A ThnotliySwvef</p>
        <p>Arlington Bivd.*8ulleDQiaentaia,NC</p>
        <p>Come share in a special Christmas celebration of lights and song while experiencing Christmas in a way you never have before.</p>
        <p>Special Faataraa Over 3,500 Ughte Ueed In Special Effacta</p>
        <p>Gueet Narrator David Nome, WGHB Radio AniKNincer Over 60-Voice Choir Handbells Carol Singing Slngere Standing On ~ A25FootTrea</p>
        <p>LIVING CHRISTMAS</p>
        <p>TREE</p>
        <p>Friday, Dec. 4,7:30 p.m. Saturday, Dec. 5,7 p.m. Sunday, Dec. 6,7 p.m.</p>
        <p>Grace Church</p>
        <p>Hwy. 43 At Bells Fork, Greenville For Infonnation, Call 355-3500 Free Admission</p>
        <p>said Mrs. Roosevelt, whose office handles logistical details for state</p>
        <p>The historic U.S.-Soviet summit -the first in the natitms caiatal since Leonid I. Brezhnev met Richard Nixon in June 1973 ~ is expected to attract at least 5,000 reporters, television crews and techmdans, as well as thousands of demonstrators opposed to Soviet policies on AMuuaistan and Jewish emigration.</p>
        <p>The biggest bang-up for Mrs. Roosevelt and other members of the White House and State Department advance teams is the lack of a detailed schedule for the Gorbachevs.</p>
        <p>Hie Soviet leader and his wifo will arrive late on Dec. 7 and leave on Dec. 10, the White House said. Working sessions between President</p>
        <p>take place on Dec. 8 and 9.'__________</p>
        <p>also be a ceremony for the signing of a treaty on intermediate range nuclear missiles.</p>
        <p>In addition, the Reagans are expected to host a welcoming ceremony and a state diiiner for the Gorbachevs, probably on Dec. 8, and the Gorbadiera will nkdy have a return diiuieronDec.9.</p>
        <p>There are other events on the tentative agenda: Secretary of State George P. Shultz will likely have a hfflcheon for Gorbachev, and Mrs. Reagan has invited Mrs. Gorbachev for tea and a private tour of the White</p>
        <p>As of Saturday, however, U.S. officials and their Soviet counterparts had not nailed down a firm schedule either for substantive talks or for ceremonial functions. Mrs. Roosevett said she hopes to have a schedule early in the week, possibly Monday or Tuesday.  i</p>
        <p>U.S. officials also are awaiting word from Moscow on what the Gorbachevs would like to see in the nations capital, which is known for its historic monuments, museums and of interests such as the Capi-</p>
        <p>One event - Gorbachevs</p>
        <p>on Dec. 9 - was scrapped after</p>
        <p>the war between Ni  .</p>
        <p>SamUtas and the U.S.-L. tra rebels, Fernandez said.</p>
        <p>He was weD oriented, but basically at a very raw stage, said Fernandez, who met with Wright &amp;lt;Jul^ 31, not knowing that the Reagan-Wright plan would be announced the following week. Fernandez said that since then, Wright has become very knowledgeable on regional issues. Fernandez said that when he first</p>
        <p>to be worked out with the I tion, Wright did not seem to know the basic nonstarter negotiating positions of the two sides. Hiose are items that eadi side considered non-negotiable, including the San-dinistas insistoice on n^otiating with the Reajean administration rather than the Omtras.</p>
        <p>On July 28, Wright met with Nicaraguas ambassador, (^rlos Tunnerman, in Washington.</p>
        <p>And on Aug. 5, the Reagan-W^t plan was unveiled but was quiduy overshadowed by the signing of the regknal peace plan by President Anas ana the other four (^tral American presidents. Arias won the Nobel Peace Prize for his regional</p>
        <p>Earfitf tins month, Wright met with Nicaraguan President Daniel</p>
        <p>Why drive miles and</p>
        <p>miles for  ^</p>
        <p>seconds...  ^</p>
        <p>...when designer drapery</p>
        <p>fabrics, including WAVERLY,</p>
        <p>are so close to home?</p>
        <p>Totally Covered has first quality &amp;amp; seconds available in exdting new designer drapery fabrics as well as traditional fabrics. Prices start as low as $6 for first quality</p>
        <p>TALLY</p>
        <p>VERED</p>
        <p>M-F 10-6 Sat KM Greenville, NC T</p>
        <p>200 W. Greenville BlviL</p>
        <p>(across from Widws^^mhH^</p>
        <p>14iierson Soviet advance team spent several days in Wi last week touring some of the I</p>
        <p>They returned to Moscow with their recommendations, Mrs. Roosevelt</p>
        <pb facs="00096780_0015" />
        <p>Miiak Tried THide Spill</p>
        <p>I</p>
        <p>V-.-</p>
        <p>m'</p>
        <p>By D6UG FISHER Associated Press Writer</p>
        <p>DAYTON, Ohio (AP) - A tape re-that officials at</p>
        <p>f cording proves ' Wriiht4*atterson Air Force Base trlM CO cover up a radioactive spill at the base, Ohios two U.S. senators</p>
        <p>Seno. Johii Glenn and Howard revealed during a joint the Senate Governmental committees that transcripts of a __ing a meeting by id not identify shortly</p>
        <p>after the Sept. 18,1986, spiU.</p>
        <p>**There is no question an attempted cover-up occurred, Glenn said.</p>
        <p>l%e ^ showed that people at the lia8e"**who understood the sedosmess of the spill clearly advocated that perscHis outside this dIsctBsien' group hot be told of the spOl, Glenn said.</p>
        <p>Those ;yirho participated in the tapdcNBversation advocated secretly dsoontaminating the building in which tm spill occurred, removing the radioactive wsBte from it and erasing the tape, he said. The of-fldals were laughing and joking on the (apiUlP said They )mew thev had committed a dasCai^ act and they were deter-' mined to cover it up, not worrying that ma^ be cause ?tolmi^$Mlaenbaum said.</p>
        <p>The tu^ senators did not discuss the Um further and said the' titescnpt woidd not be released because of a U.S. Justice Department investigation iiito the matter, the Ddiocratic senators, U.S.</p>
        <p>Tonypall, 0-Ohio, and Rep. Michael DeWine, R-Ohio, took repiuters with them on a tour Saturday m&amp;lt;Hming of sites on the base af-fectedl^lhe spill.</p>
        <p>okding to published news , the spill occurred when base wrkers accidentally (^ned a drum of the americium 241 which had been taken to the base by Newark, Ohio, John C. Haynes, releasing a [(rf the material. The jeweler had  1 to use the substance to treat fionds.</p>
        <p>V^hffe House tw^der Caught</p>
        <p>^l^fefllNGTON (AP) - An uniden-man was arrested on the White pHlie grounds Saturday after scaling a Hipce and getting to within about SO yards of t|^ West Wing where President " l^ted.</p>
        <p>IS</p>
        <p>1 The m^ident was in the residen-fKal     </p>
        <p>h</p>
        <p>of the White House, several feet away, when the incident</p>
        <p>officrs of the uniformed of the. Sec^ Service ap-(he man and took to a</p>
        <p>isrdmdded</p>
        <p>gatdmie for. tjuestioning before he was tqp^ over to ^metropolitan police.  )</p>
        <p>The man had entered the grounds from the PeniBylvania Avenue side ami made his way down an enclosed street betwemi the West Wing and the Old Executive Office Building and reached a point near a gua just outside the West Wing</p>
        <p>It is not unusual jfor intruders to nudie it over the tall ii</p>
        <p>iron fence that surrounds the White House, but is rare for one to penetrate so far.</p>
        <p>Whia a reporter asked the youthful map why he had entered</p>
        <p>Beginning Friday, November 27</p>
        <p>In Quincys Parking Lot In Front Of Farm Frash</p>
        <p>401 W. lOTH STREET GREENVILLE. N.C. PHONE 7S8-2S13</p>
        <p>List Price $252.00 Cherry Finish. Authentic Boston Rocker</p>
        <p>Solo</p>
        <p>485</p>
        <p>List Price $895.00. Cannonball Bed. Twin. 1 To Sell.........pnce</p>
        <p>List Price $1295.00. Tall Poster Bed. Full Size.............Pric*</p>
        <p>t  BoaUc-,</p>
        <p>-1085</p>
        <p>List Price $1420.00. Solid Mahogany Corner Cabinet........ Pri&amp;lt;^</p>
        <p>List Price $465.00. Solid Mahogany Drop Leaf Dining Table. 2 To Sell..</p>
        <p>List Price $1575.00 Solid Mahogany Queen Anne Dining Table. 1 To Sell...</p>
        <p>List Price $1100.00. Lingerie Chest - 7 Drawer............</p>
        <p>List Price $710.00. 4 Drawer Nite Chest  ...............</p>
        <p>List Price $1450.00. King Size Pencil Post Bed............</p>
        <p>List Price $2000.00. Wheat Carved Bed. FuH Size...........Prict</p>
        <p>List Price $1800.00. Rope Carved Bed. Full Size............3F  #  s#</p>
        <p>List Price $1925.00. Rope Carved Bed. Queen Size..........^  1040</p>
        <p>List Price $1032.00. Pencil Post Bed. Full Size. .........560</p>
        <p>Ust Price $3995.00. PhUadelphia High Boy .....</p>
        <p> PrtS 2145</p>
        <p>List Price $1680.00. Chest On Chest. 8 Drawer.............^</p>
        <p>BoMk-</p>
        <p>List Price $1250.00. Single Dresser. 4 Drawer.............^</p>
        <p>Boctic-</p>
        <p>List Price $875.00. Bachelor Chest. 4 Drawer..............^</p>
        <p>Boatlc-</p>
        <p>List Price $895.00. Powder Table. 4 Drawer ...........^</p>
        <p>Bo8tk'</p>
        <p>List Price $155.00. Upholstered Bench...................^</p>
        <p>  BmMc-</p>
        <p>List Price $395.00. Bed Steps. Velvet Fabric...............</p>
        <p>Boatk-</p>
        <p>Ust Price $570.00.3 Drawer Nite Chest..................</p>
        <p>Price</p>
        <p>900</p>
        <p>670</p>
        <p>465</p>
        <p>485</p>
        <p>85</p>
        <p>210</p>
        <p>305</p>
        <p>List Price $410.00. Nite Table. 1 Shelf...................^  220</p>
        <p>Price</p>
        <p>n.. $290</p>
        <p>SnSi</p>
        <p>Pike</p>
        <p>List Price $530.00. Landscape Mirror................</p>
        <p>List Price $1925.00. Triple Dresser. 10 Drawer............1035</p>
        <p>SAVE 1/2 &amp;amp; MORE ON SERTA HEALTH REST SLEEP SETS</p>
        <p>The man did not appear to be armed. .</p>
        <p>No other infmmation was immediately available.</p>
        <p>Be certain its Serta.</p>
        <p>Twin</p>
        <p>Size $iS  U</p>
        <p>List Price vVQ</p>
        <p>Full Size......... $190.00</p>
        <p>List Price SO 1 Q</p>
        <p>Queen Size $440.00 JL ^</p>
        <p>List Price  vO^Q</p>
        <p>King Size......$499.00  ib 7</p>
        <p>Each</p>
        <p>Piece</p>
        <p>Each</p>
        <p>Piece</p>
        <p>2Pc.</p>
        <p>Set</p>
        <p>3Pc.</p>
        <p>Set</p>
        <p>1/2 Price Serta Perfect Sleeper Bedding Sale</p>
        <p>\</p>
        <p>SPECIAL PURCHASE SERTA PERFECT SLEEPER ACCORD</p>
        <p>Twin Size</p>
        <p>$9900</p>
        <p>Full Size moo 00 pnce</p>
        <p>149</p>
        <p>Ea. Pc.</p>
        <p>Rattfl Sale</p>
        <p>Queen Size.. .stoo 00 prtc</p>
        <p>359</p>
        <p>tPc.tw</p>
        <p>^ King Size... $55So&amp;gt; w ^449avk.aM</p>
        <p>RataU $200.00  .  ,  </p>
        <p>SAVE ON SERTA PERFECT SLEEPER AVANTI</p>
        <p>Twin Size</p>
        <p>_  ot  Rvtdll  Sale</p>
        <p>Full Size .... $400 00 Price</p>
        <p>Ea.</p>
        <p>195</p>
        <p>Queen Size. $^"00</p>
        <p>Each Placa RatoU 1980.00</p>
        <p>*# A*  Rflinii  Sele</p>
        <p>lUng alZ  . $1200.00 Price</p>
        <p>595</p>
        <p>T aa.4</p>
        <pb facs="00096780_0016" />
        <p>vi</p>
        <p>Th Drtty Reflector. QreenvHIe. N.C. Sunday. November 22.1987</p>
        <p>Tiny Idaho Town Mourns Of Residents In</p>
        <p>ByMARKWARBIS Associated Press Writer MELBA, Idaho (AP) - The sense df sorrow is palpable in this small fcrmii^ town, which lost three young Women in last weeks crash of a Con-Bnental Airlines jet.</p>
        <p>* Tears come easily and the few ttiick smiles are foUowed by pursed Bps and a ahake of the head.</p>
        <p>In Melba, you cant go to the grocery shwe w the hardware store Br to any class in school without seeing soneone who knew them per-ionally, said Michael Funk, a</p>
        <p>former Melba teacher who is minister of Christian education and youth at First Church of the Nazarene in Boise.</p>
        <p>Its like losing a family member for a lot of them, he said, some of them, maybe even like losing a sibling.</p>
        <p>Ten people from this town of 300 were aboard the Continental DC-9 that crashed Nov. 15 while taking off in a snowstorm from Denvers Stapleton Airport for Boise. Three died and three remain hospitalized, one in critical condition.</p>
        <p>On Friday, the town buried Sherry erwood.</p>
        <p>Nelson, 18, and Janine Ledger 17, who were among members of the Melba Ifi^ Schim chaptm* of the</p>
        <p>Future Farmers of America attending a national convention in Kansas City, Mo. The funeral for Tami Daniel, 26, wife of the chapter adviser, was scheduled Saturday.</p>
        <p>Continental sent a team of counselors to Melba to heto the community work its way throu^ the trauma.</p>
        <p>Its like your own; it doesnt matter what their name is. Theyre part</p>
        <p>STRICKEN Wrm'GRIEF - Melba High School students Jason Simpson, left. Rod Herman, center, and Brad Hnff. student president, were hit hard by the deaths recently of two classmates and an FFA chapter advisers</p>
        <p>wife in the Continental Airlines DC-9 crash in Denver. Experts say it will be a long time before die grief of the small Idaho farm town of 390 subsides. (AP Userphoto)</p>
        <p>of the community, and part of us, said aty Clerk Lynn Perry, fighting back tears at Melbas one-room City Hall across the baseball field from theschool.</p>
        <p>The thing is, this isnt over, and it miit never be, she said.</p>
        <p>More than in cities, the kind of shared grief she expressed is strong in small rural communities like Melba, said Pat Dorman, head of the sociology department at Boise State University.</p>
        <p>Theyll go through the grieving process just like members of a family would, she said. People anywhere will feel a sense of symrathy. But when youre talking about losing one of your peers in the school system or one of your close neiibors, thats part of you.</p>
        <p>In Melba, a town with five churches, some grain elevators, a feed store and a few other small businesses, the school is the one thing that binds ti^ether farm families scattered over the southwestern Idaho plains north of the Snake River.</p>
        <p>The FFA is one of the schools largest organizations so there was a sense that the students who braveled to Kansas City represented the entire community.</p>
        <p>The links those people have to the community are impressive and awesome in a way, Dorman said. The more youre involved with other people, especially in a rural community, the more people there are to remember you.</p>
        <p>The crash victims represented ^ towns h(^ for the future, which adds to the shared hurt, Dorman said.</p>
        <p>Were anticipating theyre going to live until their 70s mr 80s and do a lot of wonderful things, then theyre snatched away like a green apple off a tree, she said.</p>
        <p>As a result, nearly everyone in Melba is likely to experience frustration, anger and denial as part of the grimdng process, then reconciliation</p>
        <p>AHENTION**</p>
        <p>GREENVILLE CITY COUNCIL AGENDA Monday, November 23,1987  5:45 PM Third Floor Council Chambers - Municipal Building</p>
        <p>Tht Qrttnvlllt City CouncH will conduct a spaclal call moating at tha abova tima, data and location for tlia following purpoaa:</p>
        <p>1. Conducting a public hearing on tha proposed annexation of 583 acres known as Brook Valley 8 vicinity.</p>
        <p>Tha public Is invitad to attend.</p>
        <p>Betty Ford 'Doing Well' Following Bypass Surgery</p>
        <p>RANCHO BORAGE, Calif. (AP) - Betty Ford on Saturday visited with her husband, f(mer Presideit Gerald Ford, and children a day after having quadruple coronary artery bypass surgery, a spokeswoman said.</p>
        <p>Shes doing exceptionally well and resting comfortably, said her spokeswoman, Sharyn Sheldon.</p>
        <p>Theyve all been over to see her. They just got back. I^s awake, ^s doing fine.</p>
        <p>In additim to the bypass, BSrs. Ford, 69, also undter-went a procedure to clear blockage in her right carotid artoy, one of two arteries that carry blood to the sides (rf the neck andhead.</p>
        <p>Dr. Jack Stemlieb headed the team that performed the</p>
        <p>surgery Friday morning at Eisenhower Medical Center, said another spokeswoman, Ann Cullen.</p>
        <p>She will be going home on Thanskgiving eve, Stemlieb said Friday. But her family has promised she wont have to cook over the holiday.</p>
        <p>Mrs. Ford was admitted to the hospital last Sundav because of chest chscomf(Ht that began in April, Stemlieb said.</p>
        <p>Coronary bvnass surgery is done when blood vessels</p>
        <p>iwMting to the heart have become Mocked or diseased, creating the potential for a stroke or heart attack. Healthy pieces M blood vessel are taken from other parts of the body and iKed to circumvent the blockages.</p>
        <p>'Big Jim' Folsom Dead At 79</p>
        <p>CULLMAN, Ala. (AP) - Former two4erm Gov. James E. Big Jim olsom, a 6-foot-8 folk hero who brought paved roads to rural Alabama and preached racial moderatkm in tivbulent times, died Saturday. He was*79.</p>
        <p>Folsmi, who was blind and bedrid-dien, became seriously ill at his Odlman home about 1 a.m. and died bout an luNir later from a heart attack with his wife, Jamelle, at his aide, said Peck Fox, administrative assistant to Lt. Gov. Jim Folsom Jr., the late governors son.</p>
        <p>During his two terms as governor In the 1940s and SOs, Folsom pushed for higher teacher salaries, old-age pensions, farm-to-market roads and teapporti(Hunent of the Legislature. He also advocated repeal of the poll lax to provide greater ballot access to poor blacks and got a law passed</p>
        <p>making it illegal to wear a mask on state highways, thus removing the hoods fnnn Ku Klux Klansmen.</p>
        <p>Folsom was in failing health in recent years and was legally blind for mwe than a decade. But despite I^ysical ailments, he kept up Ms love affair with the ballot, running for governor seven times and finisMng fourth out of five Democratic candidates in his final race in 1962.</p>
        <p>Folsom w(Mi his first term as governor in 1946, stumping the state with tte Strawberry Piders band and the song Yall Come as his campaign thmne. A mqp and bucket in hand, he</p>
        <p>WINDOW</p>
        <p>COMFORT</p>
        <p>REPUCEMENT WINDOWS STORM WINDOWS STORM DOORS WINDOW QUILTS</p>
        <p>PORCH</p>
        <p>ENCLOSURES</p>
        <p>EXPERT INSTALLATION AFFORDABLE PRICING FREE ESTIMATES</p>
        <p>CALL OR VISIT:</p>
        <p>1528 S. EVANS STREET D QREENVILLE -.LOCAL 756-8992 TOLL FREE 1-800-451-2208</p>
        <p>Faith &amp;amp; Victory Church</p>
        <p>presents</p>
        <p>Roberts Llardon</p>
        <p>November 30 &amp;amp; December 1  7:30  p.m.</p>
        <p>Roberts Llwton was bom In Tulsa, Oklahoma. M  ^</p>
        <p>tiled In the Holy Spirit, and called to the ministry at the age of rtght, after being caught up to heaven by the Lord &amp;lt;fa^. wm powerfully commissioned by the Lord to study the IIvm of God s orsat ^ women ministers and learn why they succeeded ai^ why they WW. Six years were spent In preparation for that calling and vision God had given</p>
        <p>**At*"soe 14, Roberts began preaching and teaching In denominational and non-denomlnstlonal churches, Bible colleges and universities. He has traveled extensively In the United States and Canada, and his missions outreach has taken him to Africa, Europe and Asia Ministering the Gospel with great artolnting from God and the power of the Holy Spirit, Roberts challenges people to walk In the Spirit with the blessed Trinity.</p>
        <p>1/4 MU# South Of PRt Community Collogo On County R41708 ON HlghtMy 11</p>
        <p>B</p>
        <p>Park Place</p>
        <p>Youth Group</p>
        <p>Single dresser with bookcase, he1board, footboard, and storage underneath with mattress.</p>
        <p>$47995</p>
        <p>(floor sample only) 9762.95 Sale</p>
        <p>Burlington House Bedroom SuHe</p>
        <p>Headboard, night table, armoire, dresser and mirror</p>
        <p>.*999*</p>
        <p>(floor sample only)- Reg. *1999.95  sale</p>
        <p>Hurry, Dont WaH!</p>
        <p>^l^mLng ^uxnituxe. do.</p>
        <p>Visa</p>
        <p>1012 Dickinson Ave. Mastarcard</p>
        <p>say.</p>
        <p>The survives may fed lingering pain, even guilt. But Mdba students, particularly those on Flight 1713, are unusually levd-headed and eventually will get nast the exnerience with</p>
        <p>friends.</p>
        <p>mehelpofi</p>
        <p>said</p>
        <p>I have never been associated with a school or a community that has more mprit de corps or discipline, he said. ^*11 people there really pull together.</p>
        <p>THE PiTT COUNTY MEDICAL SOCIETY AUXILIARY HEALTH EDUCATION FOUNDATION</p>
        <p>cordially invites you to participate in the Lighting Ceremony of the:</p>
        <p>With your tax-deductible donation of $5.00, $50.00, $100.00 or $500.00, a light may be purchased in honor or memory of a friend or loved one, who's name will then be placed In the Book of Honor, to be displayed year 'round at Pitt County Memorial Hospital.</p>
        <p>TREE LIGHTING CEREMONY DECEMBER 3,1987 7:00 PM PITT COUNTY MEMORIAL HOSPITAL</p>
        <p>Raindata: December 4, 7:00 pm</p>
        <p>Our Lighte of Love tree will be dedicated in loving memory to the East Cart Crew and their patient, who died January 8,1987.</p>
        <p>LIghta of Love, P.O. Box 8294, Greenville, NC 27835 75M775 758-7129 7588842</p>
        <p>told crowds at dozens of town squares that he was going to clean out the scalawags at the Clapitol.</p>
        <p>He w&amp;lt;m his second four-year torm in 1954 and, despite growing racial turmoil, built a reputation as a pqwlist and racial moderate, once sharing a drink on a portico of the Executive Mansion with black Rep. Adam ClayUm Powell of New York.</p>
        <p>A colorful figure full of earthy humor and down-home language, Folsom was known as the little mans big friend for his fight against special interests </p>
        <p>Play It MFE</p>
        <p>Play It MADT</p>
        <p>First American Announces The Safe, Smart CD.</p>
        <p>When you're looking for safety for your investment, then look for safety in numbers  FIRST AMERICAN'S numbers. High guaranteed interest rates backed by the secure comfort of deposit insurance up to $100,000 by the FSLIC.</p>
        <p>All it takes is an opening deposit of $3,000 or more and for the next 30 months you'll be earning one of the highest rates around. It's all you could want out of an investment. It's smart and it's safe.</p>
        <p>Here's How It Works:</p>
        <p>WHENYCXr</p>
        <p>oefQsrr &amp;gt;</p>
        <p>FOR THE FIRST 3 ' I^VdUEARN</p>
        <p>THEN FOR 27 M05 VOUILEARN</p>
        <p>COMBINED RATE 30 MONTHS</p>
        <p>$3,000</p>
        <p>to</p>
        <p>$24,999</p>
        <p>10%</p>
        <p>8.1 %</p>
        <p>8.29%</p>
        <p>$25,000</p>
        <p>or</p>
        <p>More</p>
        <p>12%</p>
        <p>8.2%</p>
        <p>8.58%</p>
        <p>INTEREST ON THESE RATES IS COMPOUNDED QUARTERLY</p>
        <p>Play it safe. Play it smart. Choose the level of investment that best fits your needs. Choose the safe, smart CD at FIRST AMERICAN where you can always count on us for complete service and satisfaction.</p>
        <p>So stop by the nearest office of FIRST AMERICAN SAVINGS BANK, FSB, Ask for our special 30month certificate^ It's tire smart and safe way to watch your money grow.</p>
        <p>RSfAVIEBCAN</p>
        <p>SAVINGS BANK Fse</p>
        <p>; Subtumijil penalty fur early withdrawal. Offer ubjet t lu &amp;lt; hange or withdrawal yvithout notice. Minimum deposit for thii 30-month certificate i $1.000.</p>
        <p>esce:</p>
        <pb facs="00096780_0017" />
        <p>r</p>
        <p>,</p>
        <p>i!</p>
        <p>'</p>
        <p>The Patly Reflector, Gfeenville. N.C. Sunday November 22, t987</p>
        <p>ODESSA, Texas (AP) - A 5-year- 1 boy who passed up a prize bicycle ' a $50 check to buy food for his ^nily has gotten some wheels after .and a whole lot more. /</p>
        <p>Mike Robles was given a choice of Uke, a radio or the money for jpinning a monthlong attendance con-</p>
        <p>For His Decision</p>
        <p> Live Cedar</p>
        <p>test at Fannin Early Education Center earlier this mmith. But, with his father laid off, Mike went right for the $50 check.</p>
        <p>As word of Mikes selflessness spread, people across the stte offered help.</p>
        <p>Last week, tl Ector County In</p>
        <p>dependent School District Executive Council bought Mike a new bike similar to the one offered as the attendance prize, and others offered bikes as well. The publicity also brought job offers to Mikes father, Rafael, who now has a construction Fot days die idione has been just</p>
        <p>ringing &amp;lt;rff the wall, i said Famdn Early Education Center Principal Janet Baker.</p>
        <p>Emfdoyees at a radio station in</p>
        <p>Las Cruces, N.M., called to say th^ for ail</p>
        <p>' Calls and letters have onne in firmn Cleburne, Dallas, El Paso, Fort Worth, Grand Prairie, Plainview and Corpus Christi, as well as locally.</p>
        <p>Leaves Hospital</p>
        <p>e ^ RyWENDYE.LANE I Associated Press Writer '  MIDLAND, Texas (AP)  A smil-ng Jessica McGure teetered out of a Kspital ih a cast Friday, a month iftOT the nation watched determined escuers pull the toddler 4rm an ibandonea well where she had survived a grueling 58&amp;gt;/^ hours.</p>
        <p>- The 19-month-old girl who was ^rescued Oct. 16 rode down a ramp at pM^nd Memorial Hospital in a toy pvagfHi, then got out and tried out her jpast with her parents.</p>
        <p>*&amp;gt; Thanks to the grace of God and heroic men, weve got our baby  said Jessicas father. Chip [cdure, before the family got in a ir and drove away, r McClure and his wife. Cissy, said ^y were looking forward to sprawling a happy Thanksgiving with the lainilyreiEied. &amp;lt; t Holding a Winnie-the-Pooh stuffed liear and 'wearing a black satin</p>
        <p>r!t ^ring the name and seal of Midland Police Department, Jessica waved to reporters and bystanders as she and her parents</p>
        <p>Isnt that cute, said Winnie Whitmire of Odessa, among about 30 bystanders. She really means a lot to us here.</p>
        <p>Later, Reba Wilbom, Jessicas grandmother, said the family members were Writh friends now and theyll be spending the holidays out of town with family members. She said she was looking forward to having the family together.</p>
        <p>After Jessica fell 22 feet through an eight-inch opening, volunteers dug through solio rock to reach her. She had l^n in Midland Memorial ever since, undergoing treatment for various injuries she suffered.</p>
        <p>Doctors feared they would have to amputate her right foot, which was jammed at an awkward angle when she was trapped. But only the little toe was removed, and Dr. Shelton Viney said the girls long-term prognosis was excellent.</p>
        <p>The little girl has a fairly active, aggressive personality, said Viney.</p>
        <p>Shes been feisty since day three, said Dr. Debbie Reese.</p>
        <p>Viney said Jessica will have scars on her thigh, where skin for the graft wartaken, a well as on the foot. A scar from a pressure wound on her forehead may require plastic surgery in 10 years or so, he said.</p>
        <p>She will wear the walking cast, put on Thursday, for two or three weeks. It will be replaced by a walking splint</p>
        <p>after her skin grafts are evaluated, doctors said.</p>
        <p>Shes walking a lot mrae now than what we really anticipated, said Viney. In fact, wed like her to stay off her foot a little more than what she wants, because we dont want it tfl^tooswidtett.</p>
        <p>Jessica means an awful lot to us, not just in terms of the fact that she came in here looking'like the dickens and is leaving looking awfully good, said hospital President Ray Branson.</p>
        <p>wanted I</p>
        <p>the diUdren in the family, Ms. Baker said. Its extremely heartwarming.</p>
        <p>I was so surprised. It looks like our famity will have the happiest Thanfcsgii^ we have ever had, Mikes 29-year-old mother, Lupe, said.</p>
        <p>Things like this seem to pull people together. I wouldnt want to take anythhig away hrrai Mike and Im not soliciting, but we do have other children in need, she said.</p>
        <p>The Robles are caring for their five nieces and neriiews as well as their own two children, Mike and his 6-year-old brother, Rafael. They assumed custody of the other children when their parents were unable to care for them.</p>
        <p>Mike is the youngest of the seven children, while the oldest is 10 years old, Mrs. Robles said. The family came to Odessa from Mexico seven years ago when jobs were easy to find.</p>
        <p>Christmas Trees</p>
        <p>Choose Your Own.</p>
        <p>See Ashby Bynurn.</p>
        <p>@ Bynum Repair Service</p>
        <p>Hwy. 258 South  Farmville 753-2077 or 753-4086</p>
        <p>KtJdb</p>
        <p>\Joy</p>
        <p>The Complete Home Cleaning System</p>
        <p>SALES &amp;amp; SERVICE</p>
        <p>Open House Today ^ 2-6 p.m.</p>
        <p>756-9812</p>
        <p>Under New Management</p>
        <p>Shes a young child and she ought to be able to walk without any kind of noticeable limp, he said.</p>
        <p>Join us and the other Arlington Village merchants in a toast to the upcoming holiday season.</p>
        <p>WeTI make your wtskes come trae.</p>
        <p>Doctors cited Jessicas personality as a key to her successful recovery.</p>
        <p>Pleaae Join us for our Open House at Arlington VHIage Sunday, 2 p.m. to 5 p.m.</p>
        <p>AN INTERIOR DESIGN CORPORATION</p>
        <p>BRAD PARRIS  ANGEL  MflVIN</p>
        <p>ASIOastoc.  ASIO  ossor</p>
        <p>630 E. Arlington Boulevord  Mondoy-FrKtoy  10  to</p>
        <p>Greenville, North Carolina 27834  Soturdoy  10  m  3</p>
        <p>1 HOME FOR THANKSGIVING  Jesica McClure, 19 months old, leaves JVIidland Memorial Hospital in Texas with her parents. Cissy, left, and Chip, yight. Jessica spent more than a month in the hospital in Midland after she was rescued from an abandoned water well. (AP Laserphoto)</p>
        <p>^noui &amp;amp; then designs^</p>
        <p>We will be open Saturday after Thanksgiving from 10 to 5</p>
        <p>91 r Red Banks Road, Arlington Village 756-8470. Open Monday-Friday 10 to 5.</p>
        <p>Holiday Open House November 22,1987</p>
        <p>Warm Up To A Special HoUtkty Season</p>
        <p>Welcome To Arlington Vmage</p>
        <p>Warm up to Arlington Village at our holiday open while you're shopping at Arlington Village, enjoy house on November 22nd. Er\joy a special kind of refreshments and good cheer to ring in the holiday cheer in each of our stores and specialty shops, season.</p>
        <p>The choices at Arlington Village are everlasting. Holidays at Arlington Village are special. Because Dtmng our open house, browse through a fine selec- we offer you the old fashioned service you want, tion of.mens and womens designer fashions, the along with the convenience you need. Like plenty latest in interior design, original artwork, childrens of storefront parking and an accessible location, clothing and unique gift items. Youll see dancewear, Welcome to our holiday open house at Arlington electronics, jewelry, holiday floral arrangements. Village, November22,1987, We re warming up for home and kitchen accessories and gift baskets. And a special holiday season.</p>
        <p>1</p>
        <p>Davis-Miller Interiors  The Kitchen Cupboard  J. Fogg. Ltd.  Certain Things  Little by Little  Clark Gallery  At Barre Steinbecks Mens Shop  Lautarcs Jewelers  Benetton  Carolina Desi^i Associates  Bernina  Fabricate Too  Maternity Moments The Scotch Bonnet  Mattta  The Snooty Fox  Hahn Construction Company  Cox Floral Service  The Salon  The (;azebo  Allstate The Dieters Chib  The Golden Gull  Curts Matties  The Hub Ltd./Big &amp;amp; Tall  C. Heber Forbes  The Blind Design  N(.w &amp;amp; Then l)e.sigiis</p>
        <p>Conn of ArUngloa Boulevard and Red Banks Road</p>
        <pb facs="00096780_0018" />
        <p>^A-H The Dally Reflector. Qrenviiie. N.C.  Sunday. November 22.1987</p>
        <p>f^'alestiniaii-American Seaks Help In Fighting Expulsion From Israel</p>
        <p>By JOCELYN NOVECK Associated Press Writer</p>
        <p>JERUSALEM (AP) - A Palestinian-American ordered expelled from</p>
        <p>*  Jewish</p>
        <p>Israel todt his case to a Jerusalem synagogue Saturday, asking Jewish wor-</p>
        <p>shiMrs to support his fight to remain in the country. Mubarak Awad, a Christit</p>
        <p>*.    x.hristian Arab with U.S. citizenship, told the Sabbath</p>
        <p>congregation, This has become a confrontation between me and the Israeli government. And that government represents you. So I ask for your support.</p>
        <p>The Jerusalem-born Awad, 44, is known for his advocacy of non-violent resistance to Israeli occupation of the West Bank and Gaza Strip, captured by Israel in the 1967 Middle East war and home for about 1.4 million Palestinians.</p>
        <p>Awad was ordered to leave the country by Friday, when his three-month tourist visa expired.As of midnight Friday I am in the country illegally, Awad told The Associated Press following the Sabbath service. But I am not leaving.</p>
        <p>An Interior Ministry spokeswoman confirmed Awad had been denied a visa extension, but said there were no immediate plans to expel him.</p>
        <p>The statement Friday, indicating new government flexibility in the case, followed U.S. government expressions of concern.</p>
        <p>Awad said he made the unusual move of visiting a synago^e to show he has support in all three of Jerusalems major religious communities.</p>
        <p>le visited the A1 Aqsa mosque, one of Islams holiest sites, on Friday and said he would visit a church on Sunday.</p>
        <p>It feels as strange to be in a synagogue today as it did to be in a mosque</p>
        <p>yesterday,.......</p>
        <p>ation.</p>
        <p>worse than death because it meant never returning to his homeland.</p>
        <p>If someone is in kil, he stays maybe 15 or 16 years and is then released, he said.  But Palestuiians who are deported cannot come back here at all.</p>
        <p>I am a Palestinian, and I was boro in Jerusalem, Awad said. I feel as strongly about having been boro here as any of you do.</p>
        <p>Rabbi Lavey Weiman-Kelman, head of Kol Haneshama, said he invited Awad when he heard the Palestinian wanted to address a synagogue but had not yet found one to accq)t him.</p>
        <p>This is an excellent opportunity to show that Jews and Arabs can live together and support each other, Weiman-Kelman said. He said he had received no warnings from Israeli authorities not to receive Awad.</p>
        <p>Eddie Kaufman, a congregant, accompanied Awad.</p>
        <p>Awad has homes both in Jerusalem, where his wife, Nancy, is a teacher, and Wapakoneta, Ohio, where he runs a counseling clinic for delinquent teen</p>
        <p>agers.</p>
        <p>y, Awad told worshipers at Kehilat Kol Haneshama, a Reform con-n. But I came because I believe in every religion there is truth.</p>
        <p>itice and responsibility.</p>
        <p>Awad told the congregants he saw deportation as a danger sometimes</p>
        <p>He is the author of a book called Non-Violent Resistance: A Strategy For tlie Occupied Territories, in which he urges Palestinians to refuse to pay taxes, to boycott Israeli products and to lie down in front of bulldozers to prevent land confiscation.</p>
        <p>Thousands of Jewish U.S. citizens who live in Israel do not risk expulsion because as Jews, they have an automatic right to Israeli citizenship.</p>
        <p>Most Palestinians in Arab east Jerusalem are considered residents, not Israeli citizens. Many hold Jordanian citizenship, but about 20,000 hold American passports.</p>
        <p>Awad left Jerusalem in 1969 to study in the United States and did not return until 1965. His Israeli-issued identity card was confiscated in May.</p>
        <p>Awad said (rffcials told him that since he had been out of the country for more than 15 years, his ^sidency was now considered in the United States.</p>
        <p>Smoking Ban Is Endorsed</p>
        <p>BEUING (AP) - Vice Premier Wan Li wants to ban smoking in China, the worlds largest producer and consumer of tobacco, a government-run newspaper reported Satur-</p>
        <p>%</p>
        <p>a cancer research conference Friday, Wan dwelt on the harmful effects of smol^ and said it should be prohibited in public places, the English-language China Daily said Saturday.</p>
        <p>Beijing started a no-smoking campaign this year and forbade smoking in 100 specific public locations, but rofiffcementislax.</p>
        <p>Shanghai launched an anti-smoking campaign last year, and Tianjin in September banned smoking from its CMmical factories.</p>
        <p>China has an estimated 250 million smokers among its 1.07 billion peo-(de. More than 60 p^nt of adult men smoke, according to Chinese statistics.</p>
        <p>The tobacco industry is a major source state revenue. Its cigarette production doubled from 1978 to 1966 and is expected to double again, to 130 billion packs annuaUy, by 1990.</p>
        <p>High-quality cigarettes re often sed as oribes, and offering a ciga-</p>
        <p>CABLE SABOTAGE  Servicemen Malcolm McDonald, left, and Ross Carrozza from the Anstralian government-owned telecommunication network. Teiecom, start tackling what will be a mammoth repair after massive sabotage of Sydney's teiephone system</p>
        <p>Friday night. Unknown persons, familiar with Sydneys andwgromid system, cat throng 24 cables, affecting np to 10.0N customers in 36 snbnrhs. The damage is estimated in millions of Australian doliars. (AP Laser-pholo)</p>
        <p>used</p>
        <p>rette is seen as a sign of frimiship.</p>
        <p>But if the Chinese do not change their smoking habits, about 50 million peqple now under 20 years old will die frmn diseases related to</p>
        <p>tobacco when they reach middle age, Richard Peto, director of cancer</p>
        <p>studies at Oxford University said at the conference.</p>
        <p>Sri Lanka Sees Cease Fire</p>
        <p>COLOMBO, Sri Lanka (AP) - A cease-fire took hold in northern Sri Lanka on Saturday amid reports that Velupillai Prabhakaran, cluef of the dominant Tamil rebel militia, would travel to India for talks on a permanent peace.</p>
        <p>No incidents involving Tamil s^ratist rebels were reported after Inma unilaterally commenced the 48-hour cease-fire at 7 a.m.</p>
        <p>Shoppers on the northern Jaffna Peninsula turned out in force to buy food being trucked in to end a lengthy shortage.</p>
        <p>But officials said an Indian soldier, aiqiarently burdened by troubles from home, went berserk in the eastern port of Trincomalee and shot two people to death. Four civilians were wounded, thev said.</p>
        <p>An official at the Indian High (Commission, or embassy, said the soldier apparently lost control after receiving bad news from India.</p>
        <p>The official, who spoke on condi</p>
        <p>tion of anonymity, said the soldier was disarmed after he started shooting wildly while on foot patrol in the town 150 miles northeast of Colombo.</p>
        <p>He said the man had lost a brother who also took part in the offensive against the Tamil rebels that India b^anOct. 10 on the peninsula.</p>
        <p>The 16Hlay (rffoisive was launched</p>
        <p>Prabhakaran was expected in India within a couple of days for talks on the peace pact and a possible end of hostilities.</p>
        <p>Senior leader Deng Xiaoping, a chain smoker who is known to favor Panda brand cigarettes, has attributed his good health partly to his heavy smctog.</p>
        <p>St. Patricks Cathedral in New York City was consecrated in 1910.</p>
        <p>after the Liberation Tigos of Tamil it r^l group, re-</p>
        <p>Eelam, the dominant i jected an Indian-brokered peace accord and refused to surrender their weapons.</p>
        <p>The accord, signed July 29, aims to end Tamil ^rrillas 4-year-old civil war for an independent homeland by offering them greater autonomy on this isl^ natimi. India, with a big Tamil po{)ulation of its own, sent peacekeeping troops to enforce the agreement.</p>
        <p>In India on Saturday, a senior Tamil politician said Tiger leader</p>
        <p>The Tireplace iL Shop a</p>
        <p>Everything for the fireplacel Since 1976</p>
        <p>ON</p>
        <p>SALI</p>
        <p>Without Tho Fuss. Msss And Work Of Wood!</p>
        <p>105 MsrlgoldSL Uptown Rocky Mount, NC Phono 4464288 Hours: Moa-Frl. 9:80-8:30 Sol, 10-2</p>
        <p>sINSTANr nPUTWl</p>
        <p>ONE HOUR PHOTOS I</p>
        <p>THE PLZA 355-5050  |</p>
        <p>Begin Your Education At Pitt Community College For An Allied Health Career</p>
        <p>Local Jobs Available For;</p>
        <p>Your Pictures Never Looked So Good...So Fast!</p>
        <p>One Hour Color Prints One Hour Color Enlargements Overnight E-6 Slides Overnight Black &amp;amp; White Video T ransfer Services Passports And Studio ^ Photography Cameras, Frames, Albums</p>
        <p>Nursing Assistants</p>
        <p>(New Class Starting Winter Quarter) Nurses</p>
        <p>Respiratory Care Therapists Radiologic Technologists Medical Secretaries</p>
        <p>Learn More About Training For These Careers At</p>
        <p>Pitt Community College</p>
        <p>FR T  " FREE </p>
        <p>Enlargement,! Doveloping</p>
        <p> With Purchase Of I $1.99Valifo iB</p>
        <p>I Any Color Enlargement </p>
        <p>Allied Health Testing Monday, November 231:00 P.M. Everett BIdg. Room 145</p>
        <p>2nd Set Of Prints</p>
        <p>At ttma of</p>
        <p>processing |  UpTo11*x14*</p>
        <p>I Om Coupon Par VWl</p>
        <p>(Mm. S Rolls)</p>
        <p>For Each Roll Developed &amp;amp; Printed</p>
        <p>(Mai.tiWta)</p>
        <p>I Om Coupon Par VlaH I    Om Coupon Par WUH nH</p>
        <p>! Expires Dec. 7,1907 | Expires Dec. 7,1987  Expires Dec. 7,1987</p>
        <p>.  * i hIh fiB Hit I</p>
        <p>756-3130, Ext 245</p>
        <p>(W22)</p>
        <p>Find It Fast In Classifted</p>
        <p>SOFAS</p>
        <p>TRADITIONAL</p>
        <p>WE TRADE</p>
        <p>FURNITURE DEPOT</p>
        <p>524 WeW 10th SL Ms Tho</p>
        <p>RsHreodOwU</p>
        <p>752-3223</p>
        <p>CORDON'S</p>
        <p>GOLF AND SKI SHOP</p>
        <p>....for oil your snowskiing needs</p>
        <p>OrMiwill* Blvd.</p>
        <p>Next to Greenville TV and Appliances 756-1003. Open Wed. 8 Fri. Until 9:00 p.m.'</p>
        <p>Homeowners insurance</p>
        <p>discounts</p>
        <p>from State Forms</p>
        <p>For qualified homeowners, we offer discounts which can make our already low premium even lower.</p>
        <p>Call</p>
        <p>EARL THOMPSON</p>
        <p>Like a good neighbor. Sram Farm is there</p>
        <p>State Farm Fire and Casualty Oxnpany Home OMice: Bloomington.illlinow</p>
        <p>RACK ROOM</p>
        <p>SHOES</p>
        <p>GREENVILLE BUYERS MARKET MEMORIAL DRIVE</p>
        <p>5 HOUR SPECIAL!</p>
        <p>TAKE AN</p>
        <p>E-X-T-R-A</p>
        <p>10%</p>
        <p>OFF</p>
        <p>OUR EVERYDAY LOW, LOW PRICES WITH COUPON</p>
        <p>STORF coupon</p>
        <p>RACK ROOM SHOES</p>
        <p>TAKE AN</p>
        <p>E-X-T-R-A 1 0 %</p>
        <p>OFF OUR</p>
        <p>lvfryda^</p>
        <p>LOW PRICES</p>
        <p>COUPON GOOD only GUN fiOV '2</p>
        <p>r</p>
        <pb facs="00096780_0019" />
        <p>Lebanon</p>
        <p>By War, Economic Collapse</p>
        <p>By MOHAMMED SALAM Associated Press Writer BEIRUT, Lebanon (AP) -'Water! shouted janitor Adnan : Sinno into the intercom of the Daouk : apartment building at 2 a.m.</p>
        <p>Within minutes, people in &amp;lt;</p>
        <p>; gowns and night clotnes were up in their apartments filling buckets and plastic jerry cans with drinking water.</p>
        <p>Quick, put the dirty clothes in the : washing machine before the power goes off again, Suhaila Labban told her husband as he filled plastic containers. Other housewives did the</p>
        <p>same.</p>
        <p>But the power went off agaiq, cutting off the water supply and the washing machines.  '</p>
        <p>S(Hneone was trapped in the elevator and banged the metal door, shouting; Get me out of here!</p>
        <p>The ordeal of the 48 families in the 12-story Daouk building in Moslem west Beirut is a microcosm of the Lebanese nations daily fight for survival in an economic collapse brought on by 12 years of civil war</p>
        <p>The almost daily violence  the</p>
        <p>bombs, bullets, assassinations and kidnapping -v hav killed an estimated 130,000 people. More than 1</p>
        <p>million, a quarter of the prewar pop-ulati(Hi, have been displaced in the civil war that broke out in 1975.</p>
        <p>With the government as divided as the country, now sliced iro into sectarian cantons run by militias, and unable to keep the half-dozen power stations running, electricity is cut for 12 hours a day. There is a shortage of fuel for private generators.</p>
        <p>Beyond such daily irritants, the collapse of the Lebanese pound has resulted in shortages of basic items, including foodstuffe, in a country ttet has to import at least 85 percent of its needs.</p>
        <p>Lebanese for years showed a dogged resilience to the carnage and destruction around them, but now, for the first time, are finally showing signs of caving in to the de^ir that envelops them daily.</p>
        <p>Its a vicious circle. You dig a water well for your building, but theres no power to operate the pump. You buy a power generator, then theres a fuel shortage, said Abdul Hafiz Labban, a Sunni Moslem contractor.</p>
        <p>The standard of living is going from bad to worse. And I dont think weve even seen the worst yet, he</p>
        <p>said.</p>
        <p>Only the very rich are untouched in</p>
        <p>a country that once was known as the Switzerland of the Middle East.</p>
        <p>In Beirut, people scavenge for scraps in piles of rotting garbage in the streets.</p>
        <p>The Lebanese pound, once the Middle Easts strongest currency,</p>
        <p>I has nosedived in the last two years to an all-time low of 700 to the dollar.</p>
        <p>Before the war it was pegged at 2.5 to the dollar and remained amazingly resilient until 1985 despite the fighting.</p>
        <p>That has pushed prices sky high. A recent 100 percent pay raise ordered by the government did little to help Lebanese cope with the worsening crisis.</p>
        <p>It made up only one-third of the loss that the pound has suffered, said economist Kamal Hamdan.</p>
        <p>In 1975, the government-set minimum monthly wage of 210 pounds was equivalent to $84. The current wage of 8,400 pounds is worth only $12.</p>
        <p>Inflation, 8 percent in 1975, is expected to reach 400 percent by the end of the year, Hamdan noted.</p>
        <p>An economic analysis prepared by the President Amin Gemayels staff showed that the average national income dropped from the equivalent of $1,330 in 1975 to $155 now.</p>
        <p>ELDERLY CARRY FOOD - Elderly Lebanese women carry boxes of food on their heads as they cross on foot Beiruts dividing Green Line from the Christian eastern sector to the Moslem west side Saturday. The</p>
        <p>crossing is the only open gate between the east and west Beirut demarcation line to visit relatives and sort out business and personal affairs. (AP Laserphoto)</p>
        <p>Candidates  doUAR FOR POULAR -</p>
        <p>Trade Barbs</p>
        <p>SEOUL, South Korea (AP) -Presidential candidates traded charges of corruption and cruelty Satunday as thousands of riot police stood guard to prevent attacks and violence by rival supporters.</p>
        <p>Government candidate R(di Tae-woo, visiting the central city of Taejon, attracted the largest crowd yet in his campaign. Korean news me&amp;amp;a estimated Uiat about 400,000 people turned out to cheer him.</p>
        <p>^Roh and the top two opposition candidates* - Kim Young-sam and Kim Dae-jung -held rallies in different parts of the nation as they stefqped up their campaigns for the Dec. 16 elections, each claiming he will win and insisting he alone can save South Korea from violence and chaos.</p>
        <p>The military rulers have been cunningly instigating regional animosity, a wicked evil which devastates the nations, Kim Young-sam Udd a rally in the southwestern city ofChonju.</p>
        <p>Guarding the candidates were large contingents of riot police, in green combat fatigues wii shields and helmets, and plainclothes martial arts squads.</p>
        <p>Police cadered the massive security after all three were attacked at rallies in recent weeks.</p>
        <p>National Police headquarters in Seoul said security was further increased after a death threat was re-'ceived against Kim Young-sam and Kim Dae-jung. Police said a man claiming to represent a radical group threatened to kill one of the two becaiK they refused to agree on a single can^date. Police said it may have been  crank call.</p>
        <p>PhM 8V^% Interest</p>
        <p>Forget about the stock market. This is what you get at Great Southern Finance on 12 Month Capital Notes. Your investment never goes down and you earn a top interest rate. Over 25 years financial service in North Carolina.</p>
        <p>Inquire</p>
        <p>GREAT SOUTHERN FINANCE</p>
        <p>202 Arlington Blvd.  Phone  355-7161</p>
        <p>BRASS BEDS</p>
        <p>AND DAY BEDS</p>
        <p>SOLID BRASS</p>
        <p> MADE IN USAlk</p>
        <p>FACTORY DIRECT-</p>
        <p>ORDER NOW FOR CHRISTMAS DELIVERY.</p>
        <p>DISCOUNT</p>
        <p>PRICES ON</p>
        <p>MATTRESSES</p>
        <p>WE TRADE</p>
        <p>KiMEiars</p>
        <p>FUWWlTUItE DEPOT =</p>
        <p>524 WmI 10th St.</p>
        <p>RaUfMdOspot</p>
        <p>rv.iirjr</p>
        <p>IDE</p>
        <p>S V\K . (,A\</p>
        <p>Our furniitjre from S'.otiand is m - over 300 piece'^ o'</p>
        <p>10 oo)r QncJ mohogarvy 'urn^ure plus items from a partial local estate o pe inoiuded ir- this sdie Previe'A Sc* No 2i fal' day) h Sun Nov 22 n 00 Sale Nov 22 100 pm</p>
        <p>Rni.tf' H Bn. 4V8  AIB'H Ro,n]  GrtiPnvillfi N' H31  ( i i)^S6-99V9</p>
        <p>The hardship has united Moslems and Christians. A labor union organized a nationwide strike in early November demanding action by the nations leaders to combat the crisis. It fizzled after five days with little achieved.</p>
        <p>The strike should have been aimed against all militias. Theyre responsible for our starvation, said Mahmoud Natour, a plumber.</p>
        <p>Moderate leaders blame the crisis on the governments inability to collect taxes and fees for public services.</p>
        <p>The warring C^stian and Moslem militias levy their own taxes in the territory they control and run illegal ports along Lebanons Mediterranean coastline.  ^</p>
        <p>Beiruts once chic stores once offer^ the best in electronics, the latest Paris fashions, and other goods. Now tihey sell second-hand electrical appliances^ cheap furniture and old clothes because few can afford anything else.</p>
        <p>An auto dealer, who spoke on condition of not being identified, said hes sold only three new Merc^-Benz cars this year  all to militia officials, about the only people who can afford such luxuries.</p>
        <p>Most well-off Lebanese have left, sitting out the disintegration of their homeland in the Unit^ States, Latin America and Western Europe.</p>
        <p>Ahmed Khanji, a mechanic, bought used boots for his five childrwi for the new school year that started in mid-October and said that with other expenses such as Ixxrfcs and clothes, Im in debt for the next year.</p>
        <p>But there are still occasional flashes of the old opulence that was prewar Beirut.</p>
        <p>A Shiite Moslem businessman who has lived in Nigeria for 30 years recently became the talk of the town for throwing an extravagent wedding for his son in west Beirut.</p>
        <p>He brought relatives and friends from Nigeria in two chartered Boeing 707s and rented the 300-room Summerland Hotel overlooking the</p>
        <p>Mediterranean to them for three days.</p>
        <p>accommodate</p>
        <p>Home Fashion Days</p>
        <p>Spectacular Savings!</p>
        <p>Draperies</p>
        <p>Top Treatments</p>
        <p>Bedspreods</p>
        <p>Mint ond Micro Blinds</p>
        <p>Balloon and Roman Shades</p>
        <p>ond more!</p>
        <p>&amp;amp;9o()McSliop</p>
        <p>RL3,Bra3lC.G&amp;lt;wmt nmw 796-2575</p>
        <p>NEW 14K GOLD</p>
        <p>Supply Satellite</p>
        <p>MOSCOW (AP) - The Soviet Union on Saturday launched a spacecraft to cariy supplies to its space station, Mir, where historys longest space mission is continuing.</p>
        <p>The Tass news agency said the Progress-33 capule was carrying perishable supplies.</p>
        <p>Cosmonaut Yuri Romanenko has been working aboard Mir since his arrival there two days after a Feb. 6 blastoff from Baikonur cosmodrome in Soviet Kazakhstan. He surpassed the space endurance record of 237 days on Sept. 30 and has now been in the cosmos for 289 days.</p>
        <p>Also woricing aboard the Mir station is cosmonaut Alexander Alexandrov. Alexandrov arrived in late July to replace Alexander Laveikin, who began the mission with Romanenko but later showed signs of heart trouble.</p>
        <p>The Mir complex was launched on Feb. 20,1986.</p>
        <p>CHAINS &amp;amp;  ^ gr^</p>
        <p>BRACELETS  I D</p>
        <p>Sold By Weight,   w a</p>
        <p>/away for CHRISTMAS</p>
        <p>SOUTHERN GUN &amp;amp; PAWN INC.</p>
        <p>PER</p>
        <p>GRAM</p>
        <p>Co^'oa'e)</p>
        <p>_ AY AWAY FOR CHRISTMAS</p>
        <p>500 North Greene St.. Greenville 752-2464</p>
        <p>Brookhaven S.D.A. School</p>
        <p>Florida Citrus</p>
        <p>Navel Oranges &amp;amp; Pink Seedless Grapcfroll</p>
        <p>Indian River  Tree-ripened  Freshly Picked  No Color Added. Will Arrive Dec. 17, Just in Time For Christmas!</p>
        <p>Call &amp;amp; Place Your Orders Now:</p>
        <p>758-2459</p>
        <p>355-2292</p>
        <p>756-1806</p>
        <p>756-0416</p>
        <p>Save Now On Wilton Bakeware</p>
        <p>//</p>
        <p>Let's Decorate</p>
        <p>//</p>
        <p>1988  Yearbook</p>
        <p>11x15 Sheet Pan</p>
        <p>9x13</p>
        <p>Sheet Pan</p>
        <p>$777</p>
        <p>$^66</p>
        <p>6 inch Round Pan</p>
        <p>$400</p>
        <p>8 inch Round Pan</p>
        <p>S437</p>
        <p>10 inch Round Pan</p>
        <p>$577</p>
        <p>12 inch Round Pan</p>
        <p>$Z88</p>
        <p>Football Shaped Pan V</p>
        <p>Partysaurus Pan JZ50</p>
        <p>aNB 6E6RTE</p>
        <p>SPECIAL CHRIST^S CAKES</p>
        <p>Jolly Santa Face</p>
        <p>Light Cocoa Candy melts /,</p>
        <p>JS*6</p>
        <p>Santa</p>
        <p>Stand</p>
        <p>Up</p>
        <p>$900</p>
        <p>Holiday</p>
        <p>Tree</p>
        <p>$777</p>
        <p>Certain Items Subject To Prior Sale</p>
        <p>NONf SOLO TO OEALERS</p>
        <p>IU</p>
        <p>WE RCSCRVE THE RIGHT TO LIMIT QUANTITIES</p>
        <p>607 Qreenvllle Blvd. (Next To Farm Fresh) Hours: 9:30-9:00 Mon.-Sat. 1:00-6:00 Sun.</p>
        <p>.-Vi</p>
        <pb facs="00096780_0020" />
        <p>Sunday Opinion</p>
        <p>The Daily Reflector</p>
        <p>Established 1882</p>
        <p>David Julian Whichard. Chairmm ct the Boad David J. WMchvd O. Edtor &amp;amp; Co-^PtOMm  John S. Whichard, Co-Pubitm</p>
        <p>D. Jordan Whichard 01. GeneretManeger  Alvin  B.  Taylor, Managing</p>
        <p>Mary C. Schulken, Editorial Page Editor</p>
        <p>Truth In Preference To Fiction*</p>
        <p>Buffers Essential To Protect Value</p>
        <p>The Greenville City Council should proceed with bufferyard ordinance revisions, not delay or amend the proposal.</p>
        <p>Bufferyarding is an important means of ensuring rapid growth does not damage the aesthetic or economic value of properties. Greenville is currently experiencing explosive growth. One harmful side effect of that growth is the fact that adjoining land uses are often incompatible ^ for example, a residential area may back right up to a commercial zone.</p>
        <p>This conflict often creates visual pollution and detracts from the integrity of both zoned land uses. It damages the appeal of a community and consequently can harm the value of the properties which conflict. Bufferyards are barriers which soften the transition from zone to zone and shield properties from incompatible elements.</p>
        <p>It makes good sense to place land or physical barriers such as fencing or I vegetation between in-congruent land uses. The revisions proposed are firm, reasonable requirements that can significantly protect property. The Council should not tamper with the proposal before it.</p>
        <p>Greenville needs a bufferyard ordinance  and a strong one  in place. It is easy to visualize places in the city where land uses conflict, diminishing the appeal of the area. With the dynamic growth occurring within the city limits, incompatible land uses are increasing. Without bufferyarding, the city has no way of easing this conflict and protecting the integrity of zoned land uses.</p>
        <p>A drive through a city which has experienced rapid growth without strict bufferyard requirements --such as sections of Raleigh, Fayetteville or Wilmington  is convincing of the need for these barriers. To put them in place before growth occurs is a progressive measure.</p>
        <p>The City Council should approve the bufferyard ordinance promptly and as proposed. Undue delay on the issue is not the approach to take. If fine-tuning is necessary, it can be accomplished as problems arise. BufferyarUng, however, is an effective tool for minimizing the impact of explosive growth. Greenville is in need of measures that encourage orderly growth.</p>
        <p>Revising bufferyard requirements is an issue with time value. If it is not done before growth occurs, the changes are useless and have little impact. The City Council should act as progressive opportunists and successfully seize this chance to provide Greenville with an implement for controlling growth.</p>
        <p>Stress Academics And Competition</p>
        <p>The future direction of East Carolina University intercollegiate athletics seldom fails to prompt speculation.</p>
        <p>With the resignation of Dr. O. Ken Karr as director of athletics, plenty of advice will be offered on where the ECU program should go.</p>
        <p>It should first be acknowledged that athletics has developed considerably under Karr. The school has a National Collegiate Athletics Association Division I-A program, the football program involves a schedule of national prominance and the basketball program, although struggling, has potential for respectability in a reasonably good conference.</p>
        <p>The athletic program is now in black ink, although some sacrifices were made to place it there and a successful fund raising program was needed to pull finances out of the red.</p>
        <p>The hiring of Art Baker as football coach three years ago was a signal that, while ECU was dedicated to playing a major schedule, emphasis would be placed on academic performance of athletes as well as winning.</p>
        <p>Going back even before the Karr era, intercollegiate athletic progress at ECU stacks up well. The football program has come from Carolinas Conference to Southern Conference and finally to independent status with the nation's top teams as opponents.</p>
        <p>Inevitably, a new era has begun for athletics at ECU. The university has a new chancellor in Dr. Richard Eakin and will soon name a new athletic director. It should be the university's goal to recruit athletes who are capable of completing their academic programs while here. That, too, is the philosophy of the University of North Carolina system.</p>
        <p>That has been done at other universities throughout the nation and it can be done at ECU. There is no reason to feel that the university cannot compete on its present level and still maintain its academic goals for student athletes.</p>
        <p>ft ftR)Loc V m</p>
        <p>Of \NNPCtNt ttoUP )WOOTV\</p>
        <p>over, wt '(ou mwK?</p>
        <p>Disi North Amef'ca Synoicaie inc '987</p>
        <p>Pride Goeth Before A Rubber Turkey</p>
        <p>Mary C. Schulken is guest columnist for Sunday Morning Notes this</p>
        <p>Nary C. Schulken-</p>
        <p>I am a good cook. Ill pit my marinara sauce with sea scallops, my smothered chicken and my laplander chocolate icing against the best.</p>
        <p>But 1 dont do turkey in my house on Thanksgiving.</p>
        <p>Its not because Im a vegetarian, Im flaunting the celebration of the Pilgrim ways or Im unpatriotic. It certainly doesnt mean Im not thankful. Its because of the year of the rubber turkey.</p>
        <p>The year of the rubber turkey is lodged painfully in my mind. My first turkey. Because of work, my husband and I were marooned away from family on a day when all our friends went home for the holiday. It seemed like a perfect time to start our own Thanksgiving tradition. My spouse of; fered to slave in the kitchen while I was slaving at the office but my female ego revolted at the idea. I should have ignored my ego. Pride goeth before a rubber turkey.</p>
        <p>Armed with explicit directions on turkey-roasting and cooking stuffing from my</p>
        <p>Sunday Noming Notes</p>
        <p>mother, the queen of holiday fowl preparation, I felt confident as I removed the bird from the freezer and stuffed him in the oven to cook. Yes, you read correctly. The bird went from the freezer to the fire.</p>
        <p>Now a turkey takes a while to roast, so several hours and hunger pangs later, I removed what appeared to be a juicy, golden brown bird from the oven. We sat down at the table, set with good china and silver and lit with tall holiday candles, and carved. About an inch in, the meat got hard and (ick!) blood ran out. Something was wrong. The oven must be slow, I suggested.</p>
        <p>Undaunted, we blew out the candles and stuffed the bird back in the cooker. We waited another two hours or so, relit the candles and tried again. By this time starvation had set in and the accompanying casseroles (which had been done for approximately three hours) were ragged-edged from raiding.</p>
        <p>When we cut into the bird, which by now was significantly crisper than before, very little progress was visible.</p>
        <p>Let me make the picture a little clearer. Here are two starved and completely isolated humans. One has a massive female ego in shreds and grim determination to save face. The other is a desperately hungry fellow ready for food at any cost.</p>
        <p>So we threw that bird in the microwave and nuked it for all it was worth. Cooked the heck out of it. We wanted to be sure it was done. Finally, we relit the drooping candles for the third time, sat done and dug in. The turkey was cooked alright, but it was ... well... chewy. The meat could have been cut in little bits, wrapped in paper and sold as Double Bubble  or better yet, jawbreaker candy. Rubbery is an understatement. The fowl would have lasted several rounds of one-on-one with Larry Bird.</p>
        <p>But factor in starvation.</p>
        <p>that crucial shattered ego and a six-hour wait, and youll understand how determined we were to eat the thing. We masticated two legs and some slices before our jaw muscles collapsed from exhaustion. The leftovers went to the cats, but I assure you they could have been shipped by the roughest luggage handlers to any world destination without damage.</p>
        <p>So I dont do turkey. IU eat hamburger, pizza, burritos or go hungry on Thanksgiving before I cook a turkey.  '</p>
        <p>This year? Moms coming up to cook the bird and were going to have a normal holi*^ day Thanksgiving feast. She will thaw the fowl before it goes in the oven, because shes wise. Ill just stand by, stroke my feminine pride and stir my laplander icing.:</p>
        <p>U.S. And Nicaragua: A Delicate Balance</p>
        <p>V. ' I</p>
        <p>At no time during this tragic turn of events (d any  |</p>
        <p>one mention thawing the  |</p>
        <p>turkey before cooking iL  |</p>
        <p>Since I had expert instructions from Mom, I didnt bother to read the label. So  i</p>
        <p>much for my four-year col;  </p>
        <p>lege education and the value ' | of a career in communica: tions.</p>
        <p>Wayne</p>
        <p>Smith</p>
        <p>Over the past two weeks President Ronald Reagan and President Daniel Ortega of Nicaragua have given an impressive display of knight and pawn. They have moved their pieces about the board seeking an advantage but have not significantly dianged their basic positions. That they feel compelled to move at all, however, is a tribute to the way in which the (Central American peace plan devised by Oeta Ricas President Oscar Arias Sanchez has altered the game. The two principal adversaries can no longer simply sit back glowering across the boaitl at one another.</p>
        <p>For his part, Ortega had long insisted that he would discuss nothing with the senior Contra leadership. Why talk to the clowns, he had asked, rather than to the owner of the circus, the United States?</p>
        <p>But once having accepted the Arias plan and the cease fire it called for, Ortega was caught up in its logic and momentum. How, after all, can one bring about a cease fire without discussing the details with the other side? And so, Ortm came around to say, yes, he would negotiate those matters and those matters only with the C^tra leadershipbut on an indirect basis, with Cardinal Miguel Ohandoy Bravo as the intermediary. Hardly a major shift, but endugh to ^Nicaragua in compliance with the Arias plan.</p>
        <p>Reagan responded in his speech to the Nov. 9 meeting of Organization of American States foreign ministers by announcing that if the Sandiniatas in fact got down to serious negotia-tions with the Contras, the United</p>
        <p>States would then be willing to enter into discussions with representatives of all the Central American governments, including Nicaraguas.</p>
        <p>At first blush, this seemed to offer something new. Sources in the State Department subsequently made it clear, however, that to be considered serious, the negotiations would have to address a broader agenda  i.e., some form of power sharing -and that while they might begin on an indirect basis, they would have to end up as direct talks between the San-dinistas and the Contras.</p>
        <p>In other words, there was nothing really new in the Reagan announcement. The United States has always said it would talk to the Sandinistas, but only after they have entered into direct neg(giations with the Contras. The Sanmnistas have just as consistently refused to do that. Predictably, they refused again.</p>
        <p>While all this posturing around the question of direct negotiations may have its comedic imdertooes, the issue is one of deadly serious proportions. As the Sandinistas understand, the Reagan administrations insistence ttiat thcor negotiate directly with the Contras Is a function of jto strati to rid of them. Should th^ accept the Contras as valid in-terfockers and sit down to discuss internal political arrangements with them, they would in effect extend them belligerent rights and at the same time undermine their own legitimacy - perhaps fatally so. Precisely because of that, the Arias plan does not call for such negotiations or otherwise contemmate power sharing. As a Costa Rican spokesman phrased it last week: ^t is not allowed. Under the ac</p>
        <p>cord, all governments are legitimate."</p>
        <p>Unf(Nrtunately, the Reagan administration hasnLyet acoe^ that logic. It is still trymg to maneuver the Sandinistas into committing suicide.</p>
        <p>In his own address to the OAS on Nov. 11, Ortega strove to place the (Hius squarely back cm the United States. His government, he said, would fully comply with the Arias plan provided the Reagan Administration immediately ceased its aggressive Contra war against Nicaragua. If it failed to do so, then Nicaragua would not be bound by the accord and might again resort to such measures as cloimig La Prensa, the principle opposition newspaper. The outcome was not entirely up to the United States. Ortega also scathingly criticized Reagan for not living up to earlier promises to negotiate (Urectly with Managua. M-though White House spokesmen quicUy denied that any such commitment had been ma&amp;lt;w, the fact is that the peace plan proposed by Reagan and Speaker of the House Jim Wright, D-Texas, last August did provide for direct talks between Washington and Managua.</p>
        <p>But after attacking Reagan so strongly, Ortega adopted a more conciliatory tone in reiterating his readiness to meet with the president</p>
        <p>is for the Sandinistas to accept them as equals.</p>
        <p>And so matters stand, hung up on the same old snag as always; We wont talk to Managua unless it first talks to the Contras. One can understand Ortegas refusal ~ if he accepts.</p>
        <p>he conce the game. The Reagan noredlf-</p>
        <p>administrations position is more i_ ficult to understand. If the United States has legitimate security concerns in Nicaragua, why should those concerns be negotiated between the</p>
        <p>Cmitras and the Sandinistas? Why</p>
        <p>s</p>
        <p>if that would help the cause of peace Not only that, but the president coul^</p>
        <p>can we not negotiate for ourselves: Indeed, one would think the administration would be demaiuting direct negotiations instead of offering them as some kind of door prize. After all, since the Contras obviously cant win militarily, direct negotiations with Managua is the only way to achieve U.S. objectives.</p>
        <p>But dont despair. The Reagan administrations position may as yet show some change. Reagan can no more escape the logic of the Arias plan than can Ortip. To be incompliance, the United States must terminate all aid to the Contras ~ even , if the Sandinistas stiU rriuse to talk to tto. And at that point, as the whole m^otten Contra policy col-must choose: either he addressM U.S. security concerns through direct negotiations with Managua, or he leaves those concerns unattended.</p>
        <p>invite Adolfo Calero and other Contra leaders to lit in on the meeting.</p>
        <p>Nothing doing, Assistant Secretary of State Elliott Abrams was quick to reply. Such a scenario, he sufflested, would cast the adnUnistratioos Contra clients in the role of junior partners. What the administration wants</p>
        <p>S. Smith, adjunct prol of Latin American i^uttiag at Johm Hopkins Schooi of Adm ta^tioaal Studies, is authoi The Closest of Enmkn,'* an count of U.S.-Cuban rtatiom s IS97.</p>
        <pb facs="00096780_0021" />
        <p>CommentairyReagan And Wright Differ Sharply On Role In Negotiation</p>
        <p>Jim Wright Has Mode A Mess Of ThingsSusan Purcell</p>
        <p>longstanding position that they would never negotiate with the Contras and agrei^ instad to indirect</p>
        <p>WASHINGTON - Until House Speaker Jim Wright D*Ttet., decided to play an active role in the cease-fre negotiatimis between the Sandinistt and the Contras, the Sandinistas had been on the defensive, which had forced them to make important con-</p>
        <p>Now, thanks to the behavior of the speaker, ^ focus of attmitiQD has shifted from the eonfliet innde Nicaragua to tihe conflict within the U.S. govom-mratm WSuH may weU I fte tojructhm ofihe C^tras^w ^nvtffmiining the Central Amencan peace plan ahd the eventual consolidation of the San-dinista dictatorship in Nicaragua.</p>
        <p>The  had made few omcessums as the</p>
        <p>al Nov; 5 deadline drew near.</p>
        <p>aiv WIUI UIC wiiuaa miv</p>
        <p>negotiations mediated by Cardinal Miguel Obando y</p>
        <p>Bravo.  ^  ^</p>
        <p>As the Reagan administration was too qmck to p(M^out, the Sandinistas willingness to negotiate even indirectiy with the Contras gave the rebels increased legitimacy as a belligerent fwee. Presiteit Daniel Ortega obviously agreied. He tried to undo the damage by immediately insisting again on bilateral negotiations with the U.S. government, so as to</p>
        <p>re^ve the old image of the Conhras as^ dependent leUrated States.</p>
        <p>haddbwedaSepivately ovraed i^spaper. La Prensa, to reopen and one radio station. Radio Cat^ca, tor resume broa^sting religious, but ncrt political, iniorniation. This is far from the wmplw freedom of the press and access to the media called forinOscarArlaspeace plan.</p>
        <p>The  bad also refused to enter mto</p>
        <p>direct nmaUons with the Contras to establish a cease-fiS In Contrast to Presidents Jose Napoleon Duarte of El Salvador and Vinicio Cerero of Guatemala, both of whom had met face to face with their countries respective armed guerrilla movements. .  ^  ^  j. *</p>
        <p>The Sandinistas intransigence had caused inter-</p>
        <p>nathal pvliUc to hp Wtast ttaJiore imiwrtaiil, it M Wreased tlw chaiices that the U.S.</p>
        <p>Reagan administrahuu iw lauuavu a..  .-</p>
        <p>0Sm. IhbwaasoiMithliigtheaBlh^</p>
        <p>to avoid at aU costa. The $100 milhon m U&amp;amp; aid that the Contras receiving in early m had allowed 12 000 Contras to operate with growing siKcess in Wthfrds of Nicaraguan territory and to sh^ down</p>
        <p>Soviet-suppUed helicopters with increasing frequency. The Sitras steppednip military activity tad :a^ caused the SaMfinistas to consume greater amounts of Soviet-supplied oil, obliging them to ask</p>
        <p>puppets of the Urua.</p>
        <p>The White House recognized the trap. It agre^ to bilateral talks, but only in a regional context and only after some progress toward a cease-fire agreement tad been made in indirect talks between the Sandinistas and the Contras.</p>
        <p>Having failed to achieve his goal with the Reagan administration, Ortega tried to enlist Wright to his cause. He succeeded. With the speakers help, the Nicaraguan president managed to cast himself as a man of peace, to eclipse the mediating role of Cardinal Obando y Bravo, to relocate the cease-fire negotiations from Nicaraguawhere they belot^ to Washington and to reinstate the United States as the key player in what tad until then been a Central American peace process.</p>
        <p>By undermining the Contras, the House speaker removes the only real incentive the Sandinistas have to negotiate a cease-fire that is a meaningful first step toward a democratic opening, and not a Contra siuTCnclcr</p>
        <p>Ortega's current proposal is the latter. It asks the rebels to disarm and to accept a vague amnesty mior to cease-fire negotiatiwis and on terms dictated by the Sandinistas. These provisions violate a key principle of the Central American peace plan: simultaneity, or the requirement that all the elements of the plan - including the establishment of democratic freedoms, the tend of cross-border support for rAel movements, the granting of amnesty</p>
        <p>pun. lur reuci uiuvcuiww, w  j</p>
        <p>ata the imptanentatkm of cease-fire agreements -go into effect a the same time.</p>
        <p>their Soviet patrons for more.</p>
        <p>This is what led the Sandinistas to reverse their</p>
        <p>Staao Kaufman Purcell b direetar of (he LaChi American Project at the Council on Foreign Relations.</p>
        <p>Peace Effort Backfired On AdministrationJohn (kMhko</p>
        <p>WASHINGTON - When President Reagan and House Speaker Jim Wright, D-Texas, marched into the White House |8s room last Aug. 5 to announce a joint Central American peace initiative, both radiated (mtimism that they were ending six years of Republican and Democratic squabbling and making a new, bipartisan start on resolving the tensions between Nicaragua ataitsnei^bors.</p>
        <p>But 3^ months later, in a week that began with Wright and the presidents most senior advisers engaged in an angry exchange of insults, the Reagan-Wright initiative threatened to turn into the Frankensteins monster of administrati(Hi finreign policy.</p>
        <p>In August, when the administration offered Wright a limited partnership on Central America, the move seemed to hold the promise of bringing in the speaker, with a dependable support base in the Democratic-controlled Congress, even though the administration planned to ask Cmgress for more aid to ttie Nicaraguan Contras.</p>
        <p>But two days later, the situation suddenly changed when the Reagan-Wri^t initiative had the unexpected effect of emboldening the presidents of Nicaragua, Costa Rica, Guatemala, Honduras and El Salvador to meet in Guatemala and sign a peace agreement.</p>
        <p>Wright became an instant and passionate partisan of the pact. However, the administration, for all its rhetoric, has been tom from the outset by doubts about whether the Guatemala agreement can effectively end the threat of subversion in the hemisphere. Some influen-tial administration officials and conservalive Republicans continue to believe that the only sure way to deal with Nicaragua and end its ties to Cuba and the Soviet Union is through the Reagan doctrines emphasis on iwarting communism through wars of national liberation.  .  ,  .</p>
        <p>That is what underlies the controversy of the past we. The administration now fears that Wright, instead of being content with the role of legislative junior partner, is tr^ to take control of U.S. poUcy and turn it fr-</p>
        <p>revernbty away frmn military sohitioos toward negotiated teWemento in the framework of the Guatemala</p>
        <p>Shultz appeared together on Capitol Hill to assure reporters that the latest quarrel had involved misimder-stan^ngs over tactics and had been patched up. But white they insisted that the speaker and the president remain united behind the goals enunciated last summer, there no longer is any doubt that the two view the Central American situation from different perspectives that almost inevitably will cause further clashes.</p>
        <p>These differences were evident in the dispute that erupted last week when Nicaraguan President Daniel Ortega came here with a new bid for talks with the ad-ministrati(Hi, which rebuffed him with the argument that Nicaraguas dvil war must be settled by Nicaraguans negotiating with Nicaraguans. Plainly, the administration wants to force Ortegas Marxist tandinista government to negotiate with the Contras, thereby acknowl^-ing tiie resistance movements legitimacy as a political force in Nicaraguan life.</p>
        <p>As a result, the administration was enraged when Wright moved on his own, ata in three days of highly publicized wheeling and dealing sought to wk out a plan for Nicaraguan Cardinal Miguel Obando y Bravo to act as intermediary in indirect negotiations between the Sandinistas and Contras on a cease-fire.</p>
        <p>To the administration, that was tantamount to Wri^t usurping the functions of the secretary &amp;lt;rf state and undercutting tiie administratimis poli^ of dowing Ortega a hi^-level dialogue with U.S. officials until the Sandinista leader first engages in serious talks with the Contras.</p>
        <p>Wright saw the situation differently. While agreeing that indirect talks between the Sandinistas and Contras are essential to progress in the peace process, he maintains there was almost no chance of enticii^ Obando into the mediators role withmit some high-level mcourage ment from the United States. He says that when the administration refused to recognize that fact, he felt com-lelled to accede to requests that he do what he could to lelp bring about negotiations between the contesting Nicaraguan factions.</p>
        <p>The potential for such differences apparently was not evidlent to either siite last summer w^ White House chief oi staff Howard H. Baker Jr., acting on a suffiestton from a former Texas Republican manner of Congress, chtaWrighttosee if they could find</p>
        <p>agraement.Ttasdiy,!</p>
        <p>Tom Loefflcr, approach</p>
        <p>a new basis for dealing with Ctral America in the wake</p>
        <p>.HM.y, a day after an acrinuoiow mee^ at tta White Hbuw, Wright and Secretary of State George P.</p>
        <p>of the damage to administration policy caioed by the Iran-Contra scandal.</p>
        <p>Back Off, NRA</p>
        <p>Jerry</p>
        <p>Vaa^n</p>
        <p>Readers of The Washington Post and ot^ large daily newspapers recently have been assaulted by full-page ads suggesting that they secure a handgun as the most effective means of self-d^ense. The ads de^ several different kinds of assattants  notably muggers and rapists - and ask, Should You Shoot A Rapist Before He Cuts Your Ihroat? or How Much Red Tape Is Too Much Red Tape When He HireatensThKUlYouf</p>
        <p> It should come as no surprise that these ads were naid for by the lead-</p>
        <p>police officers, are occasionally subject to this kind of violence, what sense does it make to encourage the public - who do not get the same level of training in firearms tandling ata usage  to get guns for self-defense purposes?</p>
        <p>Third, law oiforcement is not anti-gun. Police officers carry gun as a tool of the trade. Many of us are recreational shooters and hunters. We also, however, get a firsthand view of the carnage created by guns that get into the wrong hands and into the hands of the untrained.</p>
        <p>The whole truth, to twist an interesting and familiar theme, is that guns wont protect peq;)le, people protect people. Citizen are not Mpless against the rising crime</p>
        <p>ypokfaman explained: The ads message is, dont own a frearm if you dont want one, but dont let anyone deny yon the right to own one if you want.</p>
        <p>' That would seem to be stretching it a bit. The real message in this campaign, it would appear, is that the on-I ly way you are going to prevent yourself from victimization is by getting a tandem and keeping it at the ready.</p>
        <p>rate, and the firearm is not the only way the public can protect itself. For those who are looking for better protection I suggest the following:</p>
        <p>Instead of</p>
        <p>ona</p>
        <p>Leaving aside the many statistical inaccuracies and distortions presented in this alarming ad campaign, a i'lmmber of things need to be pomted out.</p>
        <p>ing your money ' your bed, install a phone there. Call the police if you hrar a strange noise that you think might be an intruder. By doing so, you decrease the chances of killing your spouse or child  something that happens all too frequently ^ if they move around and make noises unfamiliar to you in the night.</p>
        <p>Have adequate locks and other motective devices installed to keep mtnidersout.</p>
        <p>First, guns alone are not the 'crimefroofmg insurance the NRA pamiifligii suggests. The police, from ^ own experience in fcding wito .guns, crime, and criminals, know the liheer lunacy of the proposition. Guns t arent used quickly, easUy or without consequence.</p>
        <p>basic precautionar measures to avoid making</p>
        <p>- -.If</p>
        <p>vulnerable in the first place. Plan what you are going to do if theres trouhle. An ounce of prevention is worth a pound of cure.</p>
        <p>Tenuous Changes For China</p>
        <p>Andrew</p>
        <p>Nathan</p>
        <p>long as it shows positive results. When its benefits are perceived to have run out, we will see a revival of stronger state planning.</p>
        <p>For the technocrats, the issue in economics is no longer conservatism vs.</p>
        <p>r __:4________I.__41...  ...nr. rtalnn otnrliul Ratluir ilic ImMV III</p>
        <p> Ive workta with highly skilled and trained police officers who have fad-:led to use deadly force when it was</p>
        <p>more ttanlSSLf and appropriate.</p>
        <p>Organize your nei^borhood to be alert to activities that threaten your safety and security. Where such organizations already exist, join them and do your best to keep them active.</p>
        <p>^Pieopte tend to hesitate, even freeze up, in a life-threatening, traumatic tauatkm. When an attacker sees a</p>
        <p>y victim lift and aim a handgun, he is hardly goim to wait to see whether cttare ki any hesitation about using it -&amp;gt; he win most assuredly use his own 'weapon quickly. The police experi-jence is that the consequences of such ..confrontations are often more oSerloia than if the victim tad no .waapon.</p>
        <p>CaU your local police and ask for their guidance on crime reduction tips. Tliey can provide you with per</p>
        <p>sonal protection and effective rape ...... ample.</p>
        <p>  techniques, for exai .</p>
        <p>at would do much to protect you from crime.</p>
        <p>(Itaff is, by the way, often a jeveie emotional trauma associated ,,witbkiUii8oineoiie.Over70percent of aU police ofticors who kUl a person leave the force within five years .heorase of emotional difficiilties hasodatodwiththeeveiit.)</p>
        <p>Write to your elected leaders and demand that they spend the money for adequate police protection and to correct the flaws in our criminal ^tice system. Insist that public</p>
        <p>The 13th Conununist Party Congress marked a giant step in the process of Chinas takeover by technocrats.</p>
        <p>In the last few years, top leader Deng Xiaoping and his chosen sucesor, Zhao Ziyang, have forced extensive retirements in the bureaucracy. Millions of older officials have been replaced by younger cadres in both party and government offices.</p>
        <p>The old officials were educated on the battlefields of revolution or in the party undeiiFouta. The new breed largely have engineering and managerial backgrounds.</p>
        <p>The lower rungs of the bureaucratic ladder are crowded with smart young men (and some women) chosen at Dengs orders as the third echelon, marked for future promotion.  .  ,</p>
        <p>Tlta month tta second echelon readied the top. In a techncwratic takeover, an engineer, an economic planner and the former head of (Tiinas top scier^ and techndow university became three of the four new members of the in-ner-sanctum Politburo Standing Committee.</p>
        <p>The fourth, Giao Chi, comes from the party security apparatus. Zhao, the ecmimnic rdormer, rounds out membership in the top policy-making body.</p>
        <p>All the old revolutionaries in their 80s have stepped aside.</p>
        <p>Deng will continue to provide the guiding vision for reform as long as he re-</p>
        <p>____  mw_________vwioft  Knail  fJ  IliA  Pi</p>
        <p>reform, as it was when the reform was just getting started. Rather, it is how to adjust and readjust an eclectic mix of market and planning mechanisms to</p>
        <p>mains vigorous. Moreover, he retains the important post of head (rf the Central Military Commission, providing a guarantee of the annys loyalty to the</p>
        <p>aujusi ailU icoujuai an tvrcviiv 1UI.\ U1 uioinv, auu piuiuii.ie,  -----</p>
        <p>make the economy work best Inflation is not only an economic problem, but also one of tta two most serious political problems tta new Chinese leaders face. Tta other is corruption.</p>
        <p>Economic reform has created more winners than losers in Chinese so^y, but paradoxically almost everyone seems more dissatisfied ttan ever bdim with his or tar lot. Salaried factory and office workers complain that their income does not keep pace with inflation Individual entrepreneurs  peditai^ repairmen, owners of small shops and factories - worry about their lack of</p>
        <p>security and constant harassment by petty bureaucrats.</p>
        <p>Most peasants are better off than before, but millions stUl live bdow tta poverty line and see economic advance passing tliem by, while those ta w prospering dislike tta unaccustomed pressure of a sink-or-swim society and resent tta need to pay off village bureaucrats</p>
        <p>While it is imponible for an outsider to measure the extent of atlier um-tion or corruption, both are serious, and i*olh have become major political tests for tta regime.  ,  .</p>
        <p>In tta day of Mao Tse-tung, who died in 1976, citizens were forUdden to press their demands on the government on the grounds that everyone sliouM sacrifice fw toe common welfare. Today the technocrats acknowledge at a</p>
        <p>fact the divereity of interests in society  .  .  ,  ,</p>
        <p>of tta technocrats, then, becomes the key to several a</p>
        <p>vices</p>
        <p>rise of tta technocrats will change China in many ways. I once asked a member of tta third echelon how, if China is a socialist country, it could con-</p>
        <p>1*ll6 rise? wa Mxv icviiiiv'. IMutj  --  -   ^  </p>
        <p>paradoxes Alth^h open to the West, the reformis are not interestol in tta western model of democracy, which they consider a recipe for ctaw.</p>
        <p> Second, tta police experience also reflects tta fact that gunspiilled or just available during confUct often fall into tta wroiqi hands. Last year</p>
        <p>dtiaens everywhere must reject the notion that more guns in our society will make us safer and should tell those who make any such suggestion to back off. Tta people who are</p>
        <p>sider allowing tta sale of stocks,land-use rights and labor - all reforms in process or under consideration.  J..........</p>
        <p>CSHmil lUUUvl W1 UvlllWAMvj, J  it.   * A    t _</p>
        <p>Uninterested in ideology for their own policy inaking, ttay insist on drm^</p>
        <p>*' I have a simple logic, he told me. Socialism is bound to be good, and what is good is bound to be socialism. Our goals are a strong country, a wealthy people and an open society. Anything that helps us achieve these</p>
        <p>sharp ideological limits on public discussion as a way of maintaining</p>
        <p>*Sw;h is far freer in the inner councils of the party, where those doaei^ tta i^r makers can voice harsh crilicirns of the system without threateaing its existence.</p>
        <p>pumping out this crazy, dangerous advice mr public consumption and aburo - are not toe police, but the</p>
        <p>NRA</p>
        <p>first, and ttan we hand it philosophy research in-</p>
        <p>whea they ware dtautned and shot wftb ttalr awn weapon. Some n pe^ caot of an pottca offtcers who tase ttair weapon to an aaailaiit are liiot wtth ttair own weapon, ft those bait trainad In the uw of firearms, our</p>
        <p>goals is socia'lism.</p>
        <p>A young economist t&amp;lt;dd me, We make . public amsumptiwi -* and ovw to them  pmnting to hi cidleague from stitute - to explain why its socialism.</p>
        <p>Ideology, in short, no longer means much in economic policy-making, to tta lak few years Oitoeaa tare been going to Ainerica for ideas about how to enrktottNfreonoiny.Sconiefpelleyiiiakeretare visited and</p>
        <p>II I  rt mm nn Im immwlnwii ailarimarmttl </p>
        <p>Tta successes of reform will bring new issues and, if history is any giida new splits among the leadership. Political consensus at tta 13th Congnaa*-** real, but almost certainly temporary.</p>
        <p>Jerry Vaughn b executive rector of the tatmmUonal Assocbtian of ChiefsofPolice.</p>
        <p>tta beatyoui^economialitareitiidM In American intvarilUea.</p>
        <p>Tta (taiese seem to have more faith In tta virtues of ^ market mecha-</p>
        <p>The generational shift of power engineered by Deng was inevitable and la permanent. But his transfer of the highest power to Zliao Ziyang may jreH pi ove much more tenuous.  </p>
        <p>Ambew J. Nathan and author of Chinese</p>
        <p>is professor of political science at Columbia UnfmwRy if bemocracy,  University of California Prma.</p>
        <p>101110 wiu auwawv i apnu/ mmem mmvmm</p>
        <p>The trend toward expanaten at l nto af ftaaaftat wiU continue only so</p>
        <p>L.A.TIines-WaHhlnRlon 1'mI News Service</p>
        <p>*</p>
        <p>r-</p>
        <pb facs="00096780_0022" />
        <p>^ i s/' ' .</p>
        <p>Ttif  Hrtl^tor. drwnviii. N.c.</p>
        <p>OwanMly IMit ll*Mrvd - itoO.</p>
        <p>Non* SoM to Ooolors</p>
        <p>:\</p>
        <p>Sundy.NpwnbNf 22.1087  ;,    .  r..,.</p>
        <p>We Redeem AH Food &amp;amp; Drug</p>
        <p>i</p>
        <p>Store CouponSi. Turkey^.u"rh.?*^^</p>
        <p>USDA GRADE A FROZEN 4-7 \BS. AVG. WGT. CUDOY</p>
        <p>Turkey</p>
        <p>MB OUR raESH TURKEY AD IN THIt NEWSPAPER</p>
        <p>Ooiniwi UmHaUom an4 RmumiMiite AMrty.</p>
        <p>''  *' i-f'. -  ' '"i. ' i. 1 . s',.'!"!</p>
        <p>OPEN THANI^IVIliO     ^  1</p>
        <p>DAY REOULAR HOims    5gg^5S5g5?555^t=  </p>
        <p>^  "  8i8.tDe88ewteMi8iiE^&amp;gt;etiEiiRrti8tra48E*iewf*</p>
        <p>y jWrl&amp;gt;MlTyX.ri!5j&amp;gt;l!  HOI  1  tit*-</p>
        <p>U80AQOVTM8PECTa&amp;gt;' GRADE A FROZEN</p>
        <p>A n &amp;gt;!* i</p>
        <p>Lb.</p>
        <p>UTTY-HOAQO^</p>
        <p>TWIN FLAKE OR</p>
        <p>COMBO KROGER</p>
        <p>Browii *n Serv</p>
        <p>12</p>
        <p>Ct.</p>
        <p>Pkgt</p>
        <p>... . He</p>
        <p>KMIchoill Light</p>
        <p>1^020</p>
        <p>1 "  t-#  1</p>
        <p>MONEY</p>
        <p>ORDERS</p>
        <p>25c</p>
        <p>OPEN 24 HOURS EVERYDAY</p>
        <p>600 Greenville Bivd - Greenville 756-7031</p>
        <p>mMMMmmmmm</p>
        <p>t</p>
        <p>1</p>
        <pb facs="00096780_0023" />
        <p>THEDAILY</p>
        <p>REFLECTOR</p>
        <p>V</p>
        <p>QfMnvllM. N.C. Sunday, November 22,1967</p>
        <p>IU#i School Football Stodc Listings Business Notes</p>
        <p>B</p>
        <p>Pop 'Huskers, 17-7</p>
        <p>UNOOLN, Neb. (AP) - Anthony Stafford and Patrick</p>
        <p>veuiueeuwcuuuuiini-quarierruiiBW ouu oa vorua w</p>
        <p>seeondfanked Oklahoma renewed its claim to me No.^^ 1^ it lost last week to Nebraska by defeatii^ the Cor-: nhmken 17-7 Saturday and earning a fourth consecutive trto to tiie Orange Bowl.  ^ </p>
        <p>Ihe Soooers conduit an ll-O regular season and stretched the nations longest winning streak to 20 Wnes. Thej^ aU sevnn Big</p>
        <p>conference title in 45</p>
        <p>Hi2ahdSl6ig of the No. 1 E No. 2 teams in the history ofThe Associated Press college football poO failed to live up to all die pregame hype.</p>
        <p>triumph set up a posible national cham-M^ ig^ ttdid^nmked Miami, which ac-"Itoirt bid Satu^y. Miami, coached t^ assistant Jimmy Jdmsim, handed the SoQois their only two setbacks in their last 35 games, r Nebraska, H ends its regular season next Saturday at Colorado. The Cornhiiskers, who have dropped four m a roar and 35 of their last 46 meetings against Oklahoma, wiU play fourth-ranked Florida State in the Fiesta Collins, quarterback Charles Thompson and fullback</p>
        <p>Dei Anderson - the last two fillingin for injured regtt* Jamelle Holieway and LydellCarr, all rushed for e than 100 yards. R.D. Lashar kicked a 27-yaid field</p>
        <p>Rotnei Anderson-</p>
        <p>mare than 100 yards. R.D. Laiar kicked a 27-yaid field midway mrough the final period for the Sooners</p>
        <p>led 7*0 at halfthne as tailback Keith Jones ran 25 yards for a first-period touchdown, the only time the Conhuskers moved the ball significantly in the first</p>
        <p>Except for that 10-play, 84-yard scoring drive, the nations best defense shut down the top-rated offense. Nebraska managed only 14 yards on its other five first-half possessions.</p>
        <p>Despite trailing at halftime, Oklahoma dominated the first two periods. But Anderson, making his second start, ftimbled at the Nebraska 8-and 25-yardlines. In addition, Lashar inissed a 45-yard field goal and Thompson was intercepted at the Nebraska 7 late in the seoondperiod.</p>
        <p>&amp;gt; Wim a record Memorial Stadium crowd of 76,663  some 3,013 above the listed seating capacity and the Cor-nhuskers 155th consecutive sellout - waiting for the annual rally it has come to expect, Oklahoma got the break it neededon the third play Of the second half.</p>
        <p>A pass by Nebraskas Steve Taylor was deflected by</p>
        <p>comerback Derrick White and free safety Rick^ Dixon made the first of his two interceptions, returning it fimn the Nebraska 37 to the 13.</p>
        <p>Anderson gained two yards and the Sooners tied the score on the next play when Stafford took a pitchout around right end and tiptoed down the sideline. Lashar kicked the extra point.</p>
        <p>The Sooners again struck suddenly late in the period, this time going 80 yards in just five ^ys after a punt by John Kroeker, who was Nebraskas best weapon all</p>
        <p>Oklahoma controlled the ball for most of the final period. However, Collins fumbled at the Nebraska 4 with 2:49 left in the game only to have linebacker Dante Jones intei^ a Ta^ pass at the 19 on the next play.</p>
        <p>After i^flshar missed a 36-yard field goal attempt, Ndlnaska Arove from its 20 to the (Mdunna 21 before Taylors fourtlHlown pass fell incomplete as time expired.</p>
        <p>Nebraska teased the hometown orowd by scoring on its</p>
        <p>game.</p>
        <p>(hi third-and-5 frmn the 35, Ckdlins UxA Thompson: tchout around left end, cut back inside behind John</p>
        <p>ds block and broke clear at the 45 for an easy toudidown.</p>
        <p>Leading 14-7, it was unnecessary for Oklahoma to pull off one its patented fourttHpiarter rallies. For good measure, Dixon intercepted Taylor again at the Nebraska 45 on the first play of the final period and the Sooners wrapped it up on their next possession after Dixons seven-yard punt return to the Oklahoma 48.</p>
        <p>Anderson gained 28 yards to the Nebraska 20 on third-and-1 but fumbled, with teammate Stafford recovering. Four plays later, Lashar kicked his field goal.</p>
        <p>reverse that was supposed to be a fleaflicker pass and Jones 16-yard run on a draw play.</p>
        <p>Frmn the (hdahmna 25, Jones took a pitchout down the right sideline for a 7-0 lead at 13:32 of the opening period.</p>
        <p>Jones rushed five times for 58 yards on the scoring drive but gained only 36 m&amp;lt;Mre on 10 carries the rest of the game.</p>
        <p>(Hdalumia marched from its 20 to the Nelnraska 9 fd-lowing the (giening kickdf but Andorson cunmitted the first of the Sooners eight fumbles - they lost only three</p>
        <p>(See SOONERS, B^)</p>
        <p>InOT</p>
        <p>SPRINGFIELD, Mass. (AP) -WRk the perfbnmuiee of the young frontcourt of PeteC!hilcuit, Rick Fox and Scott Winiams, J.R. Reids name was ahqostforgiDttenr-almost. .TUr^kankedNorth Carolina, playing idtiiout R^ a preseason All-</p>
        <p>were suspended for the gameby Coach Dean Smith, beat top-ranked Syracuse 964)3 in overtime ^turday in theninth annual T^ Classic.</p>
        <p>- Chilcutt, a redsnirt freshman, ieored 14 points, grabbed 13 rebounds and bad a team-high four agdsts. as the Tar Heels rallied from a;i4ffljint deficit with 15;^ to play in</p>
        <p>-^TVenever^seen Pete play like that, Smith said. He rose to the occasion, as did all of our players. Our young players made many good big</p>
        <p>was as big as Chilcutts jnmpa* ffom the foul fine that bounced around the rim as the final buzzer sounded and then fell through to tie tie game at 854)5 and force me over-</p>
        <p>Jeff Lebo added 20 for the Tar Heels, while Fox, a freshman, had 15 and Williams, a sophomore, 14.</p>
        <p>Syracuse took an 894)5 lead early in the overtime but the Tar Heels tied the game on two free throws by Smim and a layup by (Mcutt. ^racuses last lead came on a short jumper by Stephen Thompson that made it 91-89, but North (Carolina scored the next five points, the last two free throws by Lebo with 21 sec-ondstoplay.</p>
        <p>I fdt like it was straight on target, jint a httle hard, Chilcutt said of the shot that tied the game, tit was a hickyshot.</p>
        <p>Luck was absent from the Syracuse bench for the second straight game as the Orangemen lost to North Carolina aftor^nng to Indiana by one point in last yeos NCAA champiomdiip game.</p>
        <p>Defensively t^ caused us a lot of problems,'^ ^racuse Coach Jim Boeheimsaid. There was no wiy to g it into Rony (Seikaly) in the sec-ondhalf.</p>
        <p>Ranno Smith scored 21 points and</p>
        <p>Syracuse fireshman Blatt Roe made two free throws but they were offset by a dunk by Fox with four seconds left.</p>
        <p>Yeah, Roe was supposed to miss the second free throw, Boeheim said. But he is such a good shooter he cant miss.</p>
        <p>Kevin Madden, who was supposed to start instead of Fox but was three minutes late for the team bus and was ben^ by Smith, added 12 points.</p>
        <p>Seikaly led Syracuse with 23 points, one more than Sherman Douglas.</p>
        <p>They had two, three people aitiund me in the second halL S^-ly sa^ *1 wanted the ball but the guards said there were two and three guys behind me. I couldnt see them and you ha ve to trust your guards. </p>
        <p>^cuse dominated the first half, taking a 50^ lead at intermission, and extenM the lead to 5945 before the Tar Heels began their comeback.</p>
        <p>We were do^ 14 points and we knew we had to work on that, Chilcutt said. Anybody can work on cutting down turnovers and getting back on defense and thats what did it for us.</p>
        <p>Pete gave us the key game with his rebmmdiiig without J.R. put there, Fox said.</p>
        <p>Williams scored seven straight points for the Tar Heels as they cut a 59-45 ddScit to 63-52. North Carolina scored seven straight points from there, the last five by Smith.</p>
        <p>North Carolina pulled within 80-79 with 3:27 to play on a layup by Smith, the only semor on the team.</p>
        <p>A nee throw by Douglas gave Syracuse an 81-79 tead with 3:12 to play.</p>
        <p>A layup by Madden brought North (Carolina into the first tie of the second half and the Tar Heels took the lead on a driving layup by Williams.</p>
        <p>Syracuse tied the game with 11 seconds left on two free throws by Seikaly, and two more free throws I9 Derrick Coleman  who stole the inbounds pass after the second free throw - gave Syracuse an 854)3 lead.</p>
        <p>SYRACUSE</p>
        <p>MP FG</p>
        <p>Coleman</p>
        <p>FT R A F PI</p>
        <p>nxMnpsoa</p>
        <p>Duncan</p>
        <p>Dnlas</p>
        <p>Roe</p>
        <p>41 S-7 4-613 2 2 14 33 6-11 1- 2 4 1 4 13 9-12 VIO</p>
        <p>Harriei</p>
        <p>isar</p>
        <p>39</p>
        <p>27 2-6 2-4 42 9-19 3-4 U 3-4 2-2 10 0-2 O-O 8 l-.l 1-2</p>
        <p>7 1 423 3 3 4 6 2 S 122</p>
        <p>IMI</p>
        <p>0 0 0 3</p>
        <p>imc</p>
        <p>Chilcutt P ,</p>
        <p>,  13  , 0-2 1- 2 2 . 0 2 1</p>
        <p>209 3S44 1M2 39 13 22 93 MP FG FT R A F PI 40 6-8 2-213 4 4 14</p>
        <p>Lebo SmiUi Rke May Madden Totals.</p>
        <p>28</p>
        <p>32</p>
        <p>43</p>
        <p>30</p>
        <p>7-8 1-3 5-9 4-7</p>
        <p>1 315 1 5 14 1 20 321 2 0 0 0 3 12</p>
        <p>7 3</p>
        <p>6-14 4-4 1 8-16 5-5 2 19 0-2 0-0 2 2 0-0 0-0 1 31 4-8 3-5 2 200  3665  19-26 33 15 21 96</p>
        <p>Smxmt............................50 35 8  93</p>
        <p>N.Caraltaui______ ________________J9 46 li  98</p>
        <p>Thre^poiittaoato---Syracuse 4-12: Duncan 06. Dou^ 1-4, Roe 36. Hughes 01. North Carofina 5-13: Fox Ol. Lebo 4-7, Smith 03. RiceOl. Madden 1-1.</p>
        <p>Turnovers  Syracuse 16, North Candna 16.</p>
        <p>Technical fouls-None.</p>
        <p>OfficialsNichols, Forte, Higgins.</p>
        <p>A-0.128.</p>
        <p>Cavs Down State, Earn Bowl Berth</p>
        <p>Stop, Thief!</p>
        <p>Syracuse guard Stephen Thompson, left, reaches in to steal the baU from North Carolina guard Ranxino Smith (33), during first period action in the Tip-Off Classic Saturday. UNC won in overtime, 96-93. (AP Laserphoto)</p>
        <p>I V</p>
        <p>By TOM FOREMAN Jr.</p>
        <p>AP Sports Writer RALEIGH (AP) - G&amp;lt;^ Welsh said he would have been happy to take a 6-5 Virginia football team to a bowl game. North Cardina State nearly obliged him.</p>
        <p>It took the third of Keith McMeans three interceptions to help the Cavaliers secure a 34-31 Atlantic Coast Conferoice foothall victory and ensure their berth in the Dec. 22 All-American Bowl in Birmingham, Ala., against Brigham Young.</p>
        <p>Its better to go out a winner, win the last four, get the seven wins, second in the conference. Its just better, Welsh said. I would have been happy to go at 66, though. What the heD,abowrsabowl.</p>
        <p>Scott Secutes passed for 269 yi^ and two touchdowns as Viigima withstood a strong N.C. State nly for its victoiy. The Cavaliers reportedly wiD nee Brigham Yauog at Legion FtekL The Wolfpack was marching ior the potential wtoteiM toudiaowp behind Shane Montgomery, who passed for 408 yarn and three touchdowns on 30 of 54 passes. But on first-and-lO from the Vugima 17, his pass for Charles Daveopiwt was intercepted in the end sne by McMeans with 3:58 tefl.</p>
        <p>We mi^ not win without it, right? WM said. I thoiht tt was a neat play by him.</p>
        <p>Even then, Welsh mi^ have been a Uttte startled. When he and his team went to the locker room to accept the invitation from Bob Femell, the ACC representative from the AU-AmoicanBowl.</p>
        <p> ... We cordially and proudly in-</p>
        <p>(SeeVmGIMA,B-2)Duk Sails Past Carolina</p>
        <p>CHAPEL HILL (AP) - After a by knocking Tar Heel quarterback pasadominated first half, Duke took BlarkMayea</p>
        <p>  __  :  Maye  out  of  the  game.</p>
        <p>Sevdnd out of Noii Carolinas sato  Du^ quarterback Steve Slayden</p>
        <p>went on to pass for 278 yards and two touchdowns, rushing for a third, as Duke took a 25-10 victory over North Carolina in Atlantic Coast Conference football Saturday. But Andy Andreasiks sack of Maye in the third quarter, forcing a fumte and reinwring Mayes knee, tamed the Tar</p>
        <p>yard touchdown pass to Hines put the Bhie Devils up 15-10 when a twoiiointStappi^gOuf  ^</p>
        <p>&amp;gt;lorth CiroUna'i Eric S^rr (85) mk to step away from Dpke idefcwder Randy BlUy durliig Sat^y% ACC gamo pf Kenan Stadium In ChapctHttl. &amp;lt; A^serpholo)</p>
        <p>caught N( very good time, said Duke coach Steve Spurrier. Theyve had a lot of troubles and injuries. Our players were really hitting hard out the to-day.</p>
        <p>Slayden, who hit 23 of 36 pass at-tempo, tied a Dulre record with 20 touchdowns in a season and Clarkston Hines, who caught both touchdown passes, set a Duke receiv-in^ni^ Duke improved to 56,2-5</p>
        <p>Maire. who had 216 yards before leaving, set a Tar Heel record for passing yardage in a season as North SniSifeUto5and3-4.</p>
        <p>Spurrier said Slayden continued to imam. </p>
        <p>lie has Droved what be has proven an year long; that he is a good paann  SpunW De has really tearoed how to play quarterback ^last couple of weeks.</p>
        <p>North Carolina coach Dick Crum, who tried to end recent speculation about his future by saying be would remain as head coach, said Mayes injury was a problem, putting reserve quarterback Dan Walkowiak into action after throwing only eight passes anyear.</p>
        <p>Mark te the leader of the offense and that eertainly hurt us, Crum said. 1 thou^ we got a groat effort out of Dan.Ite got us to the 5 one time.... But, of couree, he hasnt had the experience with it that Mark has had.</p>
        <p>Duke. traUli m at balftima.</p>
        <p>conversion attempt failed.</p>
        <p>North Carolina got possession at the SO and got a first down before Maye suffered his fumble and injury. Dukes Doug Peterson then hit a 55-yard, wind-assisted field goal to make it 18-10 with 9:33 left in the third quarter.</p>
        <p>On the next Tar Heel series, Walkowiak threw three incompte-tions and North Carolina punted.</p>
        <p>Howard Feggins intercepted a Slayden pass in the end 2one to end the next Duke series and the Tar Heels drove to the Duke 45 before North Carolina punter Kenny Miners pass off a fake punt fell harmlessly in the end xone.</p>
        <p>Opming the fourth quarter, Duke</p>
        <p>mandied 69 yards, including a 33-rdMtol8iie8,to</p>
        <p>yard pasd from Slayden to! set up Slaydms 1-yard touchdown dive and take a 25-10 lead with 9:52 left.</p>
        <p>The Tar Heels managed to move from their own 42 to the Duke 5 as</p>
        <p>Walkowiak passed for four straight . but his three consecu^</p>
        <p>first downs, I incomptetiona, the last on fourth down, gave Diike the baU and ended the last North Carolina threat.</p>
        <p>Hines, who caught passes for 122 yards, set the Duke and ACC record for receiviog yards in a season at 1,093, breakhig Wes Chessons 1970 mark of l,060.^yden tied the Duke record of 20 passing touchdowns in a season set by Ben Bennett in 1982. Duke also set a school record for passing yards in a season with 3,406, bluing the 1982 mark of 3,349.</p>
        <p>Mayefinisbed the season with 1,965 yaitis passing and 1,914 yards of total offense to better Tar Heel marks of 1,786 yards passing and 1,782 yards of olienaeartfiy Kevin AhtMiyIn 1964.badilttoo.Petenon1ie[aDuke</p>
        <p>(SmDUKK,B4)</p>
        <p>Post-Game Talk</p>
        <p>Leaves Questions</p>
        <p>CHAPEL HILL (AP) - North Carolina football coach Dick CTOm, trying to end weeks of speculation that he mi^t resign, announced Saturday he would remain with the Tar Heels.</p>
        <p>But some players remained unconvinced after an emotional lockerroom talk, saying it seemed Crum, the wiimingest football coach in North Clarolina history, had coached his last game for the Tar Heels.</p>
        <p>Crum, in his lOth year at North Carolina and with four years remaining in his contract, said media attention and criticism had made it difficult to prepare for</p>
        <p>Saturdays game against Duke, liiii25</p>
        <p>which ended m a 25-10 loss.</p>
        <p>1am a little bit surprised that we play^ as wdl as we did because it was awfiiUy difficult for them ((riayero) evm to |vac-tice, he said in a news con-fernice.</p>
        <p>But Crum emphasixed that he planned to servC out his contract, adding, When or if anything changes in that, you guys will be the first to know, but until that time Im not even going to talk about it</p>
        <p>Carlton Bail^, a senior noseguard, said (5rum gave an emotional talk to players that left doubts whether he would reinain.</p>
        <p>I realfy do believe that he has coached ms last game, he said. Tlngs dont look too good.</p>
        <p>He reaUy didnt say much about it untu after the game. It was a very emotional sceie. He was pretty much in tears; just like the rest of the guys. said he</p>
        <p>loved us ail and whatever the outcome will be, he would be behind</p>
        <p>us.</p>
        <p>Bailey said he doubted Crum would quit Its not going to be Coach Chun leaving us, be said. He loves us too much to do that. It could be somebody else buying his contract out.</p>
        <p>(hntin Smith, a senior wide receiver, also appeared unsure of C^s future.</p>
        <p>We really wanted Coach Crum to go out a winner, he said. Hes always been a winner to us.</p>
        <p>Smith said most players were waiting to see what happens.</p>
        <p>I guess thats up to the gov-body, or whoever deddes</p>
        <p>erning body, or whoever decides that Theyve gota lot of power. Junior Ran^ Marriott said, I</p>
        <p>think its silly. Its very unsettt-^ ing. ... Ive never been through anything like this before.</p>
        <p>With the Duke loss, Crums coaching record feU to 72-41-3 at North Carofina and 106-51-4 in his</p>
        <p>career.</p>
        <p>Speciilation began on Tuesday, when The News and Observer of RaMgh reported that Crum would not return to North Carolina in 1988. On Rnirsday, UNC Athletic Director John Swofford issued a statement saying the school would not fire Oum and that it would aUow tostey for the remainder of his contract if he chose.</p>
        <p>There have been reports that a deal had been struck in which Crums contract would be boi#t out, a deal that reportedly went sour when reports of Crums res-ignation leaked into newspapers.</p>
        <pb facs="00096780_0024" />
        <p>.H*2 ThDllvRW*otor.Qrnvtlte.N.C.  8undwf.Newinbf lii.11W</p>
        <p>iC^ge Scores</p>
        <p>S3,W.CarUu CmUnilO loreheulStO</p>
        <p>^V^ordS</p>
        <p>S.ColBaSt.lS iSt.</p>
        <p>wS^WebbS6,W&amp;lt;^</p>
        <p>ni30,S.Cvolii -i&amp;amp;UviiWrton eSa^tawSiU 17,1taDeMeeTeeh IS</p>
        <p>asf&amp;amp;asggr</p>
        <p>U</p>
        <p>l^ertGc-KentuckyS MarylandM ,.CnroUiHiSL 4S.N.CwoliMAItT17</p>
        <p>Ky. 17</p>
        <p> ^ .aranmCol.O</p>
        <p>lGMl.0^.MicMfaDl7</p>
        <p>rr-jJ</p>
        <p> :i,Bdia.is</p>
        <p>Jforrii, SW lOoMsoU M</p>
        <p>ohk&amp;gt;SLa,r^---</p>
        <p>AbUcMChriftiuin.W.TexasSt 17 Gml Aifcaam n, H^s</p>
        <p>--  -  -  Bot.StjOUa.</p>
        <p>OaKMtalS,Hen</p>
        <p>OentsnJkla.a .^J,IoiraS.27 M,IleiMenaiiSt.7</p>
        <p>LltewOviitianM</p>
        <p>'iNn/WEi5w</p>
        <p>FAR WEST</p>
        <p>SlMSt IL Soaona SL tt IViMStll. New MadcoSt 10 nfiDBf-----</p>
        <p>bSL 41. Montan</p>
        <p>BaMwin-WMbee  N.C.-amn*era O.</p>
        <p>%.C. WeaieyaB  OktoM.  or</p>
        <p>FwBftSSSftwte</p>
        <p>U.</p>
        <p>-**sSg^</p>
        <p>CknawkMk</p>
        <p>AlfrK7I.YoyPgCT .</p>
        <p>WHnirfcwliaMnal</p>
        <p>WmiCk^SSmShArn</p>
        <p>i Georgia Southern quarterback Ray-Imood^</p>
        <p> I Groas ran for two touchdowns</p>
        <p>and teanunate Tim Foley kicked t ttree fidd goals to lead the Eagles to</p>
        <p>a SO-IS victory over South Carolina State in college football Saturday. Georgia Southern, 84 and ranked</p>
        <p>Mat hattime after Foley kicked goals of 17,37 and 29 vardi. In the Em quarter, the Eagles built their hMd to 234 with TD runs of 16 yards lodl yard by Gross.</p>
        <p>^Tfler Gross</p>
        <p>Virginia..</p>
        <p>\</p>
        <p>(QmtioaedFrmB'l)</p>
        <p>vite a fine, a great Virginia team to cmne to Birmingham, Alabama,</p>
        <p>point is very ^disappointing, Sheridan said.*As a team and as individuals, we never gave up. We fotfhtbackandworkedhatd.^ Montgooiery hap passed for 870 yards in his final two games after last weeks school record WBfard performance ina victory over Me.</p>
        <p>HHftfd hi lUiiHi jmnhqi itf.</p>
        <p>fort of more than 200 yards and is thM on the schools a04ime passing</p>
        <p>December 22nd to play at</p>
        <p>lal Hall of</p>
        <p>Field for the llth annual Fame Bowl, said Fennell, who almost immediately recognised his mistake.</p>
        <p>*AI1-American Bowl! Gol-leel he</p>
        <p>jwriainifld</p>
        <p>Hk Cavaliers, 7-4 and 8-2 in the ACC, converted three of four WoRjpack turnovers in the the first 16 minutes into a 264 lead. Durwin Greggs scored on a 1-yard dive after an interception, Mmrk Inderlied kicked a SS^yard fidd goal following a fiimble, Secules completed a 10-yard touchdown pass to John Ford and Ford raced 44 yards on a reverse after a fumble on a Wolfpack kikcoff return.</p>
        <p>**They did a lot of bad things in the first quarter, Welsh said, adding 244isnotagoodleadthesedays.</p>
        <p>With a noihhuddle offense, the Wolfpack came back on Montgomerys 20-yard touchdown pass to Bobtv Ham midway through the second quarter. Hie same attack producen Montgomerys 15-yard touchdown pass to ToM Fisher with 3:41 left before halftime.</p>
        <p>Pla:</p>
        <p>factor of 14 degrees, Montgomerys first iiossattempt was intercepted by Mditeans at the WoUjpack 37, and that led to Greggs [runat9:(l8.McMeanscaiHAt Montgomery pass at Ee 43, but Virgiiite ooiildBt convert that turnover.</p>
        <p>Mai Crite ftunbled, linebacker PhU Thomas recovered and Virginia turned that into Inderlled*s 35-yard field goal with 3:25 left.</p>
        <p>,.M MM i-M ..J U 7 7-41</p>
        <p>Bryan Carter added a 23-yard field goal 17 seconds before half tune to get N.C. State within24-17.</p>
        <p>virstafai.....</p>
        <p>N.KraM8l..</p>
        <p>UVA-GicggB 1 nn dnderlMkkk) UVA-roindBrtiedSS UVA-Ford 10 pa fNm Secules (In-derUedkkk)</p>
        <p>UVA-FordMna (Indeflledkkk) NCS-HsrreU paw from Moo tgoinery (Carter Uck)</p>
        <p>NC3-iher IS pass from Mootgoineiy (Garterkick)</p>
        <p>NCS-FGCarterS</p>
        <p>UVA-nakeMon 14 pan from Secules</p>
        <p>(Inderlledkkk)</p>
        <p>{Inderlied S7</p>
        <p>Rnd* An Opmhig</p>
        <p>Vbtiiiia tailback Mhcw waM (a) DM an opening as he gets away from N.C. State de-</p>
        <p>cant answer right now why we start so slow.</p>
        <p>Secules passed to Tim Finkelston on a 14-yard scoring play with 10:18 left in the third period, and a Kevin Cook interception led to IndeiBeds</p>
        <p>UVA-F61 NCS-flarreD 8 pan from Moalaomery (Ckrterkick)</p>
        <p>NCS-Crtunpler 1 run (Carter Uck) A-3S,a00.</p>
        <p>First</p>
        <p>yards</p>
        <p>fender Ray Agnew () during Saturdays ACC gaiae In Raleigh. &amp;lt;AP LaserplMto)</p>
        <p>27-yard field goal with 5:25 remaining in the third period to put Virginia in command 3417.</p>
        <p>Paaskn RetonVardi</p>
        <p>Cony-Att-lnt</p>
        <p>UVA NC8 8 8 8S-1S4 a-is</p>
        <p>Wake Forest, Greene Make Tech Regret Throwing Deep</p>
        <p>The Wolfpack converted two Virgtoia turnovers into touchdowns. A SMules fumble led to Montgomerys second toodidown pass to wurell, an 8-yard play late In the thM period that cut the deficit to 34 24. Chris Johnsons interception and 40-yard return to the VirgM 19 wt up Bobby Crtunplers 1-]UM scoring ran with ll:19Mtoplav.</p>
        <p>The WoMck mined a chance to</p>
        <p>hYaidi Thneeirwemloo</p>
        <p>14  </p>
        <p>841-1 S0444 MS Ml M 44</p>
        <p>8:M  :</p>
        <p>INDIVIDUAL STATISTICS RUSHlNG-ViMkda, WOaoq, M. 8-44,</p>
        <p>Gieni 1M7. N. (SieHte</p>
        <p>PASSING-^</p>
        <p>N.CMM8t.</p>
        <p>-VlifhHa. Serulee aMt-1-81. .......... JtlluliBinenr3M44401</p>
        <p>RBCBmm-Viiili^FI^^ Ford 48. N. CarolimiSr, M. Jooee 71. Cordenl-lse,HarieD78</p>
        <p>ATLANTA (AP) - Geonia fsch h^ throwing deep and A. XGnsm kept makiiM the YcOow Jhdteli Rpetit (keene intercejM km pnm, returning one 37 yards fir a</p>
        <p>leda defease that produced tatereeptlQns and a ftunble re-</p>
        <p>retuming one 37 yards tonehdown, as Walm IM Tech 334D an Atfaugie Omt Gm-ferencefootbani *Ton dream aboM</p>
        <p>"Dmth iwrtn, I thoiht we</p>
        <p>help the Deacons control the ball and Mark Youiq; rushed for 88yardion22 carries.</p>
        <p>tie when Bryan Carters 49-yard field goal attempt earfy in the fourth quarter was wide left.</p>
        <p>WakeFwuat------------------SMW 7-8</p>
        <p>% E E</p>
        <p>qnarterwaswidel N.C.Stateendedtheyearat47and 44.</p>
        <p>*lhe season frtun a record etand-</p>
        <p>MQQANSMKIffAK</p>
        <p>DOWNTOWN OREmVlUa opiNwiurftM</p>
        <p>MMWytaabtMA</p>
        <p>iAOiiialUMrH^</p>
        <p>*thi ml ahiy was that we bad ^he added. On the</p>
        <p>thii, Greene saM IlMy l8|l frU( thrartnfi it deep..Jod dm mtei mmi gMadefenshebadttteAhmk Ufes</p>
        <p>glvesi onthebalL</p>
        <p>Wahe Forest tin semd m a Uocked mnt. a yard laten by</p>
        <p>Uocked ni^ a yard lal &amp;lt;nr delma</p>
        <p>Aa.--lA Aa-----A--AV  </p>
        <p>MnpiHHii IIWOMI \ UKyiwKfMm</p>
        <p>tlilmhmktogduwn. Vto actually prftoctfd the quarterback  wifl. dai. who pf** for 208 mis, aeeied the ether Wake Forest imhdawi oa a l-yard run and ImMaddedMdf 3laod</p>
        <p>WF-F6Hogrla8 WF-FGHoyle8 WF-BfclMl ran (Hoyiekick) WF-F6Hoyla8 WF-FOHo^ST ^-MoalaylUocked pant return (Hoyle</p>
        <p>WF-Qrwne SI tatercoptioB return</p>
        <p>(Hgtekick)</p>
        <p>GT-Oaveni</p>
        <p>I added field goals of 24,</p>
        <p>oar delme dU a tiemendoiB Joth Wahe Owh Bffl Dooley aakL A. J. Gnm and the</p>
        <p>WOmHwleaddet MLWaodWyaidi. Rwaathefiflhloninarowfor</p>
        <p>r-Oavenport tt puss (ram Ramplqr (pmsftdWi T-a,ll4.</p>
        <p>Tech, wfakhfefl to 2-8 going into next</p>
        <p>rat M the seomi dkhft ahw fliemtomovetheb iDwlfliaByea</p>
        <p>waeki season finale against Gasqia. The Jackets fiihed 44 in</p>
        <p>First downe RuriMs-yards PMSilM RrturoVa</p>
        <p>ReturnVardB</p>
        <p>i-Att-Int</p>
        <p>The Deacon defense was so</p>
        <p>*T thoqght ov football team wodd ha raady to phqr, ted I Ihoq^ it waoU be a don ime, Dooky added. I dnl have anr Idea tted our fieotfaaD taom weuUptay n wcD at it dU.</p>
        <p>Ihe Demon Deacons, keeping alive their hopes for aDii an In-</p>
        <p>-R----J * -      -  AR. -e_</p>
        <p>QBpWBHm IWwl IM, CM0Q uKu</p>
        <p>regular 8ea8Qoat7-4,44inlhe ACC.</p>
        <p>domhuitiiig that Tech did not penetratele Wake 40 ontU the final</p>
        <p>FUmMm-Lott POMltiet-Yardi Time of Possession</p>
        <p>WF GT 17  11</p>
        <p>171 107 SOI 144 S4 7 144S-7 8-8  84S</p>
        <p>1-1  S-1</p>
        <p>I04S S- 8:04  8:8</p>
        <p>InrnSntes of the game when the Jachela drove 51 yards to avoid a</p>
        <p>taihddnal Leaden Rushing-Wake Forest. Young S^8. Rfrolo^ McGUlSAGeortfalteli, A. nnmas 108, Hills 7-8.</p>
        <p>Techs touchdown came on a 15-yard pm from Todd Rampley to Seva Meoport with S:im in the</p>
        <p>ganm</p>
        <p>EDdne completed 20 of 35 posses to</p>
        <p>Passii^Wake Forest, Elkins SIMSO-SOe. ^jl^aTteh, Gast 4-S1-4-8, Rampley 10-</p>
        <p>Rocdvii^Wake Forest, Proehl 78. PhilHps Young 38. Georgia Tech, Watson 38. Davenport MS. ScoUon:</p>
        <p>I Ml.</p>
        <p>tiim for giving thanks</p>
        <p>For the privilege of living and working in this communi-ty...For wonderful friends and neighbors...For serving your insurance needs. May you all enjoy a safe and happy Holiday.</p>
        <p>Polly D. Piland</p>
        <p>300 Ariington Btvd.</p>
        <p>ParNamenl Plaot Qroanvllle, N.C.</p>
        <p>750-8886</p>
        <p>Uto I (DOd MitNr, 3Mi Fm b iM</p>
        <p>STATE FAM MSWWCE COMMMES HomtOttk:</p>
        <p>Duke $ails...</p>
        <p>I Go. Southam...........30</p>
        <p>;$. Gsrolina St..........13</p>
        <p>I ORANGEBURG. S.C. (AP) -</p>
        <p>(QntinuedFtmBi)</p>
        <p>record for field goals made and attempted inaseason, hitting 15 of 21 Roger Boone fiiiished with 118</p>
        <p>yards nishing for Duke, which had rdsoffense to 347 for North</p>
        <p>After an offshks call and a kkkoff out of bounds, Peterson kicked off from the 25 and the Tar Heels used a return to take over at the 146.</p>
        <p>TRE88BWIGEGEIIITR</p>
        <p>Services performed while you wait Highway 264 ByPaes &amp;amp; Hooker Road 758-2841</p>
        <p>Nm Mom: Monqr#ltmv S AJS. to S SJL SMwUnSAJLIbSSA</p>
        <p>420 yards Garohna.</p>
        <p>On North</p>
        <p>Carolinas</p>
        <p>MayeUtDaiyl I and found Eric Starr for</p>
        <p>nnainiiMf</p>
        <p>s</p>
        <p>N.</p>
        <p>.J  f 7-8 .4 7  e-M</p>
        <p>8 to key a 74yard march cap-lffller^8 3.......</p>
        <p>No. 4 in the NCAA Division I-AA, led ml field</p>
        <p>34yard field goal at  14:47 mark.</p>
        <p>Duke responded with a Uflay.</p>
        <p>UUR responded with a Ufiay. 70-yard drive and Petersons 19-yard fieid goal made it 34 at the 4:33</p>
        <p>UNC-PGMUierS4 DU-FGPlanoo8 DU-BhM 8 pam from Slayden (kick toikd)</p>
        <p>UNC-Oora I nm (Ifiller kkk)</p>
        <p>DUHtaM SI pass from Slayden (run failed)</p>
        <p>DU-FGPetersoo</p>
        <p>DU--8kwiden 1 nm (Petersookick) A-4MOO.</p>
        <p>touchdown</p>
        <p>^wtth 10:32 remaining, quarterback Tyrone Gilmore re| M&amp;lt;dBaDdo&amp;lt;</p>
        <p> _  PiilMftg</p>
        <p>titem ^''aSr</p>
        <p>tlwoscoring drives.</p>
        <p>Gilmore scored on a 2-yard I loadtidown run with 5:22 left in the</p>
        <p>mark.</p>
        <p>In the second quarter, the Tar Heeb engineered a 14|ilay, 77-yard drive only to give up me bafi when Torin Dorn was dropm for a loei on ayatSel</p>
        <p>First down kyank</p>
        <p>ssr</p>
        <p>ards</p>
        <p>Att-Int</p>
        <p>) Duke 19.</p>
        <p>afourtlMuid-playi On the enoung aeries, an apparent IS nullified^ a</p>
        <p>Funbl^Lost</p>
        <p>Pnalties-Yards</p>
        <p>TtmeofPosaesrtQa</p>
        <p>DU UNC '  8  21</p>
        <p>8-142 40-70 ITS 277 18  8</p>
        <p>2347-2 2242-1 38  38</p>
        <p>1-1  M</p>
        <p>78  88</p>
        <p>8:8 8:8</p>
        <p>t third quarter, and the score was 234 after icsti</p>
        <p>States twofoint conver-</p>
        <p>interception was nuUiftedT by roughing-theiiasser caU to set up Slayden Y 30-yard touchdown pan to Hines. Peterson missed the extra poiiitaDdDiikeled94with7:081eftiD Eehalf.</p>
        <p>INDIVIDUAL STATISTICS RUSHING-Duks. Boone 8-118. Monk S-8. N. (kroiina, Starr 11-51, Lewis PASSING-Duke, Slayden 238-2-278. N. CMoUna. Maye 15-22^5.</p>
        <p>RECElVn^Duke, Hines 5-122, Green 551N. OuoUne, DoraVn, Parham448.</p>
        <p>YES</p>
        <p>ITG</p>
        <p>ITQ TRAVEL CENTER HAS SPECIALLY PRICED SKI PACKAGES THIS WINTER WITH ALL MAJOR AIRUNES. BOOK YOUR PACKAGE WITH ITQ BEFORE DECEMBER 15 AND SAVE $25.00 PER COUPLE. FOR DETAILS CALL</p>
        <p>^ II ^</p>
        <p>355-5075</p>
        <p>THE PLAZA GREENVILLE</p>
        <p>i</p>
        <p>1</p>
        <p>HIUMm</p>
        <p>n.TMMTE</p>
        <p>ANRI</p>
        <p>AUSEASm</p>
        <p>STEanaTa</p>
        <p>RIUMl</p>
        <p>31</p>
        <p>00</p>
        <p>P1S550R13</p>
        <p>1 Sin 1</p>
        <p>SS.OO</p>
        <p>VM</p>
        <p>30.00</p>
        <p>dtW</p>
        <p>P19S-79II14</p>
        <p>4S.(</p>
        <p>P205-7SR14</p>
        <p>45.00</p>
        <p>P21S-75RI4</p>
        <p>4a.oo</p>
        <p>P20S-75R15</p>
        <p>40.00</p>
        <p>CrTOiiilMMTFTM</p>
        <p>49^</p>
        <p>owiiieaLowpMcii4.M</p>
        <p>DISC BRAKE</p>
        <p>MMnENwa</p>
        <p>HKMMOimi</p>
        <p>CMUITERr</p>
        <p>SPECIAL</p>
        <p>Replace front diso peda Raeurfaee rotors Repack bearings Metallic pads extra</p>
        <p>imiMstlon inciudM Surtle q|M you bat IMM raOMiHt ol ntuMHwr AmlcaiigM to til moMAmsrtobnamtimiltUGM</p>
        <p>54</p>
        <p>nsasr</p>
        <p>! ***ni</p>
        <p>LUBEfOIUFILTER aPfCIAL</p>
        <p>mptoee an  to I qto. PmmhS</p>
        <p>lowia iniMi sn&amp;gt;^ atigto ttm mm.</p>
        <p>(Untmt wtw</p>
        <p>14</p>
        <p>T</p>
        <pb facs="00096780_0025" />
        <p>Southern Cal Wins Rose Bid</p>
        <p>\</p>
        <p>LOS ANGELES (AP) - Rodnqr Peete threw a pair of fourtlH]uarter touchdown passes Saturday as underdog Southern Cal raUied to beat crosstown rival UCLA 1743 and earn a berth in the Rose Bowl against Big Ten champion Michigan State on NewYearsDay.</p>
        <p>Both the Trojans, 3-3, and the fifth-ranked Bruins finished with 74 Pacific-10 Conference records, but Southern Cal earned the Rose Bowl bid by virtue of its win over UCLA. nThe Bruins finished the regular season 9-2 aftej^^r^ their e^</p>
        <p>Supls^onda in the aKS^BowI at Hoooinfu on Christnias Day.</p>
        <p>The win. before a sellout crowd of 92,516 at the Los Angeles Coliseum, was the eighth in a row for Southern Cal in games between the Tr^ans and Bruins in which the Rose Bowl berth was at stake for both schools.</p>
        <p>College Bowls</p>
        <p>By The AsBodated PreM lui Timet E8T 8atarday.Dee.l2 CiBfoniaBowl AtFreio.Callf.</p>
        <p>0-20, VS. San Jose State, 10-1-0,4 p.m.</p>
        <p>Satoda&amp;gt;Dec.lt iBdepeadenceBowl AtSkrevtport,La Tulane, 6-4, vs. Tteas or TSxas A&amp;amp;M w ^ Baylor r Texas Tedi ot Washington, 8 p.m.</p>
        <p>Tttedhiy,Dee.22</p>
        <p>AU-AmerlcanBowl</p>
        <p>AtBirmlngham.Ala.</p>
        <p>- Virginia,7-4,vs. Undecided,8p.m. Friday. Dec. 25 SuBowl At El Paso, Texas ; Oklahoma sute, 0-24), vs. Minnesota, 6-.l:SOpjiL</p>
        <p>&amp;gt; AlahaBmri AIHmMs FlorkU, 40, vs. UCLA. 9-24). 3:4Sp.m.</p>
        <p>^  Thesday,Dec.29</p>
        <p>Liberty Bewi AtMemmds, Tean.</p>
        <p>Arkansas, 7-3. vs. Oeoigia, 7-34), 8 p.m. Wednesday. Dec. 30 Freedom Bowl At Anaheim. Calif.</p>
        <p>' Air Fffce, 8-34), vs. Arizoia sute, 6-44), Sp.m.</p>
        <p>Holiday Bowl AtSanDi^o Wyoming, 9-24), vs. Iowa, 8-34), 8 p.m. Thnrsday,Dec.3l Gator Bowl At Jacksonville, FU.</p>
        <p>South Carolina. 7-24), vs. Alabama r ^ Aubnm, 2:30p.m.)</p>
        <p>  BlnebonnetBowl</p>
        <p>:  AtHonston</p>
        <p>1, PittsbuNh, 7^, vs. Texas or Texas '^'AltM or Bayksr or Texas Tech, 9 p.m. Olixlou)</p>
        <p>Friday. Jan. 1 Florida Cttros Bowl</p>
        <p>The last time that happened was jans moved to the UC^ 5 with 14 Asurara m  seconds toplay in the half.  m^.</p>
        <p>run by Johnson keyed the</p>
        <p>Both use touchdowns followed in-teroeptioDS, only the fourth and fifth thrown this vear by UCLA quarterback Trqy Aikman, who turned 21 Saturday.</p>
        <p>Peete^s first touchdown pass was a 6-yarder to Randy Tanner with 14:09 remaining and the second was a 33-iT to Erik Affholter with 7:59</p>
        <p>Peete finished with 23 in 35 attempte for 304</p>
        <p>Peete was deflected into Marcus Patton</p>
        <p>3 completions 1 yanu whUe the game as</p>
        <p>Aikman, who entered the game the most efficient passer in me country. was only 11 of 26 for 171 yards ana three interceptions, matching his total for the Bruins first 10 games.</p>
        <p>Affholter had nine catches for 151 yards. Eight of his receptions came in the second half.</p>
        <p>After having a touchdown called back by a penalty and losing another on a goal-line fiimble in the second</p>
        <p>rter, the Trojans trailed 13^ be-beginning their coineback in the third period.</p>
        <p>First, they moved 61 yards in nine plays to get in position for a 26-yard held goal from Quin Rodriguez mid-w^ tnrou^ the quarter.</p>
        <p>Then, after Cleveland Colters interception, the Trojans drove 76 yards in 12 plays to make it 13-10.</p>
        <p>Finally, they went 58 yards in six plays following an interception by Man Carrier.</p>
        <p>Neither team threatened after the Peete-to-Affholter touchdown pass. Affholter juggled the ball before gaining possession just before going out of me end zone.</p>
        <p>Carriers second interception with 56 seconds remaining deep in UCLA territoiy clhiched the vicb^.</p>
        <p>The Ttojans lead the series between the schools 3MH1. UCLA had won five of the previous seven</p>
        <p>gatnptt</p>
        <p>The Bruins took a 7-0 lead by driving 72 yards on 11 plan the second time tb^ had the ball, with Gaston Green srring on a 6-yaird run. Green gained 53 yards on eight carries during the dnve and finished with 138 yaids on 30 carries. On the scoring play. Green tried to go around the 1 side but ran into traffic, revers-</p>
        <p>r^t!</p>
        <p>edhis</p>
        <p>At Orlando. Fla.</p>
        <p>ClemSMi, 9-141, vs. Penn SUU, 8-34), noon (ABC)</p>
        <p>32-yard field goal with4: hatftimetomakeitlO-O.</p>
        <p>FiesUBowl AtTSmpe, Aril.</p>
        <p>lU. 9-14), t</p>
        <p>Florida SUU, 9-14), vs. Nebraska, 9-1-0, 3:30 p.m., (NB(j)</p>
        <p>Cotton Bowl AtDaHas</p>
        <p>Notre Dame. 904). vs. Southwest Coo-ferenceChampion, 1:30 p.m. (CBS) -&amp;gt;;,'HsioBaw|.3e At Pasadena, CaUf.</p>
        <p>MichUan St. 7-M. vs. Southern Cal, 5 p.nL(NBC)</p>
        <p>Orange Bond AtMUmi</p>
        <p>Oklahoma, 11-04). vs. MUmi, Fla., 904), 8p.m. (NBC)</p>
        <p>SngarBowl At New Orleans</p>
        <p>Syracuse, 1900, vs. SouUwastem Conference CSuunpion, 8 p.m. (ABC)</p>
        <p>Jan. 2 Peach Bowl AtAUanU</p>
        <p>Tennessee. 92-1, vs. IndUna, 930, 2 p.m.</p>
        <p>HaU of Fame Bowl AtTamna. Fla.</p>
        <p>Michigan, 7-3, vs. Alabama or Auburn or Louisiana SUte (one &amp;lt;rf the teams that does not win Southeastern C(ference), 1 p.m. (NBC)</p>
        <p>This field and outran the pursuit as he breezed into the left corner of the mdzone.</p>
        <p>UCLAs Alfredo Velasco kicked a :53 left before I. That was the only score in the second (piarter, but both teams had several opportunities.</p>
        <p>A little over two minutes into the period, a delay of game penalty nullified a 34-yard touchdown pass from Peete to Ken Henry shortly after a holding penalty wiped out a 21-yard pass from Peete to John Jackson.</p>
        <p>Midway through the period, Aikman torew a 15-yard scoring pass to Mike Farr that was disaUowed because of a holding penalty. Velasco kicked his field g(ial a couple of minutes later.</p>
        <p>Southern Cal then moved to the UCLA ^yard line on a 44-yard pass from Peete to Tanner. After three running^ plays put the ball inside the 1, Ryan Knight, on his first carry of the game, fumbled as he appeared to be crossing the goal line ana UCLAs MarcusTivner recovered at the 2.</p>
        <p>After the Bruins punted, the Tro-</p>
        <p>A pass Iw Peete wa theairbylinebackw,</p>
        <p>at the goal line and Enc Turner pick-</p>
        <p>ed tt oH and tea**,</p>
        <p>Soutbera Cal end (rf the field. But Peete ran him down after an 89-yard retornas the half eiKted.</p>
        <p>Hie Bruins made it 13-0 less than three minutes into the third qu^r on a 38-yard field goal by vel^o shortly after an 18-yard punt by Southern Cals Chris Sperle.</p>
        <p>Smithern Cal played most ( me game without its leading nisher, tailback Steven Webster, w^ suffered a sprained left knee on ^fmd</p>
        <p>play of flie first quarter and didn t return. Webster wound up with 34 yards on eight carries.</p>
        <p>Pnn State..............21</p>
        <p>Notre Dame (7)........20</p>
        <p>STATE COLLEGE, Pa. (AP) -Blair Thomas rushed 35 times for 214 yards, scmred (me touchdown and set im two as unranked Penn State upset No. 7 Notre Dame Saturday 21-20 aifter the Irish missed a two-point conversion attempt with 31 semi left.</p>
        <p>With Notre Dame trailing 21-14, quarterback Tony Rice, who scored twice, led a 12-play, 62-yard drive, cabled by Anthony Jidinsons 1-yard dive into the end zone, putting the Irish behind by one p()int. But Rice was dropped as he tried an option play run for a two-point conversion.</p>
        <p>After the game, Penn State accepted an invitation to play Clemson in the Citrus Bowl at (jrlando, Fla., on New Years Day. Notre Dame accepted an invitation to the Cotton Bowl, where it will face the Southwest Conference champion.</p>
        <p>Hxxnas provided the miMnentum for Penn States ISflay, 76-yard fourth period game-winmng march that hxik 7:17. He carried six times for 32 yards, setting up a 3-yard run by John Greene for the touchdown.</p>
        <p>The victory completed Penn States regular season at 8-3. The loss drcmped Notre Dame to 8-2, aiding its nve-game winning streak.</p>
        <p>Brown, who came into the game second in the nation in all-purpose yardage with 182.2 yards per game, was bield in check by a Penn State defense that had its four starting linebackers for the first time this</p>
        <p>Brown carried four times for minus 9 yprds, caught four passes for 80 yards; and returned one punt for 7 yara.</p>
        <p>Penn State Coach Joe Paterno, in an effort to limit Browns punt and kickoff return yardage, kicked on third down in the first pmod, catching the Irish by surprire. Notre Dame was unable to get its return team on the field and the kick was ftimbled. Penn State recovered, teading to its first touchdown.</p>
        <p>The victory, in the nationally tdevised game, was Uk sixth ai the last seven in the series for Penn State.</p>
        <p>The lioM have not lost to the Irish at home since the inaugural game in 1913.</p>
        <p>Itioinas, who was held to 87 yar^ last week in a loss to Pitt, turned in his seventh lOD-yard game, ex-ceediihi8 career one-game hi^ of</p>
        <p>was the first Pom State beck to rush for 200 or more yards in a game rince Curt Warna gsumed 256 inl961agaii^ Syracuse.</p>
        <p>Michigan St. (11)......30</p>
        <p>Wisconsin.............  9</p>
        <p>BIADISON, Wis. (AP) - Lorenzo White rushed for two touchdowns and John Langdoh kicked three field</p>
        <p>goals Saturday as llth-ranked Ificlugan State neat Wisconsin 399 and completed an unbeaten Big Ten Conference season.</p>
        <p>The Rose Bowl-bound Spartans finished 8-M, including 7-0-1 in the Big Ten. Wisconsin, endiog its first football season under Coach D()n M(t(m, was 3-8 and 1-7 in the Big Ten.</p>
        <p>White 8C(ved on runs ci 23 yards and 1 yard and Langeloh kicked all his field goals in the second-qua^r as the Spartans took a 23-9 halftime lead on a windy, chilly day at Camp Randall Stadium.</p>
        <p>Blake Ezor, who alternated at tailback with White throughout the first half, ran for a 9-yard touchdown with 1:02 to go in the third quarter, competing the scoring.</p>
        <p>Wnite, who carried 56 times f(Nr 292 yards in a victory over Indiana last week, did not iday after the first series of the seconcf half and finished with 92 yards (19 carries. Ez(h* carried 28 times for 148 yards.</p>
        <p>Michigan State went 59 yards on its first possession, with White going 23 yards for the touchdown. The drives tHg [day was a 26-yard third-down jg^^m Bobby McAllister to Andre</p>
        <p>Wisconsin came back on the next series and scored with the help of a 39-yard kickoff return by Fred (jwens and a 28-yard pass from Tony Lowery to David Buiks. Leon Hunt ran five yards for the touchdown, but John Budde blocked Todd Gregoires extra xnnt, leaving the score 7-6.</p>
        <p>Whites 1-yard leap, set up by carries of 14 and 11 yard by Ezor, made it 146 early in the second quarter.</p>
        <p>connected from 18,31 and the last c(Hnins on the final</p>
        <p>Michigaii</p>
        <p>ekbkxfS</p>
        <p>162yan</p>
        <p>Lngek</p>
        <p>y of the half after ites Matt^ Vanderbedi a punt by Scott Cepicky with five se^</p>
        <p>Wisconsins other points came ^ Gregoires 38-yard field goal in tlf sec^(iuarter.  \</p>
        <p>White finished the season with 1,40 yards (m 322 carries.</p>
        <p>McAllister completed his fir t eifd^t passes ami finished 10 of 12 fi 211 yards. Rison had six catches fi 162 yards, including receptions of ifO and 23 yards, setting lobs first two field goals, j</p>
        <p>Wisccmsin rushed for 103 yards in 42 attempts against the Sparti^ who have the nations leadini defoise against the rush. Michigab State had allowed only an average (f 57 yards rushing per game prior tp Saturday.  \</p>
        <p>The Badgers Marvin Artley, whb needed 113 yards for a 1,000-) season, gained 68 on 14 carries.</p>
        <p>Michigan State had 463 yards i offense to 192 for the Badgers.</p>
        <p>,ww</p>
        <p>t-yard</p>
        <p>itotel</p>
        <p>The crowd of 45,385 at 76, was the smallest for a Wi home game since 1969 when the Baclgers drew only 42,624 against D-linois.  !</p>
        <p>it 146 early 1 Langeloh ( 41 yards, tlM</p>
        <p>Crimettoppers</p>
        <p>If yon have informatkm on any  crime committed in Pitt County, \ call Crimestoppers, 758-7777. * You do not have to identify; yourself and can be paid for the informatkm you supply.</p>
        <p>ditions. The the wind chill</p>
        <p>were 25 mph and factor at mmus 1</p>
        <p>degree.</p>
        <p>Penn State took advantage of a fumbled punt by Brandy Wells, wbich the Nittany Lioiis recovered at the Irish 19. Thomas gained 9 and John Greene ran it over from the 10 for a 7-0 Lions lead with 8:49 left in the first quarter.</p>
        <p>But Nim Dame took the kickoff to its 38 and tied the score in three plays. Tim Brown ran fcH* 24, Mark Green picked up 1 and Rice went 32 yards for the touchdown.</p>
        <p>Penn State capitalized on two breaks on a nine-play, 33-yard drive to go ahead 14-7 early in the second quarter. First, the Irish were guilty of interferring with a fair catch on a punt, then were called for pass interference in the end zone, putting the ball at their 2.</p>
        <p>Tbomas scored from the 1.</p>
        <p>Notre Dame tied the score 14-14 in the third period after Andre Jones recovered a Penn State fumble at the Irish 23. Rice led an eight-play, 77-yard drive, running the last 11 yards.</p>
        <p>\967Kmart-Co(p(xaon</p>
        <p>Americas Favorite</p>
        <p>CM mis-</p>
        <p>JfA</p>
        <p>cMtoconlar</p>
        <p>RELIABLE AUTO PARTS AND SERVICE AT K MART</p>
        <p>HwwKlwlMaiUI*Only&amp;gt;iWuiOpMMIrSam-ApmiaoMdkm.</p>
        <p>wOwOBiiwHiXlBwwiiyWwi* noyawavNotMnlabtelnMSioiM</p>
        <p>1 SOE</p>
        <p>PIKI</p>
        <p>1 numn</p>
        <p>H-97</p>
        <p>1 PI75/INI3</p>
        <p>30.97</p>
        <p>N nKimi</p>
        <p>37.97</p>
        <p>^JE</p>
        <p>E PHS/75D4</p>
        <p>39.97</p>
        <p>i fmim</p>
        <p>43.971</p>
        <p>I P20S/7SIH</p>
        <p>45.97</p>
        <p>niS/7SRI4</p>
        <p>44.97</p>
        <p>47.97</p>
        <p>1 niS/7SR1S</p>
        <p>4t.97</p>
        <p>' P225/75tIS</p>
        <p>51.97</p>
        <p>n3S/7SIIS</p>
        <p>53.97</p>
        <p>foaed wrwiu ouonidi^s</p>
        <p>Steel Belled Radial Tires</p>
        <p>40.000~mile ViAsrranty*</p>
        <p>97</p>
        <p>bsinqsiq</p>
        <p>steel Betted Radial Tires</p>
        <p>45,000-mile Warranty'</p>
        <p>97</p>
        <p>P155/80R13</p>
        <p>Mounting Included - No Trade-in Required</p>
        <p>- ......-.....-.-1.-.-...</p>
        <p>P175/70R13</p>
        <p>Low-proflle rodiols with performance "block-tread  design for minimum rood hum and groove wander.</p>
        <p>ix</p>
        <p>mMIGO</p>
        <p>steel Betted Radial Tires</p>
        <p>40,000-mile Wananty*</p>
        <p>40^</p>
        <p>P205/75R14   RWX</p>
        <p>Rugged rodiols for It. trucks. Feature all-season, all-su-face tread design for excellent ride and durability.</p>
        <p>Road Hazard Warranty Available</p>
        <p>11.97</p>
        <p>K mart Oil, lube and flNer special for</p>
        <p>many cars and light trucks. Valuel</p>
        <p>AddWonol pofti. MtvtcMoiewM</p>
        <p>QUALITY MOTORVATOR BATTERIES</p>
        <p>Motorvolor SO battery for</p>
        <p>many cars and light trucks</p>
        <p>WHhe*ehanae 50-moolMlmlted wononf</p>
        <p>wononty deloih</p>
        <p>54.97</p>
        <p>Motorvotor van/tmck battery</p>
        <p>for many vans and light trucks.</p>
        <p>VWheMChono# 60-moolhltmttedwaronN dele</p>
        <p>Stottters And Alternators k Available</p>
        <p>nelconenM</p>
        <p>HmeilDMllVICON8XtKMOtlnMOV.23THRUAT,H&amp;lt;Wt28</p>
        <p>Greenville Square Shopping Center  Call 756-5953</p>
        <pb facs="00096780_0026" />
        <p>The Daily Reflector, Greenville. N.C. Sunday, November22,1987</p>
        <p>Vandy Slips Past</p>
        <p>NASHVILLE, Tenn. (AP) -Quarterback Eric Jones figured Maryland w(Hild try to nullify his runing talents, so the Vanderbilt junior took to the airways Saturday to lead the Commodores to a 34-24</p>
        <p> the last two games Td had, I knew Maryland would take me out of the option and they did, said Jones, who countered Uie Terrapins by (xnnideting 16 of 25 passes for 225 yarra, including a pair of touchdown passes to flatter Carl Parker.</p>
        <p>J(es, who rushed for more than 100 yards against both Rutgers and</p>
        <p>Kentucky in the past two we^, also found time to run for 51 yartb mi 10 carries, but left most of the running to tailback Everett Crawford, who gained a career-high 125 yards on 21 carries.</p>
        <p>Vanderbilt Coach Watson Brown pointed to his defense, which created five Maryland turnovers, as the true key to the win that pushed his team to 44 for the season.</p>
        <p>T thought we hit them very hard and knocked the ball lose. The turnovers created by our defense are what saved the game, Brown said.</p>
        <p>I dont remember our defense</p>
        <p>this many (big plays) with the ball being moved on them so much. Its the first time since Ive been here that the defense has been able to keep their poise (in that situation), Brawn said.</p>
        <p>Maryland Coach Joe Krivak said the loss only mirrored his Terps 4-7</p>
        <p>Vandy improved iqiMi its balftime edge quickly, taking the second-half U^ofi and mardiing 80 yards with</p>
        <p>Its been a long season. This is the same result weve already seenwe make mistakes and we miss opportunities. The scenario did not change. It was no different from the past 10 games, Krivak said.</p>
        <p>The Jones-to-PaitMT cMnbination struck again Mght seconds into the fourth quarter with a 15-)* idav ^t boostMl the mto a 31-14 lead.Ohio Stato..............23Michigon...............20</p>
        <p>ANN ARBOR, Mich. (AP) - Matt Frantz, a goat a year ago, kicked a 26-yard fidd goal with 5:18 remaining Satimday, lifting (Miio State to a 23-20 Big ten Conference victory over errM-iffone Michigan that SMit fired Coach Earle Bruce out a winner.</p>
        <p>Bruce, who was told Monday it would be his last game mi the Buckeyes sideline, finished with an 81-26-1 record in nine years at Ohio State, 5-4 against ahe hated Wolverines.</p>
        <p>Ohio State, which rallied from a 134 deficit, has said it would decline a bowl bid, if offered. The Buckeyes finished the season &amp;amp;4-1 overall, 4-4 in the conference.</p>
        <p>Michigan, which could have clinched a tie for second in the Big Ten with a win, finished 74,5-3 in the conference. The Wolverines were expected to accept a bid to the Hall of Fame Bowl Jan. 2 at Tampa, Fla.</p>
        <p>Last year, Frantz missed a 45-yard field goal with 1:03 left as Michigan beat Ohio State 26-24.</p>
        <p>The Wolverines turned the baU over fMir times, three on fumbles and once on an interception, and the Buckeyes convertea two of the mistakes into scores.</p>
        <p>With the score tied 20-20, Ohio State Tom Tupa drove the</p>
        <p>Jones scoring on a 6-yard run for a 17-7 Commodore lead.</p>
        <p>With 5:57 left in the quarter, Vandy fullback Mark Johnson pushed the Commodore edge to 24-7 with a 3-yard scoring run.</p>
        <p>Parkers 15-yard touchdown reception came three minutes after Maryland had pulled within 24-14 on a 30-yard p^ from Dan Henning to Vernon Joines.</p>
        <p>Henning and Joines connected for a 12-yard scoring play with 13:12 left in the game to move the Terrapins within31-21.</p>
        <p>Maiyland added a 28-yard field g&amp;lt;nl by Dan Plocki mi its next possession to narrow, the score to 31-24 with 9:12 remaining.</p>
        <p>Vanderbilt then was able to take sMne time Off the clock on a 51-yard dMve that ended with a 39-yard fidd ^Md 1^ Johnny Clark ami a 34-24</p>
        <p>TlM Terrapins killed another jhto-mising drive ahd their h(^ for a victory when Vanderbilt linebacker Bob Scanlan recovered a fumble by Maryland split end Azizuddin Ab-dur-Raoff at the Commodore 34 with 3:22 still to play.</p>
        <p>The Commodores used a pair of Terrapin turnovers to grab their</p>
        <p>Vandy moved 61 yards in seven</p>
        <p>inthefirstquarter.</p>
        <p>The scoring drive was set up by safety AndyBaker, who interc)ted a Henning pass at the CMnmo^ 15 and returned the football to the Vandy 36.</p>
        <p>Maryland used a fourth-and-10 pass by Ifenning to Adbur-Raoof &amp;amp;tOK the Terps from the Vandy 34 to the 11-yard line to set up its only score of the first half.</p>
        <p>On the next play, Maryland tailback Bren L0WM7, who gained 70 yards on 17 carries, raced around his own left end to put the Teros up 7-3.</p>
        <p>Marylands scoring drive was set up by linebacker Sean Scott, who recovered a VanderUlt finnble at the Commodore 34.</p>
        <p>Vanderbilt regained the lead witir 1:37 left in the half when Jones capped a 4-yard drive with his 14-yard passtoPariier.</p>
        <p>The Commo^res second scMing march was set up by cMnerback Allan Romans interception at Ter-rapin49.</p>
        <p>Oklohoma St. (13)....48 lowo Stcrt#..............27</p>
        <p>STHXWATER, Okla. (AP) -Ihurman ThMnas became Oklahoma</p>
        <p>States career rushing leader by car- __________ _</p>
        <p>rying for a school-record 293 yards touchdowns.</p>
        <p>Saturday in leading the 13th-ranked Coadioys to a 48-lig Ei^ football victory over Iowa State.</p>
        <p>Thomas big day came on 30 carries and gave the senior tailback 5,047 yards for his career, eclipsing the mark of 4,754 yards previouslv held by Terry Miller. His 293 yanb bettered by 23 the single-game record previously held by Ernest Anderson.</p>
        <p>Thomas srred on runs of 58,9,1 and 66 yards and set up another touchdown with a 35-varder as the Sun Bowl-bound Ckiwboys finished the regular season 9-2 overall, 5-2 iq the conference. Iowa State finished 34 and 2-5.</p>
        <p>Halfback Bany Sanders, who alternated with Thomas, added 122 yards on 12 carries.</p>
        <p>Thomas first two touchdowns runs came in the second quarter and helped give the Cowboys a 27-17 hairame lead. However, Iowa Stat^ made it 27-24 on a 34-yard pass from Brett Sadek to Dennis Ross.</p>
        <p>Sanders macte the score 33-24 with a 2-yard run mi fowth dMvn, but the Cydones came back again with a 26^yard field goal by Jeff Shudak.</p>
        <p>After Shudak missed a 37-yarder six minutes into the fourth quarter.</p>
        <p>Oklahoma State pulled away when Thomas scored his final two</p>
        <p>Marylaml...........................e T 7 l-24</p>
        <p>Vaaderbilt.........................a 7 14 lS-34</p>
        <p>VU-PG Clark 20 MLowery 11 run (Plocki kick)</p>
        <p>VU Partner 14 pass from Jones (Clark kick)</p>
        <p>VUJones 6 run (Clark kick)</p>
        <p>VUJohnson 3 run (Clark kkk)</p>
        <p>M-Joines 30 pass from Henning (Plocki</p>
        <p>VU- Parker 15 pass from Jones (Clark kick)</p>
        <p>M-Joines 12 pass from Henning (Plocki kkk)</p>
        <p>M-FG Plocki 28 VU-FG Clark 39 A-34,816.</p>
        <p>Ski</p>
        <p>Vail</p>
        <p>Final Gome</p>
        <p>Ohio State coach Earl Bruce patrols the sidelines during Saturdays game with Michigan in Ann Arbor, Mich. Bruce was fired this week as head coach of the Buckeyes. (AP Laserphoto)</p>
        <p>First downs</p>
        <p>Rusbes-yards</p>
        <p>Passing</p>
        <p>ReturnVards</p>
        <p>Comp-Att-Int</p>
        <p>Punts</p>
        <p>Fumbles-Lost Penalties-Yards Time of Possession</p>
        <p>M VU</p>
        <p>20  25</p>
        <p>32-68 52-261</p>
        <p>Juckeyes 77 yards in 15 plays, running 6:45 off me dock, setting up the winning fidd goal by Frantz.</p>
        <p>The Wolverines drove to the Ohio State 47, but Leroy Hoards fumble was recovered by Ohio States Eric Kumerow.</p>
        <p>INDIVIDUAL STATISTICS RUSHING-Maiyland. Lowery 17-70, Morton 10-29. Vamferbilt, Crawford 21-125, McCarroQ 1645, Jones 1041.</p>
        <p>PASSING-Marybmd, Henning 2S42-2-376. VanderbUt, Jones 16-25-1-225.</p>
        <p>RECEIVING-Maryland, Abdur-Raoof 7-151. Joines 443, Edmunds 444. Vanderbilt, Parker 6-115, Kosanovich 3-39. 664</p>
        <p>Keystone  %94 Winter Park.. ...*619 Copper Mountain. *679 Breckenridge.... ^694</p>
        <p>PockoM includat Roundtrto Aiffoio from Raloigli, Groonvilla, or kintton, Holol Accommodotioiw for 5 nights.</p>
        <p>Call For Detailsreenvilletravel center</p>
        <p>200 ArUnglon Shrd SultoM756-1521Western Auto</p>
        <p>ll-Season RadialsSteel Radials</p>
        <p>r</p>
        <pb facs="00096780_0027" />
        <p>Secules, Perry Pace All-ACC</p>
        <p>By TOM FOREMAN Jr.  change that mark after being iniur^</p>
        <p>APSportsWriter  and unable to play against Maryland.</p>
        <p>AP Sports Writer . RALEIGH (AP) - Scott Secules, the ViMinia quarterback who led Coach George Welshs team to his fourth winning season and a bowl bid, and Michael Dean Perry, the Clem-son defensive lineman following in his hrothers large footsteps, are among the top pidb on the 1987 all-AUantic Coast Conference football team announced by The Associated Press Saturday.</p>
        <p>Secules barely missed being a iiqairimous selection to the team, as he was chosen on nine of 10 ballots cast by a panel of sportswriters from the five ACC states. Perry was chosen on all 10 ballots, as was freshman teammate running back Terry Allen, placekicker David Tlreadwell and offensive lineman Jnim Phillips.</p>
        <p>' Also named on all 10 ballots was Bbryland tight end Ferrell Ed* muDU, North Carolina defensive hack Norris Davis and North Carolina State punter Craig Salmon.</p>
        <p>Secules, a graduate student, has completed more than 59 percent of his passes for more than 2,300 yards and 12 touchdowns. He also has rushed for six touchdowns, best at that position in the ACC.</p>
        <p>In his last eight games, Secules is passing at a 60 percent pace. He also jffi the ACC passing efficiency l^der going into the final week.</p>
        <p>Hes been a great quarterback. Mentally, hes been v^ sharp all season, Welsh said. The offensive jine has dime a good job this season and his receivers have made some {freat catches, but hes been a great ljuarterback for us this season.</p>
        <p>: Also chosen to the offensive team were wide receivers John Ford of Vh^nifl and Clarkshm Hines (rf Duke. Along the line are tackles thris Nunamacher of Clemson and Joey Page of N.C. State; guards ytiiilips and Pat Crowley &amp;lt; Nmrth Carolina; and center Chuck Massaro N.C. State.</p>
        <p>: Joining Allen in the backfield is Wake Forests Mark Young.</p>
        <p>* Ford, the third leading receiver in the ACC, set a school single-season wcord in last Saturdays victory over North Carolina, catching seven passes for 116 yards, giving him a peasw total of 787 yaj^ to break the mark of 777 set by Billy Smith in 1983. Ford also has 18 career touchdown catdies, another Virginia mark.</p>
        <p>: John Ford is a great deep threat, nmning deep on ttm streak and post patterns, Welsh said. Teams have changed their coverages this season justlbrhim. iBfiea has averaged more than 100</p>
        <p>Goad and Bailey have anchored a</p>
        <p>North Candina oefensive line that has yielded ground grud^ngly all seas. Bailey leads the TaFjfteeb with 117 hits and Goad is third with 88. In the middle of that, Rudolph is seixmd with 98 as all tfcuree entered the final week of the season.</p>
        <p>is part of Wake Fm:ests secmid-ranked dtefense which has aUowed a Uttie less than 18 points^</p>
        <p>re. Walker has been a k^ part of Terrapin defense for nrst year Coach Joe Krivak.</p>
        <p>Davis has been the standout of the season for defenders. He has scored</p>
        <p>five touchdowns, tied for third on the Tar Heds. He has returned an in-terceptim, a mid-air fmnble recovery and two blocked punts for touchdowns. Against N.C. State, he recovered a bad snap mi an attmnp-ted pud in the end zone fw another toiK&amp;amp;Iown.</p>
        <p>Greene has been just as deadly for the Demmi Deacons, intorc^ting three passes and returning one against Duke for a touchdown. He abo has recovoitri a blocked punt for</p>
        <p>ascore.</p>
        <p>Cook leads the ACC with seven in-terceptkms, while Woolfmxl has four.</p>
        <p>Salmon finally emerged thb year as the premier punter for the</p>
        <p>Wolfpack, and abo in the ACC, averaging 44J yards per kick on 61 attmiH^.</p>
        <p>Ihe ACC coach of the year will be announced Monday morning and the pbyer of the year follows Monday afternoon.</p>
        <p>Tbe Associated Press 1987 all-Atlantk Coast Conference football team selected by a |nel of 10 sportswriters and Imad-casters from throii{^t the league region.</p>
        <p>Offense</p>
        <p>WIUIoimFord. Virginia WR-Clarkstoiinnn,Diike TE-FerreUEdmundsJIaryland T-Jeff Nunamadwr, Clemson T-Joey Page, N. Candina St.</p>
        <p>G-Pat Crowley, N. Candina G-Jolm Phillips, Clemson COmdt Massaro, N. Candina St.</p>
        <p>f-Ten7Alleo.Clen</p>
        <p>RB'MarkY&amp;lt;wag,Wal</p>
        <p>PK-DavidTieiidwen,</p>
        <p>UnesMn</p>
        <p>Minear, Clonson;</p>
        <p>N. Candina; njuiiams. demsoo; Granger, Clenwoo; Mann, Wake Foitst; Port Did: Bak, Clemsoi^ Gandca, N. Candina; Maybeny, Wake Forest.</p>
        <p>Slayden, Duke; Boon^Duke; Johnson, Clemson; McFadden; Clemson; McGill, Wake Forest.</p>
        <p>DEFENSE</p>
        <p>Unemen</p>
        <p>Alston, Maryland: Demore, Duke; Lee, Georgia Tecb: Stephens, Clemson; Vaumm, Wake Forest.</p>
        <p>Liaebacken GotUrey, Duke, Griggs, Virginia; Earle, Clemson; Carter, Clemson; Edndobry, Ga. Tech.</p>
        <p>Backs</p>
        <p>Brooks, N. Candina St.: Hammond, Virginia: Ingram, Ga. Tech; Lilly, Ga. T^ibny, Duke; Purnsley, Wake Forest</p>
        <p>WakeForest Clemson</p>
        <p>L-Mlehael Dean Peny, Clemson L-Tim Goad, N. Carolina IrCaritonBaOw, N. Carolina LBeanScottVln^</p>
        <p>LB-Brett Rudobph^Candina LB^Iimmie Simmons, Wake Forest LB-Kevin Walker, Maryland DB-DormeDWoolford. Clemson DB-A. J. Greene, Wake Forest DB-Norris Davis, N. Carolina DB-KevinCook,Vir^</p>
        <p>P-Craig Salinon, N. airolina St</p>
        <p>HONORABLE MENTION OFFENSE Wide Receivers</p>
        <p>Lester, Georgia Tech; Proebl, Wake Forest; Lewis, ft Candina</p>
        <p>Western Auto</p>
        <p>MhkFbewdonll</p>
        <p>USMtMke</p>
        <p>Withdoughmitstyte handlebars, racing mag wheels. Stretch, freestyle hame. Front rear caliper brakes. Jtuntpsgs. 34-2788,90</p>
        <p>'Wi</p>
        <p>20m.IIXrNi-lllse</p>
        <p>Choose boys Dirt Ouster or giri'shi-rise. 34-2750,59</p>
        <p>20 In. GM'sNI-Mm</p>
        <p>Pretty n Pink with white frame, coaster brakes. 34-2749-9</p>
        <p>20 m. Bny*s NIX</p>
        <p>Black invader H with stretch frame. BMXforfc. 34-2770-5</p>
        <p>20ln.Dnrs"&amp;gt;aoNie</p>
        <p>"Scorch'n" hae overtiaed fork, down-tube. 34-2778-8</p>
        <p>2Oln.1OSpfl-Xac0r</p>
        <p>Lugged frame, Shimatio derailleur. Each. 34-2926,27</p>
        <p>Your</p>
        <p>54!? 59*</p>
        <p>DmnwNln.10Sp0.</p>
        <p>Shimano derailleur. front rear caliper brakea. 34-2950.51.53</p>
        <p>Boy's CM'S or</p>
        <p>*s</p>
        <p>the AUen</p>
        <p>yards in reckons in 10 ----------</p>
        <p>bnak the ACC record for yardage in (me season. That mark b held by Dukes Wes Chesson, who collected 1,080 yards in 1970. Against N.C. State, he had 11 catches for 192 yards and three touchdowns.</p>
        <p>.Clarkston definitely deserves all-oMiferaice homxn, Duke Coach Steve Spurrier said. Hes a fearless [for that will by hb body on tocatchthefootbaU. emeiwed as the new ground threat in the Clemson attack, rushing for 868 yards through hb first 10 :games and scoring seven  touchdowns. Young, fighting off inju-: ries through the m^ of the season, 2 rushed for 709 yartb and four touchdowns through 10 games.</p>
        <p>% ; Named to the d^ensive team were t Perry; North Carolina linemen Tim ^Goad and Carlton Bailey; and * Virginias Sean Scott. The ' linebacdkers are North Carolinas Brett Rudolph, Jimmie Simmons of jVake Forest and Kevin Walker of</p>
        <p>' In the defensive secondary are Davb, aemsons Donnell Woolford, A.J. Greene of Wake Forest and Kerin Cook of Virginb. The punter b N.C. Sbtes Craig Salmon.</p>
        <p>Perry has come withb one tackle for a loss of tying hb older brother, William, for most bckles for loss m the ACC m one season. He was stuck at 60 and didnt get a chance to</p>
        <p>16 m.BMXorHI-mM</p>
        <p>Shimano coaster brake. Adj. training wheals. 34-2718.19</p>
        <p>Boy's or GiH's D5lE.ei.</p>
        <p>SnafWTMtellMe-Oii 20 In. BMX</p>
        <p>Sturdy steel frame, adjustable  Track certified. Disc wheels,</p>
        <p>training wheels. 35-1410-6  Rear tide pull brake. 34-2766-3</p>
        <p>For Boys tGiris</p>
        <p>Trsck csrtifisd. Disc wwhssls. Rsar sids pull brake. 34-2767-1</p>
        <p>2979  79</p>
        <p>26lB.12Sp6-NcBr</p>
        <p>Shimano derailleur. Lugged lifetime frame. 34-2968.89</p>
        <p>Man's or Women's</p>
        <p>l6SpBMI**CllyBlkB*</p>
        <p>26 in. wHh kiggsd frame. SMmeno derail. 34-2028.27</p>
        <p>AA88 Men'eor OA88 OAg*c*.  Women's A JeaO</p>
        <p>GIFT SOMEONE SPECIAL WITH A SOUND VALUE ... GIVE A GIFT THAT LASTS</p>
        <p>.159"^, 99"  29" ^22"</p>
        <p>g-Blaytpnmr</p>
        <p> RMdAlwt</p>
        <p>9# to. 12 volt. 21-5016-7</p>
        <p>39</p>
        <p>79IU1BSS99 (15).........24</p>
        <p>Kwntucky  22  </p>
        <p>- LEXINGTON, Ky. (AP) - Tennessee stopped Kentuckys Mark Niggy on four runs inside the 5-yard Bne b the final mmutes as the 15th-janked Volunteers held on for a 24-22 ^theastem Conference football rictory Saturday.</p>
        <p>* Quarterback Jeff Francb, returning to the Tennessee lineup after biing two games, tossed two touchdown passes as the Volunteen bnprovnd to 8-2-1 overall and 3-1-1 b )he^.</p>
        <p>; Francb hit wingback Terence {Sevnbnd with a 10-yard scoring</p>
        <p>1</p>
        <p>r</p>
        <p>CLOSED THANKSGIVING DAY . . . OPEN FRIDAY TO MEET YOUR NEEDS</p>
        <p>99MMitliBallWY ssMmillilaltory 49 MmMi BMlwry 79</p>
        <p>44?</p>
        <p>WiMllAWM DMooFwilll</p>
        <p>High powvr, lotw cotl</p>
        <p>3I!f:x 29? as 54i* a- Seg^gSSt;</p>
        <p>TBimwSg^</p>
        <p>Pra</p>
        <p>Battery TSrmMels BatlmryCaktes</p>
        <p>T...    9-24  in.  Innfth.... 1.99</p>
        <p>25-40 in. length. . .2.99 49 72 in. length. . .3.99</p>
        <p>itrike with 6:25 remaiiiing, giv^ Weiiee a 24-20 advantage, ib first bad of the game. t Gbon Fohr then com iMWei for 47</p>
        <p>SiMrtiPliiia</p>
        <p>Motwrcrah.</p>
        <p>Amllcwlleni</p>
        <p>InilOGli.</p>
        <p>IT"' ri|</p>
        <p>mm</p>
        <p>199 i?rn|5E 10% OFF 10% Off S^2giS5.r 5</p>
        <p>IMN</p>
        <p>i</p>
        <p> Ifigm went off right tacUe on tbe Drit two pbys and tried dives over 3he middb on the last two. But on hb :final attempt, with 1:50 left, he was joAes fjrom the goal line.</p>
        <p>1 Francb kept the hall on three</p>
        <p>tator Bob Gmmion ran out oi</p>
        <p>:t(iQlumbBdb^</p>
        <p>^oey Worbi^ 22-yard field goal.</p>
        <p>i</p>
        <p>trn^kmriummn, mi,nni/ei.Prni..eni.n^nmMW.piwii  --</p>
        <p>CO-2.  tele...2/794  Pemim4</p>
        <p>W4&amp;gt;..-ee  Mai/</p>
        <p>ale  67a</p>
        <p>Wahela -fa</p>
        <p>tSu.</p>
        <p>Umita.</p>
        <p>794630-9</p>
        <p>umiaiiMM MeikieteahM</p>
        <p>|49</p>
        <p> 01 pum|&amp;gt;. 1^ Limit 2 m'</p>
        <p>27* iB?*</p>
        <p>Umhtl</p>
        <p>SALE ENDS NOV. 28,1987</p>
        <p>VUootom Auto</p>
        <p>W  1ieila49anlMllaa4</p>
        <p>STORE HOURS:</p>
        <p>Mon.-Fri. 8-8 Sat. 8-6 Sun. 1-8</p>
        <p>Ammricmn C|&amp;gt;ree MaslerCfrerMe V*M</p>
        <p>Total Cfrerye Choiea</p>
        <pb facs="00096780_0028" />
        <p>mm</p>
        <p>Th Dally Reflector, Qreenvllle, N.C.</p>
        <p>Sunday. November 22,1987</p>
        <p>Lewis Leads Aggies By TCU</p>
        <p>FORT WORTH, Texas (AP) -Freshman Darren Lewis rushed for 194 yards and scored on runs of 35 and 80 yards Saturday, lifting 16th-ranked Texas A&amp;amp;M to a 42-24 Southwest Conference football victory over Texas Christian.</p>
        <p>The victory set up an SWC champi-</p>
        <p>showdown for the Aggies ee Sta-</p>
        <p>runs of 4 and 56 yards, giving the underdog Homed Frogs a 14-10 haUtimelead.</p>
        <p>Texas A&amp;amp;M had scored on Lewis 35-yard run and Slaters 37-yard field goal. A 27-yard scoring pass from Craig Stump to Rod Harris and another Slater field goal put A&amp;amp;M ahead 23-14.</p>
        <p>2,855 yards, the third-best figure in Iowa history.</p>
        <p>Minnesotas Rick^ Foggie l for ^6 yards, including second-half</p>
        <p>touchdown plays of 5 yar^ to Chiis Gaiters and 45 yards to Gary Couch.</p>
        <p>The 260-pound junior, the nations leading rusher, has gained 1,655 yards this season, an average of 155 yards per game.</p>
        <p>Heyward, ignoring blowing</p>
        <p>snow</p>
        <p>^ving night at College ;tion against Texas.</p>
        <p>1 The Aggies increased their record to 8-2 overall, 5-1 in the SWC. The H(med Fn^s, who were playing .without star running back Tony Jef-:fy, finished the year 5-6 and 3-4.</p>
        <p>* Jeffery, the third-leading rusher in the natim, was declared ineligible tfor his final college game by the NCAA for an improper relationship with a professional agent.</p>
        <p>TCU W 24-23 with 7:54 after a field .g(l by Lee Newman.</p>
        <p>I Lewis, who had a 70-yard scoring ^nm called back by a penalty in the</p>
        <p>David Rascoes 5-yard scoring run and Newmans field goal then gave</p>
        <p>Iowa took charge of the game after getting the winfatits back in the second quarter and quickly erased a</p>
        <p>and a whipping 30 m{di wind ^t put vind Chiu factor at minus 10</p>
        <p>fr-3 Minnesota lead built on field goals )Lohmiller.</p>
        <p>the crowd of 40,164 fans upset before Lewis specta^</p>
        <p>of an trrun.</p>
        <p>rfourth period, ran 80 yards for a ^"score after his</p>
        <p>his fumble bounced back into his arms.</p>
        <p>Then, Gary Jones returned an intercepted pass 54 yards for a touchdown, clinching tUie victory.</p>
        <p>Scott Slater kicked four field goals for the Aggies, who have beaten TCU 15 consecutive times.</p>
        <p>TCUs Tony Darthard scored on</p>
        <p>Sooners...</p>
        <p>(Continued From B-l)</p>
        <p> and Nebraska linebacker LeRoy Etienne recovered at the 8.</p>
        <p>The Sooners again came away with nothoing early in the second quarter when lAshar missed a field goal at-tenqg aftm* (Hdahoma went from it 20 to the Nebraska 28.</p>
        <p>Andersm fumbled again at the Nebraska 25 later in the period to stall a 50-yard drive and defmsive end Jon Marco recovered for the Cornhuskers.</p>
        <p>It was the third straight time the No. 2 team has w(m a 1-2 shootout but the top-rated team still leads 14-6-2.</p>
        <p>Oklah(na had beoi No. 1 in every AP poU this season until Nebraska took over foUowing the Sooners hard-fought 17-13 victory over , Missouri last Saturday.</p>
        <p>Tayhxr carried 18 times fw 54 yards and set a single-season rushing record of 605 by a Nebraska quarterback.</p>
        <p>Iowa (18)...............34</p>
        <p>Minnesota..............20</p>
        <p>IOWA CITY, Iowa (AP) - Chuck Hartlieb passed for two touchdowns and surpassed the 300-yard mart for the fifth time in the last six games, leading 18th-ranked Iowa to a 34-20 victory Saturday over Minnesota in a Big Ten Conference footbaU finale.</p>
        <p>Iowa finished the regular season 9-3 with its fifth straight victory, tied for second in the league at 6-2 and was to accept an invitafim to {day in the Dec. 30 HoUday Bowl in San Diego, Calif.</p>
        <p>Minnesota, 6-5 and 3-5, held slim hopes Q being invited to the Independence or Sun bowls.</p>
        <p>Hartlieb shook off an early fumble to fire secmid-quarter t&amp;lt;Nichdown passes of 15 yards to Mike Flagg and 34 yards to Quinn Early as Iowa scored on four strai^t possessions to take a 24^ halftimeTeaa.</p>
        <p>He completed 14 straight passes during (me stretch in the first half and finished 26  41 f(m 328 yards.</p>
        <p>That improved his season total to</p>
        <p>of 32 and 44 yards by Chip 1</p>
        <p>Rick Bayless scmred on a 4-yard run to cap 65-yard, lOf lay drive following Lohmillers second fieldgoal and Hartlieb hooked up with Flagg nine plays after Minnesotas Broit Herbel punted (mly 21 yards to the Iowa 43.</p>
        <p>I&amp;lt;wa got the ball right badi on the</p>
        <p>the wind__________</p>
        <p>degrees, scored on a 58-yard run on Pitts third play from scrimmage. Heyward made it 144) later in the first quarter by carrying all 10 times on a 38-yard scoring dnve ended by hisl-yararun.</p>
        <p>Heyward also scored on a 4B-yard</p>
        <p>run miciway through the fourth</p>
        <p>; ntf </p>
        <p>Minnesota 40 following another 21-yard Herbel punt and Early beat</p>
        <p>cornerback Tmy White</p>
        <p>quarter as Pitt, &amp;amp;3, won its third in a row and accepted a bid to play the Southwest Conference runner-up in the Dec. 31 Bluebonnet Bowl.</p>
        <p>Kent State fell to7-4.</p>
        <p>Heyward, whose 41 rushing at-</p>
        <p>later to haul in Hartliebs ^______</p>
        <p>thrown pass in the end zone with 1:55 left in the half.</p>
        <p>temfte and yards were career ghs, carried &amp;lt;m Pitts </p>
        <p>The Hoosiers took a 21-0 lead, but managed only one first down tor more than a quarter as Purdue cuti^ the lead to seven points on two touchdown runs by James Medlock. But Thompson, who also scored in the second quarter, got his third touchdown two plays after Willie Bates recovered a fumble at the Purdue 4-yard line midway through the final pieriod.</p>
        <p>Then, linebacker Van Waiters return^ a fumble 47 yards for the clinching touchdown two minutes later. Marc Ferry stopped the last Purdue threat with another fumble recovery at the Indiana 25 in the closing minutes.</p>
        <p>Joe Huff and Bill Reisert earlier blocked two Purdue field goal attempts by Jonathan Briggs.</p>
        <p>yards, and senior Danny McCoin hit junior wide receiver Roosevelt Mukes with an 18-yard touchdown pass. The Bearcats were left one point behind when McCoin was unable to complete a conversion pass to junior wide receiver Bill Davis.</p>
        <p>Virginia Tech finished the season at 2-9 under first-year Coach Frank Beamer, the worst HoUe record since the 2-4 finish of 1973. Cincinnati fell to 4-7 to end the fourth season under Coach Dave Currey as the Bearcats lost to Virginia Tech for the first time in four meetings.</p>
        <p>MARINOS INJURIES</p>
        <p>MIAin (AP) -When quarterback Dan Marino dislocatod the ring</p>
        <p>Pitt (19).................28</p>
        <p>Kant Stata .........5</p>
        <p>PITTSBURGH (AP) - Craig d and</p>
        <p>Ironhead Heyward slipped slid to 259 yards on a snow-covered</p>
        <p>____________first  13  plays  from</p>
        <p>scrinunage as snow fell throughout the first period on the already ice-covered Pitt Stadium artificial turf. He tied an NCAA record for most consecutive rushes by the same r, 15, set by Ernest Anderson of oma State against Tulsa in</p>
        <p>Vifgpinia Tach*aa******21 Cincinnati...............20</p>
        <p>BLACKSBURG, Va. (AP) -Freshman Jon Jeffries rushed for 160 yards and two touchdowns Saturday as Virginia Tech held on to defeat Cincinnati 21-20 in college football.</p>
        <p>fiiMMir (Ml li throwing hand in a n game for the Miami .against the Chicago Bean on Alta. 16, a look ol pain crossed the feceofCoachDonShula.</p>
        <p>But Miami fans were not</p>
        <p>field for his 11th consecutive</p>
        <p>game tlds seasim and sc(ned touchdowns as 19th-ranked and Bluebonnet Bowl-bound Pittsburgh beat Kent State 28-5 Saturday in college footbaU.</p>
        <p>Heprard, who gained 134 yards in the first quarter, became only the eighth playo* in NCAA Divisi( I-A hist(H7 to rush f&amp;lt;v 100 yards in all 11 of his teams regular season games.</p>
        <p>Pitt, coming off a KM) upset victory over Penn State, raised its lead to</p>
        <p>Cincinnati rallied in a 20-point ngback</p>
        <p>21-0 when Heywards backup, soph-scored his first</p>
        <p>fourth period as junior running A1 McKinney ran for scores of 1 and 2</p>
        <p>dismayed. lecMkd that ta sufferedtsimifariiriurfp^</p>
        <p>1964 NFL season. Ail he did after icturniiM to action WM to pam fo^ touchdowns and 5,6M aem yarft^ both league records.</p>
        <p>Wales Captures World Cup Golf</p>
        <p>omore Adam Walker, scored! c(dl(^te touchdown on a 19-yard run early in the second quarter.</p>
        <p>Kent State scored in the final minute of the first half on Larry Stdnborgs 34-yard field goal and a safety on the ensuing kickoff.</p>
        <p>Although there were 34,472 ti(d(ets sold, the estimated attendance was only 15,000.</p>
        <p>Pitt Captures First Victory</p>
        <p>BREVARD - Pitt Community Col-</p>
        <p>Indiona (20)............35</p>
        <p>Pufdua  14</p>
        <p>BLOOMINGTON, Ind. (AP) - An-</p>
        <p>lege held off Blanton Junior College  ....... neofthe</p>
        <p>to win its first basketball game of season Saturday night, 71-67.</p>
        <p>thoiw Thompson rushed for three UNidKlowns Satun</p>
        <p>The two were playing in the con-theBrevan</p>
        <p>KAPALUA, Hawa (AP) - Ian Woosnam and David Llewellyn outlasted Scotland in a twohole sud-den-death playoff Saturday and broiht Wales its first triumph in the 33rdWorlddmofGolf.</p>
        <p>Woosnam, by far the outstanding individual in ttie 324ation compr tkn, and Llewellyn each made two</p>
        <p>That left it up to Torrance, who</p>
        <p>The United States finished third at 576, two shots out of theplayoff. Woosnam, winner of five European</p>
        <p>titles this year, collected $50,000 as individiia] winner and another</p>
        <p>the</p>
        <p>ptayoffpars in a driving rain and gained the trophy when Sam Tor</p>
        <p>$100,000 as a inember of</p>
        <p>Oklahoma.</p>
        <p>f 14 3-17 ..7   0-7</p>
        <p>Nebraaka.</p>
        <p>FiratOaarter</p>
        <p>NebK.Jooe8 25 run (Dreiman kkk), 13:32</p>
        <p>ThMQaarter OUa-Stafford 11 nm (Lashar kkk), 2:12</p>
        <p>Okla-CoUinB 65 run (Laihar kkk). .13:21</p>
        <p>Fourth Qaartcr OUa-FG Lashar 27,7:20 A-76,663.</p>
        <p>First downs Rushes-yards&amp;lt;</p>
        <p>Retur^ards ,</p>
        <p>Ounp-Att-Int</p>
        <p>Punts</p>
        <p>Fumbks-Lost Penaltks-Yards Time of Possession</p>
        <p>Okla  Neb</p>
        <p>23  11</p>
        <p>70412  41-177</p>
        <p>25  58</p>
        <p>54  18</p>
        <p>2-2-1  6-IM</p>
        <p>038  248</p>
        <p>03  OO</p>
        <p>5-15  547</p>
        <p>35:11  24:48</p>
        <p>INDIVIDUAL STATISTICS RUSHIN(r-(ndahoina, Collins 13-131,</p>
        <p>C.Thompson 21-126, Anderson 24-110 Stafford i2-ajfk4)raska, K. Jones 1024, Thylor</p>
        <p>ranee missed a par putt OO the second hole.</p>
        <p>Wales, led by Woosnam, and Scotland tied at the end of the regulation 72 holes at 574, two under par, after a final round that resembled a survival test, with players wading through pouring rain and wind gusts imto40mph.</p>
        <p>The playoff - the first in the events history  was set up when Torrance, who had poDed Us second shot out of bounds, sank a critical, 6-foot putt for bogey on the72adhole.</p>
        <p>All four players made par-5 on the first extra Me. Samqr Lyle of Scotland missed from about 8 feet on a putt that would have won tt.</p>
        <p>On the next playoff hole, the 18th at the Kapahia Bay course, both Tor-rance and Lyle had birdie possibilities for Scotland and Woosnam hada chance for Wales.</p>
        <p>AD three missed on their bir^ at-</p>
        <p>team. Llewellyn also ---------</p>
        <p>$100,000-more than double his largest previous winidngs for a season.</p>
        <p>Lyle and Torrance each won $55,000</p>
        <p>Woosnam, with a closing round of 72 in the extremely difficult OQD-</p>
        <p>par-72 i_________,</p>
        <p>Sto, took the individual title at 274. Lyle was next at 71-279.</p>
        <p>UeweOynhadacloi^TOandaSOO total, and Torrance was 78-295.</p>
        <p>_____iturdayas20th-ranked</p>
        <p>Indiana scored five times after Purdue turnovers and beat the Binler-makers 35-14 in a season-ending Big Ten Conference footbaU game.</p>
        <p>It was the largest winning margin by Indiana over Purdue since a 264 shutout in 1945 and gave the Peach BowHiound Hoosiers an 8-3 regular-seaaon finish. The BoUennakers dropped to3-7-l.</p>
        <p>Bnan Dewitz set up two Indiana touchdowns, a 1-yard run by quarterback Dave Kramme and a 5-yud run Iqr Thompson, with a pair of first-quarter pass interceptions.</p>
        <p>Dewitz also stopped a Purdue drive with a fumble recovery at the Indiana 11 in the durd period.</p>
        <p>solation game of the Brevard Tlp-Cff Tournament.</p>
        <p>The game was even throughout mudi of the first haff befme Pitt puUed away late fw a 43-35 halftime</p>
        <p>edge. But Pitt got into foul trouble in 1 half and had to milk the</p>
        <p>thesecond_________</p>
        <p>clock, slowing the action down.</p>
        <p>Blanton finaUy cut the lead to 6667 with 48 seconds to play on a basket by Brandon Beasley. Then, with Pitts Mike Hathaway missed a firee throw, Paul HoUingsw(Nrth stole the boli back and hit two free throws for a 7067 lead with 15 seconds to go. After a miss at the line by Blanton, Otis Barnes made one last free throw for Pitt with two seconds to play.</p>
        <p>We have to cut down on our turnovers (Pitt had 23) and weve got to hit a bettor percentage fnn the foul</p>
        <p>line, Coach Charles Coburn. *Bul I was pleased wiUi the defenae, especially in the second 1^-M Dmm and Hattaway botti Mmnd well, each getting lOrebounds.</p>
        <p>Dunn led the Paladins with 16 points while Barnes had 15, W u^irorth had 11 and Hathaway hid 10. Blanton was led by Paid Martina with 17 and Beasley and Ray HowcD with 11 each.</p>
        <p>Pitt, now 1-3, opens itshomeaeaaon Tuesday, hostiBg Methodist Colleges JV team at 7:30 p.m. at A.G. Cox gym.</p>
        <p>PnTCC(71)  ___</p>
        <p>Barnes 71-215, ()oaairtoB3842,DuBn3 10-1416. Hathaway 28610, HoIHiiaswlhZ 5-7 11. bley 3 00 8. Mkhaeb 0 26 2. WUliams 1 OO 2. IMals 22 27-37 71. BLANTON (67) FowkrOOOO,GntryOOOO, BucfaananO (1) 008, Peterson2204, Martinei6S-717, 4 (2) 1-2 IL McUughlin 11-2 3,</p>
        <p>Howell 4 SO 11. Boooe 0 M 2, Workman 2</p>
        <p>448, Conley 1001 Totals 24 (3) 124387.</p>
        <p>PittC.C ...........____________...a  2271</p>
        <p>Maatoa.........................35 3267</p>
        <p>The weather and my game do not arrant description, said Ben Crenshaw, who stnigiM h&amp;gt; a final-</p>
        <p>round 74 and was 286, two unda par, on his own ban.</p>
        <p>Payne Stewart, his American partner, also shot 74 and was at 290 for a team total of 576. Each won $40,000.</p>
        <p>We just could not make a putt for the whole tournament. We had our but we couldnt make the rsakL</p>
        <p>1254, Bdl 221, Heibel 2-5, Brinson 2-2, Carprato' 1-1.</p>
        <p>PASSUNG-OUahoma, C.Thompson 2 21-25. Nebraska, Taylor218-258.</p>
        <p>RECEIVIN(^-OUahoma. Jackson 1-21, Stafford 14. Nebraska, Bell 2-18, MiUikan 1-17, Hawkins 1-9, R.Smith 1-8, Brinson 14.</p>
        <p>MISSED FIEU) CiOALS-Oklaboma, Lashar 45,36.</p>
        <p>tempts, with Torrance nmning first putt about 65 feet beyond the</p>
        <p>The Americans once crept to within-two shots of the lead, but</p>
        <p>l&amp;amp;ewellyn, who was bunkoed in three, drt^ a 6-foot par putt after Lyle and Woosnam complm their pars.</p>
        <p>bogeys by Stewart on the 16th and tended!</p>
        <p>I ended their chanca.</p>
        <p>Ireland, with Eamonn Darcy and Ronan Rafferty, and Australia, with Ossie Moore and Rodger Davis, tied for fourth at 580, four ovo par.</p>
        <p>anKINO OUR  MIS  MMIE  </p>
        <p>^ -Sf kSTSSS</p>
        <p>OOF COATWQ.JJ anchors,  home-</p>
        <p>^ es.vc*BS.cPVC.coP...a*tv.POUVMHL</p>
        <p>YOURSW'-''</p>
        <p>OOBOO*^</p>
        <p>3012 s. Memorial Drtvi 355*2400</p>
        <p>^JOETJSrJLOM^</p>
        <p>OUESTOR</p>
        <p>IW</p>
        <p>From $32^</p>
        <p>P155/80R13</p>
        <p>P165/80R13 $3935</p>
        <p>P205/75R14</p>
        <p>$51.69</p>
        <p>P17S/MR13 $41J8</p>
        <p>P20S/75R15</p>
        <p>$52.69</p>
        <p>P165/MR13 $4358</p>
        <p>PZlSri'SRlS</p>
        <p>$53.89</p>
        <p>nurrsKu $45.79</p>
        <p>P22S^5R1S</p>
        <p>$5631</p>
        <p>n9S^5R14 9A9M</p>
        <p>P235nSR15</p>
        <p>$5937</p>
        <p>The affordable passenger radial withno compromise performance</p>
        <p> Performance excellence at an affordable price.</p>
        <p> Computer designed for optimum wear and handling.</p>
        <p> Two full-width steel belts for strength and stability.</p>
        <p> Two polyester body plies for a smooth ride.</p>
        <p> Wide tread pattern for improved all-season capabilities.</p>
        <p> Designed for front, rear and four-wheel drive vehicles.</p>
        <p>FREE MOUNTING FREE ROTATION</p>
        <p>TRANSMISSION SERVICE</p>
        <p>$36.95</p>
        <p>Racommandtd avtry 24,000 milaa by moat car mfg. Indudas parts &amp;amp; labor to changa pan gaakat, fluid and fittar. Moat raar whaal driva cars</p>
        <p>ROTATE &amp;amp; BALANCE 4 Tires</p>
        <p>$18.95</p>
        <p>Moat Cara &amp;amp; Light Trucka</p>
        <p>COOLING SYSTEM POWER flushed $19.95</p>
        <p>Tharmoatat, hoaaa and balte chackad, coolant raplacad to factory apaca, up to 1 gallon.</p>
        <p>WHITE'S STEEL BELTED RADIALS</p>
        <p>MaauflKlurad by  mriwr compmy.</p>
        <p>FREE MOUNTING FREE ROTATION</p>
        <p>A qwatty Ur altiit rlfhlprira.</p>
        <p>4 FOR $99.95</p>
        <p>WHITES RETREADS</p>
        <p>Far aamomkal dcpaedabBlty</p>
        <p>4 FOR $59.95</p>
        <p>JIAS.</p>
        <p>A7M3</p>
        <p>871.13</p>
        <p>C7I.I3</p>
        <p>JtADIAl,</p>
        <p>PI5S/80R13</p>
        <p>P16S/88R13</p>
        <p>PI85/I0R13</p>
        <p>P15S/I0R13 234JS  P28Sr75R14  S4SJ9</p>
        <p>P175O0R13 tUM  PZOSriSRlS  $45J9</p>
        <p>P1IS/80R13 $38.95  PZIS^SRIS  $44.95</p>
        <p>niSriSRM $41J9  P22Sf7SRlS  $47J9</p>
        <p>P19SriSR14 $4195  P23Sf75RlS  $4945</p>
        <p>4 FOR $69.95  4  FOR  $79.95</p>
        <p>JIAS.</p>
        <p>JIADIAL</p>
        <p>D78-14</p>
        <p>E78-14</p>
        <p>F72I4</p>
        <p>P185n5R14</p>
        <p>PISSTTSRM</p>
        <p>.niA8,</p>
        <p>G78-14</p>
        <p>P7I.I5</p>
        <p>RADIAL</p>
        <p>P20SriSRl4</p>
        <p>P20SmRl5</p>
        <p>HAPPY Thanksgiving!</p>
        <p>3012S.MMiorial Drive 355-2400</p>
        <p>%</p>
        <p>14C78.15 f  2812  Sairtb  Mm(W  Oriva    ISS-t4M</p>
        <p>I</p>
        <pb facs="00096780_0029" />
        <p>By Rose, 7^</p>
        <p>By WOODY PEELE Reflector Sports Editor</p>
        <p>How big is an inch?</p>
        <p>Ask Rose High Schools Rampants.</p>
        <p>Friday night, by that much, the Rantpants fail^ to pick up needed yardage for a first down deep in JacksMiville territory and the Cardinals held on for a 7-6 upset victory, knocking the previously unbeaten Rampants out of the State 4-A Playoffs.</p>
        <p>Jacksonville scored early in the game as Ted Elliot dashed 45 y^ds on tte second Cardinal play. Deke Owens added the PAT for a 7-0 lead that was to prove fateful.</p>
        <p>Rose came back to score on a 1-yaid stretch by Timmy Moore late in the third period, but a high snap on the PAT try cost the Rampants dearly. While he had time to put the ball back (m the tee, holder Don Thompson instead, tried to pass for the</p>
        <p>The fumble in the first period was the key, Williams said. Were going in and turn it over. Both teams had other chances, but I think that was ttie key play ri^t there.</p>
        <p>(Jacksonville) did a heck of a job toni^t. They have a good football team and I dont take a thing away from them, he ad^.</p>
        <p>StUl the loss was a heartbreaker for the Rampants, who had won 11 straight games before finally bowing this year.</p>
        <p>The contest was one in which both teams had offensive opportunities but were stopped mainly bv hardhitting defenses. Rose finished the</p>
        <p>the Jacksimville defense.</p>
        <p>The Cardinals launched a 6-minute drive in the early minutes oi the final period that reached the Rse 10 before Elliot was relieved of the ball on a fumble and Rose recovered.</p>
        <p>The Rampants, taking Over with 4:50 showing, marched rij^t down the field, but found themselves facing a foui^ and two from ie Cardinal 19 with just under a minute left.</p>
        <p>Moores attempt to get the yardage fell an inch short, tunng the ball over with 37 secimds t6 go and the Cardinals ran out the cIock to earn a spot in the third round of the playoffs.</p>
        <p>For Jacksonville, it was sweet revenge. Earlier this year, in the second game of the season, the Rampants slip^ past the Card, 12-7. It marked the second times in recent years that Jacksimville had lost to Rose during the regular season only to come back and earn a victory in thyilayoffs.</p>
        <p>The CJardinals will now travel to face another unbeaten. Northern Durham, a 35-27 victor over Wilmington New Hanover Friday ni^t. , While Rose came so close to having one more crack at the goal line. Rampant coach Chip Williams called a first quarter play the key to the game.</p>
        <p>than the Cardinals282 to 228 thats not what wins the game.</p>
        <p>Rose, unable to move the ball on its first series, kicked the ball away into the teeth of a driving wind, and the Cardinals took over at midfield.</p>
        <p>Elliot, who wotdd carry the ball 31 times in the game, got the first call and picked up five around the right side. Then, on second down, he UxA it strai^t up the middle, broke ist the linebackers</p>
        <p>to race 45 yi----------------</p>
        <p>only 2:30 elapsed, Owens made it 7-0 with his ki(^.</p>
        <p>The Rampants came roaring back. After moving 11 yards in two plays, Dave Daniels broke away to race 32 yards to the Cardinal 37. Moore then went around the right side, was hit and fumbled, Init Ralei^ Fuller pounced on it to keep it in Roses hands at the eight.</p>
        <p>But two plays later, Daniels went up the middle and had the ball strip-p^ at the four - the key play according to Williams.</p>
        <p>After two minor threats. Rose got the ball back at the Cardinal 42 after recovering an Elliot fumble. A pass interference call gave Rose a first down at the 32, but the drive fizzled without another first down.</p>
        <p>On the openii^ kickoff of the second half, the Rampants were twice flagged for being off-sides.</p>
        <p>Rose, kicking from its own 30, then almost totally missed the ball, which roUed only two yards before being downed, giving Jacksonville excellent field position.</p>
        <p> It wasnt an on-side try, Williams said. We just missed the kick. We were trying to just lob it downfield to keep it out of the hands of (McGrue) Booker (who has returned seven kicks for touchdowns</p>
        <p>this year).  *  i,</p>
        <p>Jacksonville was unable to take aidvantage (rf the situation, however, and a 35-yiurd field goal attempt by</p>
        <p>Owens was wide to the right.</p>
        <p>Rose then marched 80 yards to</p>
        <p>score its only touchdown of the g^e.</p>
        <p>Daniels broke away for 30 yards on the first play. The Rampwte got 17 from Timmy Moore on a fourto and five play at the Cardinal 32. Mocsre and Daniels mov^ in onward to the four for a first down, and Moare^-</p>
        <p>ried three times from there, bursting in from the one on the last play to cut it to 7-6 with 2:01 left in the third</p>
        <p>period.  ,</p>
        <p>But the PAT try went awry, leav-</p>
        <p>Roseapointshy  *11. _</p>
        <p>ille put itself into a deep hole when Rod McLean was call^ for grounding the ball, put^ the</p>
        <p>baUbackon^ four on thiitl down.</p>
        <p>yarasroum m^e. wun j^j^jit,jgxceUent position once</p>
        <p>again.</p>
        <p>But the Cardinal defense held them without a first down and took over withl0:141eftatthel9.</p>
        <p>With Elliot doing almost all of the ninning, the Car&amp;amp;ials took nearly stt minutes (rff the clock befwe Moore came up with the ball on EUiots fumble at the Rose 1(K Rose then came back down the field behind Moore and Daniels, reaching the 19, where on third down, Tom Moye tried to sneak for two and a first down, but failed to gain. Moore</p>
        <p>At 4t&amp;gt;iA K%A AffS fllA</p>
        <p>then tried to leap over the line on the ext play, Ixit feU an inch short. Moyes sneak was called,</p>
        <p>Looking For Room</p>
        <p>Rose High School fullback Dave Daniels (32) looks for ninning room behind his blockers during action Friday night against Jacksim-vllle in the second round of the 4-A state foot-</p>
        <p>George Mason Hopi^il^ Round Into Solid Teani</p>
        <p>Williams said. They were set up for a stunt and we knew theyd be keying on Timmy and Dave. We thought</p>
        <p>Tom could make it, but they filled the gap and stopped it.</p>
        <p>Moore finished the game with a season-hi^ 25 carries, picking up 131 yards. Daniels, on 18 carries, nad 140 yards for Rose.</p>
        <p>Elliot led Jacksimville with 190 yards on 31 carries.</p>
        <p>Experience could have been a big factor tonight, too, Williams said. Those guys (Jacksonville) have been in the playoffs every year. For our kids, it was the first time. But I plan on making it the first of many times for us.</p>
        <p>Im still awfully proud of our kids. They had a great season and no one can take that away from them.</p>
        <p>Jaduonville  Rose</p>
        <p>11........ First  Downs...................14  ,</p>
        <p>42-228..........Rushes-Yardage..........49-260</p>
        <p>0..................Passing  Yards..................22</p>
        <p>9...................Return  Yards...................7</p>
        <p>0-3- 0...................Passing...................3-8^</p>
        <p>4-28.3............Punts-Average .4-25.0</p>
        <p>2-2.................FumWes-Lost.................2-1</p>
        <p>M5.............Penalties-Yards.............4-20</p>
        <p>Jacksonville  0  0-7</p>
        <p>Rose....................................0  0  6  0-4</p>
        <p>45 run (Owens kick)</p>
        <p>RMoore, 1 run (pass failed)</p>
        <p>Individual SUtisUcs Rushing: J  Elliot 31-190, McLean 7-20, Booker 3-21, Hum|direy l-(-3); R  Smith</p>
        <p>1-1, Daniels 18-140, Moore 25-131, Barnhill K-U, Moye 3-(-5), Northern 1-4.</p>
        <p>Passing: J  McLean 0-3-04; R  Moye 344^22.</p>
        <p>Receiving: R - Mwris 1-7, Wilson 1-13, Daniels 1-2.</p>
        <p>By WOODY PEELE ' Reflechn-Spints Editor Cteorge Masons Patriots were thought of highly at the start of the 1986417 basketball season, but neyer matured into the type team expected of them.</p>
        <p>This year, they have a new coach in former Patriot assistant Rick Barnes, who spent the last couple of years at Ohio State as an aide, and the basis for a good vear is there if</p>
        <p>Barnes can Ixing it all U^ether.</p>
        <p>first cfiance as they opened the season in the Big Apple NIT, falling to Seton Hall, 85-63, in the first round.</p>
        <p>But, it gave Barnes a chance to see how his team will begin to faU into place.</p>
        <p>And he had to like what he saw from Earl Moore (64), Jr., G) and Kenny Sanders (6-5, Jr., F). Moore scored 24 mnnts to lead the Patriots while San(lers added 22.</p>
        <p>And while Barnes feels there is enthusiasm on the team this year, he notes that wont be enough.</p>
        <p>We will have our woik cut out for us to match last years record, he said.</p>
        <p>Sanders, an all-conferen&amp;lt; selec-ti(m last year, is the leader of the team, and there is a wealth of talent in tte backcourt. However, there is no mroven help for Sanders up front. If it comes through, the Patriots could be a team to be reckoned with in the Col(mial Athletic Association.</p>
        <p>Sancters averaged 17.9 points and pulled eight rebounds a game to lead the Patriots in both categories last seasim. But gone from the team is</p>
        <p>George Mason University</p>
        <p>1986417 Record: 15-13 CAA Record: 7-7 (fifth)</p>
        <p>Coach: Rick Barnes (1st year) Top Losses: Tracy Battle (12.4, 6-6), Mike Dufrene (7.4,5.6)</p>
        <p>Top Returnees: Kenny Sanders (6-5, F, 17.9, 8.0), Anthony Davis (5-10, G, 9.2,1.5), Earl Moore (64), G, 7.3,1.9)</p>
        <p>Top Newcomers: Danny Deane (6-6, F), Robert Dykes (6-7, F), Joe Lucas (6-8, C), Harold Westbrook (6-5 G/F), Mike White (5-9, F, redshirted last year). Projected Finish: Second</p>
        <p>front-court mate Tracy Battle (12.4 points, 6.6 rebounds) and Mike Dufrene (7.4,54.6).</p>
        <p>The backcourt should be stroi^ with the return of Amp Davis (5-10, Sr.), Moore, Darin Satterthwaite (6-3, Sr.) and Steve Smith (6-3, So.). Each of them started at one time or another last season.</p>
        <p>Challenging for playing time up front will be Henri Abrams (6-10, So.), the tallest on the team and Kevin McNamara (6-6, So.) Rookies Joe Lucas (6-8), Robert Dykes (6-7) and Danny Deane (6-6) will also draw long looks from Barnes and his staff. ?</p>
        <p>We will have to be competitive on the backboards in order toh^ make our up-tempo style of offense work, Barnes said. Of course, we will use an aggressive style of defense design^ to produce turnovers, steals</p>
        <p>and pocff riMt selectkm in an efSoil augment (kir reboundina skittj^ wont insult anyimes intelligenci minimiTing the importance o 9^. front line, but I wiO submit aggressive defoisive team make up for deficiencies in'</p>
        <p>Davis nudied third am&amp;lt; players in the country in riKwting last year. He made for a .536 percent! eight of nine against Patriot Cento last year.</p>
        <p>Moore, while scoring at a Upv pace last year, did not play at uD overall as he (fid as a fieshman Mg in pieseason seemed to show greMhr enthusiasm for this seasons pti^. Barnes feels he wiU be a floor Inkier for the Pats this time around.</p>
        <p>Satterthwaite stared U while Smith took the coisrtmU in a starteog nfie laM year. quickness and the ality to h#igt on the boards. Brian Miller,  64iHK ingman, started 14 games as a junl|r</p>
        <p>He slipped to 5 J pmnts a game aii junior afto a 10.1 year at "i freshman.  -</p>
        <p>If Barnes can come up with tiM right mixture on the coolkihs definitely feeto that the Pat move to a bighar levd in the fercnee thanunt yeit^ ^</p>
        <p>Well pter With both ends ahd an over the coiBk1n said. "*Evtey player who works tewp</p>
        <p>enthosialilliti rthecouitns</p>
        <p> ____,  vhowa</p>
        <p>wUl play. Tlibpe to use at players in every game, so everyme willhavetobeready.</p>
        <p>, Fateful Kick</p>
        <p>' Jacksonvilles Deke Owens (40) moves to kick the baU out of the hold of quarterback Rod McLean (12) early in Friday ' nights 4-A playoff game. The kick proved fateful when Rose  missed its PAT try and Jacksonville came away with a 7-6 vic- tory. (Reflector Photo by Cliff Hollis)</p>
        <p>HOME SCHEDULE</p>
        <p>(All games at Minges Coliseum)</p>
        <p>Nov. 28</p>
        <p>Longwood</p>
        <p>7:30</p>
        <p>Dec. 8</p>
        <p>Campbell</p>
        <p>7:30</p>
        <p>Dec. 12</p>
        <p>Va. Commonwealth 8:30</p>
        <p>Jan. 2</p>
        <p>Winthrop</p>
        <p>7:30</p>
        <p>Jan. 13</p>
        <p>South Carolina</p>
        <p>7:30</p>
        <p>Jan. 16</p>
        <p>*Navy</p>
        <p>8:30</p>
        <p>Jan. 18</p>
        <p>American ^</p>
        <p>7:30</p>
        <p>Jan. 27</p>
        <p>William &amp;amp;. Mary</p>
        <p>7:30</p>
        <p>Feb. 6</p>
        <p>George Mason</p>
        <p>7:30</p>
        <p>Feb. 8</p>
        <p>James Madison</p>
        <p>7:30</p>
        <p>Feb. 20</p>
        <p>Richmond</p>
        <p>7:30</p>
        <p>Feb. 22</p>
        <p>Atlantic Christian</p>
        <p>7:30</p>
        <p>Feb. 27</p>
        <p>UNC Wilmington</p>
        <p>7:30</p>
        <p>* (Colonial Athletic Association G)ntests.</p>
        <p>Doubleheader with Lady Pirates.</p>
        <p>BASKETBALL 1987-88</p>
        <p>PART OF THE ACTION!</p>
        <p>REGULAR SEASON HOME OPENER</p>
        <p>EAST CAROLINA</p>
        <p>vs.</p>
        <p>LONGWOOD</p>
        <p>(POSTER NIGHT)'</p>
        <p>Sponsored by State Farm Insurance</p>
        <p>Saturday, November 28 at 7:30 p.m.</p>
        <p>The 1987-88 edition o Pirate basketbtlltipfcoff regular season oni Satutdny November 28 at 7:30 p.m. in Minges Coliseum as East Carolina hosts the Long-wood Lancers. It will be poster night -- Pirate basketball schedule posters will be given away to the fbst 1,000, people to enter Minget Coliseum. Don't miss out on all o the Pirate hoop acrkm in 1^7-88. Call 757-6500 for your season tickets.</p>
        <p>I</p>
        <p>CALL 757.6500 TO ORDER YOUR SEASON TICKETS!</p>
        <p>(MASON TICKBT OEADUNE IS DacaMBBR 7.1</p>
        <p>Listen to ECU Basketball on the Pirate Sports Network (WDLX-FM-Ortginating Sution).</p>
        <p>i</p>
        <pb facs="00096780_0030" />
        <p>The Pally Reflector. Greenville. N.C._Sunday,  November  22.1967</p>
        <p>,30-13</p>
        <p>By TOM MORRIS Reflector Sports Writer LITTLEFIELD - The Ayden^rif-toD Chargers proved once again that the ttme of football is played on the field, and not OB paper where record and size advantages are often given too much wei^t &amp;lt;</p>
        <p>The Chargers handed undefeated Edentoo, the top ranked Eastern 2-A team, a 30-13 defeat Friday to advance into the third round of the state where they will take on 1 Plains Conference foe Nisrth</p>
        <p>, whom the Chargers tied for the ;tiae.</p>
        <p>**A lot of people sell our guys dtort,*' said Ayden-Grifton coach B.T. Chappell. AH year, theyve proven themselves winners. Weve got a lot (tf kids who are fightors. The odds have been against them all</p>
        <p>year."</p>
        <p>The Aces were the favored team,</p>
        <p>a decided size advance over the ^den-6rifton offensive linemen. Tk most yards the Aces had given up to (Hie team all year was 178.</p>
        <p>But Ayden-Grifton paid little attention to that statistic, totaling 227 yarcb rushing, led by Eric Blounts 126.</p>
        <p>Our gi^ did a great job of controlling the ball, Chappell said. (But) Edenton has a good team. I just dont think theyve played the competition we have. We only won nine games (against two loses heading into the game). They won 11. But we played some tough competi-</p>
        <p> &amp;lt;</p>
        <p>IVFGLJOHQN</p>
        <p>INSUViNCE&amp;amp;BONDS</p>
        <p>_ 758-1177</p>
        <p>Don McQlohon Don McOlohon. Jr.  iw w. i4ih  c.</p>
        <p>Mattamuskeet (km Club</p>
        <p>Bear, Deer, Ducks, Geese, Swan</p>
        <p>In excess of 25,000 acres of prime hunting property located adjacent to Mattamuskeet Refuge. 3,000 acre marsh on the Pamlico Sound. Exclusive lodging avaiiabto.</p>
        <p>Call Gregory C. Gibbs 919/925-4511 Days 919/925-9881 Nights</p>
        <p>tion. We' had some tough games. All ha^</p>
        <p>year weve worked ha The Chargers were methodical on offense, banging away f(Hir and five yards a pop. And it wasnt just Blount. FuUback Aaron Harper banged away for 63 yards on 13 carries and halfback Tony Reeves totaled 50 more.</p>
        <p>We had trouble running (earW (Ml) like we wanted to, C^ppeU said. Aaron Haqier opened up the outside with his inside power game. That made them play us honest.</p>
        <p>For Edenton, the offense never really got untracked. The Aces lost receiver Deitnm Felton (mi the inning kickpff with a thumb injury. He was their top receiver with a 13 touchdown recej^ons. He was also a starter on defense.</p>
        <p>That really put us in a bind. It took a lot out of our passing. We just put too much pressure on our defense, said Edenton coach Jay Swicegood. Offensively, we just didnt get anything started.</p>
        <p>The Aces led early, taking advantage (tf a fumble by Reeves that killed an early frst-quarter dbive by the Chargers.</p>
        <p>EdenUm UxA over following a 36-</p>
        <p>Here He Comes Agoin</p>
        <p>Ayden-Grifton running back Eric Blount (12) eyes the blocking as he makes a cut during action Friday night against Edenton. Teammate Michael Jackson (84) makes a block at</p>
        <p>left. Blount rushed for 126 yards and scored three touchdowns in leading the Chargers to a 30-13 victory in the second round 2-A playoff game. (Reflector Photo by Thomas Forrest)</p>
        <p>and that was their only score, he said.</p>
        <p>E(imiton tried to rally in the third quarter, driving to midfield on its initial second half possession before facim a fourtii and three at its own 47. Aces went for it but Hayes fumUed (m the {day and Ronnell Peterson recovered for the Chargers.</p>
        <p>Later, in retromect, Swicegood said it mi^t have been best to punt at that point.</p>
        <p>rard return by Lemont Phelps to ive a first and 10 at the Chafer 31. (Quarterback Erie Downing^oved</p>
        <p>After tal^ over, AydenGrifton quickly turned that miscue into points, scoring seven plays later on a 1-yard dive by quartorhaidi Darryl M(^e. Fullers kmk made it 16-7 with 2; 10 left in the third quarter.</p>
        <p>The Chargers added another score in the early part of the final period after Harper intercepted Dowmng at the SO. Seven plays later, Blount went leaping into the end zone after a five-yard jaunt. Fullers extra point made it 23-7 with 9:05 to go.</p>
        <p>On the Aces next drive.</p>
        <p>tte Aces into seining position with a 34-yard completion to Aaron Little. Enc Hayes later took it in from (Mie yard out f(Mr the sc(ve. Ben Millers kid(madeiC7-0.</p>
        <p>Ayden-Grifton struck back in the second quarter, taking advantage of a poor punt by the Aces. All night long, Edmiton refused to kick to Blount, a dangerous return man.</p>
        <p>Tte Chargers took over at the Aces 35 and quickly drove down the field, with Blount taking it in from four yards out. The two-point conversion run failed, leaving it 7-6.</p>
        <p>by a 43-yard completion to Robert Ranking. Five plays later. Downing scored on a keeper. The Aces went fix' two but failed, leaving the score at 23-13 with 5:25 to go.</p>
        <p>Edentoo went for the onsides kick, failed, but got a break when Harper fumbled giving Edenton new life.</p>
        <p>But it was shortlived. Blount in-tercqited Downing on the very mxt play and returned it 36 yards for his.</p>
        <p>Ayden-Grifton then got a break on a turnover as David Dixc</p>
        <p>Kon scooped a Downing fumble at the gers 37 and returning it 50 yards to the Aces 13.</p>
        <p>The Chargers could not move the ball any closer than the 10 so George Fidler came on and connected on a 27-yard field goal that just barely cleared the crossbar to make it 9-7.</p>
        <p>But despite the close score, Chap-peU said he felt good about his team^s perf(Nrmance in tlm first half.</p>
        <p>Individual Udm</p>
        <p>They had seven points at the half, but I told the guys that we had fumbled and they ha(l gotten that one pass</p>
        <p>Sj^x&amp;gt;r{smcuv ^iuv c Jackie'</p>
        <p>0^'</p>
        <p>STEEL SHOT COPPER PLATED SHOT 3* &amp;amp;2%' MAQ.</p>
        <p>CALLS - WHISTLES - LANYARDS REMINGTON CLOTHING WATERFOWL PARKAS &amp;amp; BIBS-WADER SOX GLOVES - SHIRTS - THERMAX</p>
        <p>FEDERAL QUAIL &amp;amp; RABBIT LOADS</p>
        <p>SPORTSMAN GUN &amp;amp; TACKLE CO.</p>
        <p>200 E. Qrawwlll* Blvd. Graamllla, NC 27050 (010) 3S&amp;amp;S000 *B09t handgun prtcaa In Pin Co. * Financing Avaiiabto.</p>
        <p>and the teams, final score of the ni^t. Fuller added the point after to make it 30-13.</p>
        <p>Last week, the Chargers rolled over Ahoskie, the number two team fitxn the N(Hlheastem Conference. The Aces were the champions of the</p>
        <p>NEAC. It left Chappell wondering.</p>
        <p>They were supposed to be the number one team in the East. Ahoskie was supposed to be the number two team, he said. I wonder where we are.</p>
        <p>GUNS &amp;amp; RIFLES</p>
        <p>WE LOAN CASH</p>
        <p>BUY-SELL-TRADE</p>
        <p>SOUTHERN GUN &amp;amp; PAWN INC.</p>
        <p>COGGINS CAR CARE</p>
        <p>320 W Greenville Blvd. Greenville, N.C. 756-5244</p>
        <p>NO MONEY DOWN' FINANCING AVAILABLE'</p>
        <p>752-2464</p>
        <p>No Monoy Down Financing!</p>
        <p>500 NoOh Greene St, Greenville</p>
        <p>Edeutou Heimet  Aydeu-Griftoo</p>
        <p>7....................First Downs....................m</p>
        <p>24-*7...........Rushei-Yardage...........56-227</p>
        <p>116.................Passi Yards.................8</p>
        <p>40..................RetumYsrdi..................82</p>
        <p>7-lM..................Pas^..................1-34)</p>
        <p>3-17.3............Punta-Average............2-20.5</p>
        <p>2-2.................Fumble8'Lo8t....j............3-2</p>
        <p>9-75 PenalUes-Yardi..; 6-56</p>
        <p>Edenlim............................7  0  6  9-13</p>
        <p>Ayden^rifton...................O  t  7  14-30</p>
        <p>Scoring:</p>
        <p>EHHayes 1 run (Miller kick)</p>
        <p>AG - Blount 4 run (run failed)</p>
        <p>AG-FGFiiUer27</p>
        <p>AGMoye 1 run (FiiUor kick)</p>
        <p>AGBlount 5 run (Fidter kick)</p>
        <p>EH - Downing, 2 run (pass faited)</p>
        <p>AG  Blount 36 intercepUon return (Fiillerkick)</p>
        <p>Rushing: AG - Blount 25-126. Harper</p>
        <p>  -----</p>
        <p>13&amp;lt;3, Reeves 11-50; E - McPherson L..</p>
        <p>Passing: E - Downing 7-19-2116; Moye 1-34)8</p>
        <p>Receiving: E-Aaron LitUe 2^4</p>
        <p>Boat Show</p>
        <p>S</p>
        <p>December 4,5, 6,1987</p>
        <p>The Largest "In The Water Boat Show"</p>
        <p>Ever Held In The Carolina's!</p>
        <p>S</p>
        <p>HARBOUR!</p>
        <p>o I</p>
        <p>MARINAVILLAGE</p>
        <p>s</p>
        <p>S</p>
        <p>*87</p>
        <p>In Cooperation With</p>
        <p>FM</p>
        <p>HIGHWAY 17 N. &amp;amp; INTRACOASTAL WATERWAY IN NORTH MYIjlTLE BEACH, S.C,</p>
        <p>rHHTt 74Q.KKKS  i  it</p>
        <p>m77727732aSl</p>
        <p>I</p>
        <pb facs="00096780_0031" />
        <p>Pantheris Top Come</p>
        <p>CLAYTON-If best teacher, North</p>
        <p>have been good students.</p>
        <p>After twice making it to the State 2-A football playoffs and getting knocked out of the running in ^ firi^ round, the now-experienced Pata thers are doing some knocking off of their own.</p>
        <p>Friday night, the Panthers eliminated Capital Area co-chaflip Clayton, 18-12, and advanced to the third round of play - where they will meet a familiar face - Ayden-Grif-tons Chargers.</p>
        <p>Michael Blow, Colli* Mullins and Reggie Daniels each scored touchdowns for the Panthers, while</p>
        <p> is the North Pitt wasted little time in get</p>
        <p>itts Panthers i ting on the scoreboard in the</p>
        <p>game, sconngon the opening driveof tlK contest. ^ Panthers toc^ the kik on their own 37 and drove in 12 lys for the tally. Blow did the scoring from 14 yards away.</p>
        <p>went only seven yardi to the Comet  yardi. Ashley Sheppard spnitW jhe</p>
        <p>35, where'North Pitt took over and  defense with 21 tackles, including</p>
        <p>took advantiM. Seven plays after  nineaolos.</p>
        <p>the kick, lA&amp;amp;s went final nine  The win boosts North Pttts record</p>
        <p>yaids to give the Panthers a 124 lead  to 8-3-1 while Clayton fmishes its year</p>
        <p>to take into the dressing rooms at in-  with a41-3 record.</p>
        <p>Quarterback Calvin Hunter picked up IS yards on one carry along the way. A two-point conversion try fell diort leaving it at 64.</p>
        <p>In the second period, the Comets  ,   ---------</p>
        <p>took over foUowing a North Pitt punt  finally yards. Once again, the PAT</p>
        <p>  J I!----J-----J---- hmiiiAver.</p>
        <p>termissiim.</p>
        <p>Clayton marched 76 yards foHow-ing the second haU kiduff to tie it once more at 12-12. The 16ilay drive, which included Thorpe runs &amp;lt;rf 17 and 14 yards, ended withnim taking it the</p>
        <p>North Pitt will be the host team f or the third round game on Fnday, entertaining the Chargers.</p>
        <p>North Pitt</p>
        <p>11...................First  Downs</p>
        <p>Clavlon</p>
        <p> ..... '  If,</p>
        <p>[e ,...46 212</p>
        <p>to the S-yard line and moved near</p>
        <p>i-yai-----------------</p>
        <p>midfield before Thorpe exploded m a</p>
        <p>liled.</p>
        <p>57-yard gallop to tie the ClayUms PAT attempt also wut-iiui/wiB tui uic raiiuicio, anditwaskiiottedat64.</p>
        <p>James Thorpe did all the scoring for Backed up to its own 28 later in the the Comets.  period, Clayton punted, but the ball</p>
        <p>Panthers took the kickoff and   runis-Averag*</p>
        <p>began a drive from their own 43,  3-1.................Fumbies-Lost</p>
        <p>Knights Open Year With Wins</p>
        <p>from where Hunter , hit Reggie Daniels on a 57-yard t pass for the game-winner.</p>
        <p>Clayton fought back and tried to get one more chance. The Comets drove to the Panther 20 before fmaUy</p>
        <p>3S-167 Rushes-Yarda</p>
        <p>75..................Passing  Yan-.......</p>
        <p>10...................Return  Yards..................0</p>
        <p>2-50..................Passing..................l-io-o</p>
        <p>^35.5 ^te-Average.:.....  i  3</p>
        <p>2-10</p>
        <p>545.............Penaltiea-Yards.</p>
        <p>.... 6 ...0 6</p>
        <p>North put...</p>
        <p>Clayton......</p>
        <p>Scoiing:</p>
        <p>NPBlow, 14 run (run failed)</p>
        <p>CThorpe, 57 run (kick failed) NPMullins,9run (run failed) CThoTDe, 4 run (kick failed)</p>
        <p>MERRY HILL - Greenville Christian Academy opened up the 1987-88 (basketball season with a pair of victories in the Lawrence Academy Invitational Tournament Friday night.</p>
        <p>Hie Lady Knights t(x a 5542 victory over Halifax Academy in their games, while the boys roljcia up a 78-51 win in their outing.</p>
        <p>The Knights indwd out into a 12-10 lead in the opening period, but then streaked away from Halifax in the second period, scoring 29 points while allowing 12. That left Greenville in command, 41-22, at intermissifm.</p>
        <p>The good second gnarter gave us a lead we could work with, Coach Date Thatcher said. ^And our running game wortied extremely well. We have 23 assists, which is a real iminessive figure for a first game.</p>
        <p>Greenville saw Halifax cut into the lead in the third j^od but still lead 55-39, as the final frame opened. In that, the Knights outhit Halifax, 23-12, to wrap up the win.</p>
        <p>Robin House led Greenville with 30 points while J(dm May added 22. Alan Hate led Halifax with 20 points.</p>
        <p>In the girl gain$, Greenville zoomed out to a 20-9 leu in the first period and coasted from there. Neither team made headway in the second period and the Lady Knights led, 31-20, at the half.</p>
        <p>During the third period, both ag^ matched points, with Greenville leading, 43-32, goii^ into the final frame. Greenville enjoyed a 12-10 margin in that to sew it tg&amp;gt;.</p>
        <p>We had a problem with tumovm until we got a lead to work with, Thatcher said. Our defense did a good job f(xr us too.</p>
        <p>Sandy Johnston led Greenville with 15 points while Jonie Cherry had 10 and Kim Faulkner and Myra Locklear each had 10. Halifax was</p>
        <p>Lawrence teams on Saturday night forthedmmpionships.</p>
        <p>35 seconds remaining in the footl game.</p>
        <p>North Pitt had the only other scoring (^portifflity in the game, moving to tltt 19 before fumblii^ it away.</p>
        <p>Thorpe led the Comet attack with 181 yante on 24 carries.</p>
        <p>North Pitts offense was led by Mullins, who carried 14 times for 102</p>
        <p>NP  iJaniels, 57 pass from Huater (kick foiled)</p>
        <p> /</p>
        <p>Ed Barrow never played in the big leagues but he managed the Detroit Tigers and Boston Red Sox, and later became the general manager of the NewYork Yankees.</p>
        <p>tedbyBobbieSmithwithl7.</p>
        <p>GCA was to play the hosting</p>
        <p>, GirbGame GREENVILLE (55)</p>
        <p>Johnston 7 (1) 04 15, Tripp 2Mt 4, Chorry 5 2-512, Faulkner 5 0-210, Lcklear</p>
        <p>HALIFAX (42)</p>
        <p>Lniiler S 0-16, Lewis 2 0-14, Sigth 81-2 17, Wdls 3 04 6, Respass 0 04 O^rown 3 OS 9, Vester 0 04 0, Inscue 0 04 0.?Totais It 4-742.</p>
        <p>Greenville..................:.20  11  12  12-55</p>
        <p>Banrax.........................9  11  .12  10-42</p>
        <p>Boys Game GREENVILLE (78)</p>
        <p>Dixon 11-3 3, May 10 24 22, Parker 4 0-1 8, Joyner 2 04 4, House 14 (2) 04 30, Hug-314 7, Leneave 2 04 4, Davidson 0 00 oT^th 0 04 0, Dobbs 0 00 0, Outlaw 0 04 0. Totals 36 (2) 4-10 78 HALIFAX (51)</p>
        <p>- Johnson 11-2 3, Hale 9 (1) 1-120, Barnes 3 04 9, Faucett  l  (1)  0-13, Cook 0 04 0,</p>
        <p>  Robertson 1(1)  04 3,  Taylor 114 3, Harris</p>
        <p>32-2 8, Griswold 1 04 2. Totals 20 (3) 8-13 51.</p>
        <p>,  Greenville....................12  29 14 23-78</p>
        <p>HaUfax........................10  12 17 12-51</p>
        <p>!</p>
        <p>Little League Elects Officers</p>
        <p>Gene Briley and Gi</p>
        <p>  _______</p>
        <p>vUte Little Leagues for the upcoming</p>
        <p>season in 1988.</p>
        <p>Officers were elected at a recent meeting of the leagues.</p>
        <p>Briley will head the North State League. Other North State officers selected included Jerry Clark, viceresident; Barbara Wing, secre-sry-treasurer; Shirley Herrin, imnens auxiliary president; and Mike Aldridge, safety officer.</p>
        <p>Devoe will lead the Tar Heel League. Others selected for the lea^ include John Stallings, vice-president; Joe Warren, secretary-Masurer; Beverly Owens, women s auxiliary president; and Emmett Walsh, safeU officer.</p>
        <p>Dan Gordon will again serve as commissioner and idayer agent.</p>
        <p>^0)tWBJ^UCEl&amp;lt;SE^</p>
        <p>K Advanc %AuioPafi</p>
        <p>OPEN THANKSGIVI</p>
        <p>9.98 2^ -2.00</p>
        <p>3SS</p>
        <p>2QaLCost MI9. Rebate</p>
        <p>Prestone Anti-Freeze</p>
        <p>3.99</p>
        <p>LIMIT 2</p>
        <p>Gallon</p>
        <p>Each Qalten AWir Mfg. Rebate With 2-Gal. Purchase</p>
        <p>Prf riGiimout</p>
        <p>Prestone Super Flush</p>
        <p>Ask About Our Radiator Quarantee From Presione w/Purchase Of 2 GaL Presione Advanced Formula And 1 Jug Presione Super Rush</p>
        <p>See Store Display PbrPelails_</p>
        <p>FREE</p>
        <p>AFTER MFOLReSATE</p>
        <p>p-V-</p>
        <p>Sale</p>
        <p>Price</p>
        <p>1</p>
        <p>.50</p>
        <p>a.</p>
        <p>-1</p>
        <p>.50</p>
        <p>Final</p>
        <p>Coal</p>
        <p>FREE</p>
        <p>carburetor Cleaner</p>
        <p>59</p>
        <p>4'</p>
        <p>.-</p>
        <p>*53</p>
        <p>ii</p>
        <p>iY</p>
        <p>F^ch'Mfg #7518(12 0z. Liqui^l</p>
        <p>HARD TO FIND BATTERIES - We've Got em</p>
        <p>Escort. Somerset. Cavalier. Aries. Toyota And Many JMore^</p>
        <p>Battery</p>
        <p>Each With Trade From 280 To 310 CCAs* ((k)ld Cranldng Amps)</p>
        <p>50-Month Battery</p>
        <p>39^95</p>
        <p>65-Moiith Battery</p>
        <p>49.95</p>
        <p>I-run.</p>
        <p>Heavy Duty Light Truck J|f.L Van Battery "</p>
        <p>59.9S</p>
        <p>^ Each With Trade,</p>
        <p>Each With Trade From 310 To 510 CCAs*</p>
        <p>Each With Trade</p>
        <p>From 425 To 570 CCAs*</p>
        <p>Weve Got It In Advance  Parts in</p>
        <p>INSTALl/T!-'</p>
        <p>ON MGS'' ^Ai ANGT</p>
        <p>Super Heatqf j| 750 CCA* w</p>
        <p>72-Month WbrranB3l</p>
        <p>all Apart!</p>
        <p>Heavy</p>
        <p>Duty</p>
        <p>Shocks</p>
        <p>8.88</p>
        <p>Each/1-13/16 ston QasMMIc</p>
        <p>Shocks...22.99Ea.</p>
        <p>rrrrf</p>
        <p>[2S0NumbtriAvaltobto</p>
        <p>[iSONumbmAvaMabla</p>
        <p>((3</p>
        <p>Radiators</p>
        <p>99.00</p>
        <p>Each</p>
        <p>Exch.</p>
        <p>Remanufactured</p>
        <p>Alternators oh Starters</p>
        <p>24.88</p>
        <p>Each Exch./$10 OFF SpMdal Orders vAllanwtor</p>
        <p>c</p>
        <p>Cei eHcL</p>
        <p>''</p>
        <p>mLS/i</p>
        <p>S</p>
        <p>HIToiwtoStoiartOrAllwnatomW/^</p>
        <p>Reguielofl................29.88  Each  Exch</p>
        <p>IIOOFFSptcWOrdm PcfltolPoin.eScat ^</p>
        <p>Hi JUnp ANamaion Or Startm w/Solenoids And SpicW Onlara $5 OF^^ mmi oomMttc Appttomons</p>
        <p>Off</p>
        <p>Brake Shoes Or NEW</p>
        <p>IIWWJL./I</p>
        <p>NUMBERS</p>
        <p>HfdyAlfwl</p>
        <p>Disc Brake, Pads</p>
        <p>1288</p>
        <p>Each /Lde Set Shoes With Exchange</p>
        <p>IWeiis</p>
        <p>CommiHonal</p>
        <p>I Distributor'</p>
        <p>,4.29..</p>
        <p>bmotoiw ipnNKlfl II.Mon no.. IK.</p>
        <p>Heater!</p>
        <p>Cores</p>
        <p>29.95</p>
        <p>Each Exch</p>
        <p>WLyM/MiL</p>
        <p>Weiis igniflon Coiis</p>
        <p>9.99</p>
        <p>Mfg. 9C16191M</p>
        <p>ForMortl</p>
        <p>Seaied Beam Buibs</p>
        <p>2.66</p>
        <p>STANT</p>
        <p>Halogen [,</p>
        <p>Bearn</p>
        <p>'3uibs</p>
        <p>Each/Mfg. 94000. 5001.6014 Mfg. #4651.4652  4.99  Each</p>
        <p>6.99</p>
        <p>Each/MQ *fh466 H4656 All Other Hatoflcn Bulbs S2 OFF</p>
        <p>[CuBloni</p>
        <p>64-Spoke</p>
        <p>Wire</p>
        <p>Wheei Covers</p>
        <p>7.88</p>
        <p>Each/13'. 14". 15"</p>
        <p>roHunivit</p>
        <p>ISftAWHQ</p>
        <p>Reversible Carpeted I Floor Mats</p>
        <p>Lug'</p>
        <p>zz:*z7</p>
        <p>Nuts</p>
        <p>3.99</p>
        <p>Each _  _  Reg.  4.99</p>
        <p>Mag Wheel</p>
        <p>Lug Niili.,. a... 7.99EKr&amp;lt;</p>
        <p> fl</p>
        <p>Shift impi Kit</p>
        <p>lUPIMOft</p>
        <p>U</p>
        <p>chieftain</p>
        <p>I</p>
        <p>24.99</p>
        <p>Each</p>
        <p>AM/FM Stereo CassettB W/5-Band Equallztr</p>
        <p>69.99</p>
        <p>Each/Mlg.&amp;lt;SR3IB</p>
        <p>High Power Deluxe Electronic fUne AM/FM Stereo CatwHe</p>
        <p>219.99</p>
        <p>29999</p>
        <p>Steering Wheei</p>
        <p>16.99</p>
        <p>Reg. 199/Mlg 6l</p>
        <p>LED</p>
        <p>Tachometer</p>
        <p>J.99</p>
        <p>&amp;gt;C I ',Cr.u.CT72</p>
        <p>0-u-u-gah</p>
        <p>Horn</p>
        <p>19.99</p>
        <p>Each/Reg. 25 99</p>
        <p>chit'lkun</p>
        <p>-mm</p>
        <p>3-Speed Ruck Shifter</p>
        <p>59.99</p>
        <p>Musical Car Horn</p>
        <p>29u</p>
        <p>Each/Reg 33.'.</p>
        <p>Fr!h)Mfr) Aflno.t</p>
        <p>j, -.Cl  ml  Qroer?</p>
        <p>Wheel Spinnoip</p>
        <p>20%</p>
        <p>Everyday L&amp;lt;3w I Rea. 14{</p>
        <p>OUlCKLY^gSSrtEO</p>
        <p> ...........ipiiiimiKMw</p>
        <p>HOURS: Monday  Saturday, 8 a.m. - 8 p.m., Sunday, 1 p.m. - 6 p.m.</p>
        <p>' 90Vm PARK 9IIOPPINO CENTIR</p>
        <p>IIS Red Banks Road 7S5-9S99</p>
        <pb facs="00096780_0032" />
        <p>10 TWPlyHrtltotof.Qinvin.N.C. Sunday. Novembef 22.1967Boots Need Extr</p>
        <p>Let Cliesifll Fid You Job</p>
        <p>ByBILLSCHULZ AssodateJPreu Writer NegtoctiiV huntng or hildn^</p>
        <p>is one way to ipiaraiitee a trip into the wUdemess wiU be at least uncomfortable, or at worst painftd.</p>
        <p>Outdoors</p>
        <p>Angela Ungerfelt</p>
        <p>Seafood Sales Are Down Seafood businesses in Greenville are losing money because people are afraid juJiftih, fjnfwh, crabs and shrimp may have come from areas con-taininatodby the **Nd tidealong NorthCandina^</p>
        <p>**We nornudly sell 30 to 40 bushels of oysters a week,said Tonya Sutton of Northside Seafood. We have only sold two bushels this week.</p>
        <p>Spokesinen for local seafood businesses say the pubhc has been misinformed about which seafood pro^ are safe to eat Only shellfish (oysters and clams) are affected 1^ a toxin caused from the red tide.</p>
        <p>Tiy sito are at lea^ percent off ewey day, said Wanda ----</p>
        <p>If your feet got you in, theyve got ^et you out, so keep them warm</p>
        <p>Nwmidly that recuires boots, and boots requiie special care.</p>
        <p>Ibeieharically are four kinds of boots, rubber, leather, fabric and leather-rubber pacs, which have</p>
        <p>That allows the leather to stretch to fit your particular set of walking</p>
        <p>m rwr yrtjCMhr</p>
        <p>owner</p>
        <p>rubber bottoms with leather uppers.</p>
        <p>Rubber boots are totally waterproof, unless damaged. Their drawback, however, is they dont allow body moisture to work its way out of the boot in warm weather or during heavy exertion. They need little care ac^ cleaning with water.</p>
        <p>Fabric boots can be kept waterproof with a silicooe spray. It wears off fairly quickW, and should be ap-d*ed often. If the remainder of the boot is leather, treat that leather the way a leather boot is treated. Rubber portions of the boot require cleaning.</p>
        <p>Leather boots require the most care.</p>
        <p>Buy good quality boots because cheap leather or workmanship will take its toll on your feet.</p>
        <p>Treat the leather uppers on combination pacs the same way you treat an aU-leather boot. The technique doends on the boot itself.</p>
        <p>Leather boots are made by punching holes in pieces of leathar and stit-</p>
        <p>of West End Seafood.*The media is d(gapoor job of mforming people wtot thw can and cant eat. I knew it was going to affect me sooner or later, but this is our livelihood. This is how we feed our kids. Were losing a great</p>
        <p>*MrNobS?S^hSl&amp;amp;ss islosing money because y^ fish away and seU it feter. You must seU perishabfe items right then. You cw</p>
        <p>redtidealgae.Shellfishinghasbeenbannedthere.</p>
        <p>Only glaiM and owtiors frmn vdme the red tide algae is located are affected. said Totv Sudar, district maoagw of the N.C. Oivfokm &amp;lt;rf Marine Fisheries office in Washington, N.C.lfs okay to einmK, ofabs and</p>
        <p>mm  tm  mm  m  mm</p>
        <p>' shrimp. I would eat them.</p>
        <p>said thg gian and nysters that seafood markets and restaurants are selling do not come from areas where the red tide is a problem.</p>
        <p>**We are patrolling tiie areas affected Iw the red tkle. Ehiforcmneid efforts are defeated to keying these oysters and clams off the maihet IdonttiiiiA</p>
        <p>the first trip out. Some people recommend putting on your new boots-ovgriwQ pair of socks, a light inner pair and a thick warm outer pair - and getting them good and wet Thai walk them dry.</p>
        <p>eeeewaeewe# frew  y  # ------ 0   _  IB  H</p>
        <p>wouM do to their reputation, Sholar said.Even now, oysters are b^</p>
        <p>Sholar said a toxin from the red tide algae is frequently encountered in IMda waters, b Florida, the toxin is known to accumulate in shellfish. Ingestion of a glam or oyster that contains the toxin can promxie gastrointestinal symptoms consisting of nausea, vomiting and diarrhea. ^ pie may also experience numbness and tingUna of the s^^ a pecu^</p>
        <p>MuiMtkn of tonperature revmal in vhich cola objects fed hot and hot objects feel cold.</p>
        <p>Experts in Florida have determined that it is safe to eat finfish, crabs and ^  1 from red tide waters based on scientific considerations concerning the " ' Idiffrenoesbetweenshellfishandfinfish.</p>
        <p>______ss, public misconceptioos have caused a drastic decline in</p>
        <p>busiiiessforGreenvilleseafoodsellers.</p>
        <p>The whole tUim in a nutshell is that shellfish are unavailable from the aitns affected^te red tide, said Carl Jordan of Evans Seafood. Some</p>
        <p> It get them dirty in this process. You can apply a coating of silicone calk to the seams on new boots tohebwaterproof them. If the seams are dsts th^ must be meticulously cleaned before calkiog.</p>
        <p>Some leather boofo are treated with silicooe waterproofing at the factory. This will wear off after use and the boots should be treated regularly.</p>
        <p>Untreated boots require treatment with a waterproofing conditioner.</p>
        <p>There are two types, those made of petroleum products and those made of beeswax, landin or fish oils.</p>
        <p>The trick is to protect the leather, not sofloi it to the print the boots wont stand up.</p>
        <p>With most preparations, its best to warm the boots a little. Put them by a hot air register, or in an oven thats tuiiied oC^ bas a little heat in it and warm the leather until the boots feel slightly warm to the touch, about 120 desees.</p>
        <p>Then, using a clean rag, rub the conditioner into the leather. Dont ow^ it. Use only the amount of conditioner the leather will absorb. After treating you can use a hair dryer to continue warming the boots to absorb the conditioner.</p>
        <p>Wipe off any excess and let the boots dry.</p>
        <p>Even the best leather boots are not totally waterproof. But thiy will keep you d^ under most conditions, if you care for them and dont try to make them do a job designed for waders.</p>
        <p>IRRIGATION SPECIALIST</p>
        <p>RESIDEiniAL-COMMERCIAL-RECREATIONAL-FAIM</p>
        <p>NIE ESTIMATES ;</p>
        <p>OVER 40 YEARS CUSTOMER SATISFACTION</p>
        <p>HNDRXHBARNHILL CO.*</p>
        <p>GREENVILLE, N.C.  ^  919-752-4122</p>
        <p>CALL TOLL FREE 1-800434-9360  r</p>
        <p>r.i</p>
        <p>people thiiriLitsin the fish, too. Peoplebearshellfishand think of all seafood. Ihite to takea loss caured frnm misunderstandings.</p>
        <p>. BiR Jordan, and other Greenvilfeseafoodnuurket owners, are losingmoney.</p>
        <p>Its Ukeadeprmsion around here,he said. Sales are over half off.</p>
        <p>FWhermore, seafood retailers are worried about oyster sales during the Tlmisgiviie holidays. DuriiM that time, they normally sell healthy amounts tobeusedinoysterstuffingsfri-Tlianktvingtu^.</p>
        <p>UsuaUy, we sen aroundW bushete of oystors during the Thanksgivmg hoh-days.lhaventsoldl5bushelsyet,Jordancoinmentod.</p>
        <p>At West End Seafood, only two smaU orders for oysters have been made for Tlmnfa^iving. The story is tiie same at Northside Seafood.</p>
        <p>Most of the qysteis these businesses are trying to seU have come from Virginia or Louisiana, Bb. Nobles said.</p>
        <p>People have a whole lot of questions about where the oystere and certain fish, like spot and flounder, are coining bom. Some people are pretty rude. They are vesy skeptical, said Ms. Sutton.</p>
        <p>CiBtoiners have been calling frequently at West End Seafood to find out the</p>
        <p>origin of the seafood there.</p>
        <p>Were getting a lot of pressure and phone calls. Its not only affecting us fi-nncially,birtmentalIy.irsastressfulsituatio^^^</p>
        <p>At Greenville seafood restaurants, sales are only slishtly down. Owners say peo^ are curious about the red tide, but they are stiu eating at seafood res-</p>
        <p>People are concerned, of course, with so much daily publicity, said Sam Jones, owner of Riverside Oyster Bar. We have seen a small decline in business, especially at the oyster bar, but its not drastic. I dont Uame customers for being concerned because I would be the same way.</p>
        <p>At Fosdicks 1890 Seafood ResUurant, business is steady, but a sign is poM outside saying that its oysters are not from red tide areas.</p>
        <p>Experts are not sure when the red tide may dissipate along the states coastline, but they are hoping it win be soon.</p>
        <p>Its hard to say whats ariim to hapnen, weatiier conditions wUl he^Jiueviate me proMmn. But it wiU take several</p>
        <p>weeks after the red tide goes away before oysters and clams in those areas can be bought and sold again.</p>
        <p>HELD OVER FOR 3 BIG DAYSSALE ENDS WED- NOVi 25TH i</p>
        <p>WAS</p>
        <p>T P.Llllwh *!** gg.</p>
        <p>M360.00</p>
        <p>n 119.81</p>
        <p>6Sets</p>
        <p>*688.00 *777.00</p>
        <p>Many more items to choose fromi Not all are listed...</p>
        <p>11</p>
        <p>M9.94 M9.W</p>
        <p>25* Coesofe Color TV (Fri-f8^)</p>
        <p>LimE RED WAGONS!</p>
        <p>Wovo got thorn.</p>
        <p>All Sizes</p>
        <p>inw. rifiiin-* *r*</p>
        <p>l,,lw.i4INdMW-lwwJ;j^</p>
        <p>;fC.Swll&amp;gt;lWHllgg*l</p>
        <p>1.4 tmmi fkmft </p>
        <p>M99.W</p>
        <p>MW.W</p>
        <p>*99.00.. *497</p>
        <p>jm</p>
        <p>*34l00</p>
        <p>FI7</p>
        <p>TURKEY</p>
        <p>With Purchase Of</p>
        <p>*199</p>
        <p>OR MORE!</p>
        <p>49.W</p>
        <p>.s / *278.00 *88.00 79.W  *39.97,</p>
        <p>..W.99 jmM.</p>
        <p>Many items</p>
        <p>hlirtrited In uantity and subject to prior sale...</p>
        <p>Istome, Utsersedh</p>
        <p>IhyewiOreifi^^</p>
        <p>n 199.00</p>
        <p>Curia Cdbfest - fstm (ftjjg)</p>
        <p>599.99</p>
        <p>WM*</p>
        <p>*888.00 *377.00 *68100</p>
        <p>iiu.</p>
        <p>LimE</p>
        <p>Lay4Miy Now For ChrislinMl</p>
        <p>TURKEY</p>
        <p>With Purchase Of</p>
        <p>$199</p>
        <p>taUM</p>
        <p>7W.00</p>
        <p>wesiwr</p>
        <p>Or More!</p>
        <p>(feaae Aium Ps^'</p>
        <p>*388.00 *198.00 *168.00 ^ *58.00</p>
        <p>MOM.W</p>
        <p>10</p>
        <p>3.00</p>
        <p>*148.00</p>
        <p>2588J)0</p>
        <p>)148.00,</p>
        <p>lwiMlllw*wW **********</p>
        <p>UW.W / ^99.00i</p>
        <p>opM iiMSiy SIM Mim MS ojs. w eas pA iWwiw MS OJR. W MS *.VANS HARDWARE,</p>
        <p>QARDEN SUPPLmS AND l/KmHOIimSU&amp;gt;PUESmiaxwell</p>
        <p>FURNITURE604 Greenville Blvd.</p>
        <p>(Kroger Shoppliig Center)Phone 756-3142</p>
        <p>fMON.OfMM8L</p>
        <p>7684420HNANCING</p>
        <p>I' *</p>
        <p>I</p>
        <p>I</p>
        <pb facs="00096780_0033" />
        <p>Zambezi Trip 1$ Fantasy</p>
        <p>the enemy, er  keM paddlers them task mcM</p>
        <p>ByJOANMOWER Aisociated Press Writer , KARIBA, ZIMBABWE (AP) - If i&amp;lt;iiir idea of a greet vacation is a lek at the Hotel Ritz in Paris or a snn-drenched weekend at a Jamaican resort, dont take a canoeing safari on the Zambezi River.</p>
        <p>Ton the other hand, if youre thi .  .</p>
        <p>need to escape the Office routine and"^ your secret fantasy is be like Mtharine Hepim in The African Qaeen,thisisthetripforyou.</p>
        <p>Outdoor News</p>
        <p>or a colony of hundreds of brilliant carmine bee^ters fly en masse from boles on 12-foot high mud em-mkments.</p>
        <p>And thats not all. Paddlers on the Zambezi  particularly in the dry</p>
        <p>man-made lakes. When the land was flooded in the late 1950s, 5,000 animals woe moved to safety in the world-famous Operation Noah.</p>
        <p>Although previous canoeing experience is not mandatory, it helps to be</p>
        <p>'OoudMiotatoes, read no further. The back-fieat of a Land Rover fs yourbestbet.  ^</p>
        <p>Paddling down the Zambezi for six diin a two-man, 30(H[XHind canoe is lard work, particularly for those</p>
        <p>wiiundevelopedbackmuscles. e 10-foot-long crocffies slidisr</p>
        <p>jr -  -  -  -</p>
        <p>0 September and Octobw in good physical shag and bww how iSilieaSneod water-can to steer a canoe, there are, some ^ warthog, kudu, nyala, bushbuck, dand, waterbuck, impala, honey badger, spotted hyena, jackets, baboon, vervet monkeys, bushbabies and bush squirrels.</p>
        <p>thTSlttaStrtS dericestopr^</p>
        <p>Ul 9HCC1 a MUMC. Atmv uv,.wmAv</p>
        <p>other iron-clad requirmnents: participants must take anti-malaria pills and sign a waiver fwm.</p>
        <p>The boats, usuaUy four per trip, are loaded with caminng gear, food and wine and equipped with flotation event mem 1</p>
        <p>the enemy, even though wind can _,J8 cod as weU as make more difficult. To prevent sunburn, its vital to carry sunglasses, a hat, a longHileeved shirt, clothes to cover the legi and cream.</p>
        <p>At least twice a day, paddlers wiU</p>
        <p>stop the canoes in shallow water, and surv^ the area for crocodiles bdore taking a swim or spongelath.</p>
        <p>Paddlers must be off the river by 6 p.m. umler Zimbabwes curfew, ainwd at preventing poachers frrnn  EtMwater.</p>
        <p>  campsites are usuay on</p>
        <p>sandy islands or beadies. Mmnbmrs d the groiq) are encoiuwged to put their camp</p>
        <p>sleeping bam and &amp;gt;ar one another in</p>
        <p>the bank. Blammoth elephants ^oat the punde hyacinth on the ri^s edge, 40 m from boaters. </p>
        <p>. pt the eanbdkf quickly forgets pwsical discomfort and danger in o^ of the most spectacular wildlife ands in the world.  </p>
        <p>AJnangy lion appears forbiddiigly m the horizon; a snorting hippo gasping for air raises its headand yawns; aherd of buffalo with curlicue horns moves in slow-motion across a plain;</p>
        <p>Woman Joins Man's W(^</p>
        <p>pmiXBAAB Ihe Augusta Chronicle AUGUSTA, Ga. (AP) - When Patricia Hmidrix tossed out her first hire in the U.S. BASS Eastern Region Draw Tournament on Clarks Hill Lake she was alone ina mans world.</p>
        <p>T dont feel intimidated at all, said the 45-year-old Greenville, S.C., busineswoman. *T want to project my image as that d anotim* professional fisherman and I ctainly didnt expect, or want, to be treated any differently just b^use I am a wmnan.  *</p>
        <p>She says she has been headstrong and independent all! my life, and has loved competition since her prep basketball-playing days at Hillcrest HighmSimpsonville,S.C.</p>
        <p>She and her husband, Bill, operate Hendrixs Dog Pa^, a store in Greenville that handles hunting and fishing equipment and dog supplies, iifiiAr&amp;gt;h&amp;lt;&amp;gt;igflhonkkeepe*</p>
        <p>Weve been married for 27 years and my husband is very supportive. Hes got the same kind d love for huntiitt that I have for fishing. If it</p>
        <p>toomament fis^  we said.</p>
        <p>He stays h(ne and balqrrits thrm</p>
        <p>The scenery changes constantly, from the deep gorge where every cry d fish hawk reverberates, to the open plains dotted with bunng-bush acacias, baobabs and mahogany</p>
        <p>Hie vegetation and the wildlife are awe-inspiring. Magic, is the wind some resort to.</p>
        <p>The Zambezi, Africas four</p>
        <p>mosquito nets near-------</p>
        <p>case an errant dephant or buffalo wanders iniio the group.</p>
        <p>By 7 p.m., after nearly 14 hours on the rivar, the jne-codcfd but heated venison stew or chicken piri piri wadied down by local white wine tastes delicious.</p>
        <p>After recounting the days adventures, the charge by Henry, the hip-</p>
        <p>lidvantage d S o momigs and tte.hKlantwUdlif..tto"iSe&amp;lt;rf</p>
        <p>from tipping over into' the crocodile-infested waters. A typical party includes a guide and seven tourists, life on the water falls into a calm-routine, starting with a wake-up</p>
        <p> at about 5:30 a.m. After a small</p>
        <p>snack of tea and biscuits, canoeists paddle for about three hours t take</p>
        <p>NOW OPEN!</p>
        <p>Bhhi</p>
        <p>4*</p>
        <p>.55</p>
        <p>MNLOmQ MATBUAL8</p>
        <p>hMutatlon</p>
        <p>WMom</p>
        <p>PaSeOoort</p>
        <p>ConcralaPlpa</p>
        <p>Pool CtMMloato</p>
        <p>MOoora</p>
        <p>AeeoMOoort</p>
        <p>Amivts</p>
        <p>Cewrolo Hope MioPwwra MMOwy CoaSnQt Mortar Ms</p>
        <p>Products</p>
        <p>COMRWV</p>
        <p>COME SEE US AT OUR NEW LOCATION</p>
        <p>309 HOOKER ROAD, GREENVILLE Phone 355-7258</p>
        <p>Breakfast, usually eggs, sausages,  ........  _   toast,  coffee  cooked  on  a  camping</p>
        <p>thaiiesrrivw,'t*CTbe^</p>
        <p>ZambUiandZimbabwe,probablyha8</p>
        <p>about three hours bdore lunch, often taking *ieg over breaks vriiere (me</p>
        <p>d Africa, the cry d the jackel, the pitter-patter d buffalo hooves, the screaming numkey and the roar d the lion.</p>
        <p>EDITORS NOTE - Canoeing Safaris, Box 2997, Harare, Zimbabwe is one group that organizes the trips. Telejiione firom the United States; 011-0-263-721340. The cost ranges</p>
        <p>Zimbabwe and en()s at the Indian</p>
        <p>oriiinate  from  ea(*  reMelauilS  romb'Su.S.perpers(l</p>
        <p>Pott^boatbya^ndtteress* thr,da,sandtwonitoWU</p>
        <p>mitai from Zimbabwes capital. fbMtfor-abreast.withioiiepaddl- for nine days and eighj idgM;. Tte</p>
        <p>Harare - on the shores d Lake Kariba, one d tim worlds biggest</p>
        <p>ing.</p>
        <p>As the suns rises, the rays become</p>
        <p>trip of six days about $337 U.S.</p>
        <p>Radio /haek</p>
        <p>A DIVISION Of TANDY CORPORATION</p>
        <p>vffh HQ and Remote</p>
        <p>Model 19 by Realistic  SflVO</p>
        <p>&amp;gt;61</p>
        <p>PC-Compatible Tandy 1000 HX</p>
        <p>ire *100 599^</p>
        <p>toy poodles, a parrot who imitates his wOdtiirkey pr^ce calls and Bo^ yM. mio. who loves</p>
        <p>The co^le also has a 24-year-dd son, Ron, wtm Bilges in Jacksonville, Fla.  I</p>
        <p>Whife she has to fishing for fun for more than 35 years, Hendrix was hooked on competitive bass fis^ just two years ago when she com-4 (to in oMdSto FerrisBassn Gal events on th^ Johns River in Florida.</p>
        <p>I had fished s(ime local dub bass todrnaments, butlfhejr werent aqy-thing like what encountered m norida, Hendiii to during an in-teitor. 1 finitoUth a^ wound up*^completd^lMked. I abo found ouf that I d nd have the right eqdpment to fish that circuit properly sol took the rest d the year df.^ fte first tung she did was to start accumulating tte right (</p>
        <p>Last year, she comp' thORedManCtoim natnents and placeiT Norman on Mothers ; wleadii,the big fish .  but someon weighed in</p>
        <p>H on the last dy.</p>
        <p>Too ba(f. I could .. money to;p^</p>
        <p>Picture-perfect gift! HQ system for sharper picture. Quick-Timer re-cording. 14-day/6-event timer.  [</p>
        <p>#16-508 Remote batteries extra  V2LL-&amp;lt;</p>
        <p>288</p>
        <p>Reg. 349.95</p>
        <p>Low As $15 Per Month.</p>
        <p>Reg. 699.00</p>
        <p>Low Aa $30 Par Month*</p>
        <p>The easiest-t(HJse IBM PC compatible ever! Built-in MS-DOSjust power and run. 720K 3'k" disk drive With Personal DeskMate'" 2 software. #25-1053 Monitor extra</p>
        <p>IBM/Rag TM IBM Corp. MS-OOS/TM Microsoft Corp.</p>
        <p>With CM-5 Save Color Monitor *150</p>
        <p>Tandy</p>
        <p>1000</p>
        <p>HX</p>
        <p>848&amp;lt;s</p>
        <p>25-1053</p>
        <p>25-1023</p>
        <p>Lew As $43 Par Month*</p>
        <p>Reg. Separate Iteiwe 998.95</p>
        <p>ooTVj</p>
        <p>2-Way Speaker System</p>
        <p>Nova-15 by Realistic</p>
        <p>half PRICE</p>
        <p>Get two for the regular price of one! Big 8" long-throw woofer, 2fe tvtoer. Genuine oiled-walnut finish. 19" high. #404034</p>
        <p>Dot-Matrix Printer</p>
        <p>DMP130A by Tandy</p>
        <p>Save 11Q</p>
        <p>24995</p>
        <p>Reg. 359.95</p>
        <p>Low As $15 Par Month*</p>
        <p>IBM PC compatible! Prints 120 cps. Word, data-processing and graphics modes. With tractor. #26-1280  -</p>
        <p>128K Color Computer 3</p>
        <p>10095</p>
        <p>Save</p>
        <p>70 Reg. 199.95</p>
        <p>Low As $15 Par Month.</p>
        <p>Start computing today! Built-in Extended rar^ BASIC. Attaches to any TV. #26-3334</p>
        <p>FD-502 Color Thinline Disk #0</p>
        <p>Save MQ95  29-s</p>
        <p>80  "^26-3133  Low  Aa  $15  Par  Month.</p>
        <p>one</p>
        <p>used the</p>
        <p>my way into ou ^doppedoff at^tee^kxiper</p>
        <p>fish a Red! Man at route to k Bassn .Gal touniw oi FktoitaliOkeechobee. Iddni dace at ShtoiMt I flntotol</p>
        <p>Ihb year, she competed in all the Bassn Gal tournaments, thanks mainly to my major paying nion-mt, Jim Dobbs Pontiac^rMC; in Greenville. Before he started paying</p>
        <p>-rr-*"</p>
        <p>10'</p>
        <p>Cordless Phone 30* Off</p>
        <p>ET-396 by Radio Shack</p>
        <p>Save *30</p>
        <p>as</p>
        <p>seen on TV</p>
        <p>L95</p>
        <p>PefBonal Phone</p>
        <p>ET-120 by Radio Shack</p>
        <p>Buy one to give and one to keep! Make</p>
        <p>or to calls around the house without</p>
        <p>cords. Switchable Touch-Tone/pulse dialing. #43^7</p>
        <p>AM/FM Stereo</p>
        <p>Stereo Rack System With Remote</p>
        <p>System 1000 by FteaBslie  Lo.utx</p>
        <p>Cut &amp;lt;300 oB9SBr</p>
        <p>31-113(1/40-113042-1130  Shown with optional CO piayar</p>
        <p> SA1000100 to* to  TM-1000 Dililal Tumt</p>
        <p> Optbiiiia-10003-toS|Makafs  Ramoli Coto</p>
        <p> B1-1Q00 7-Band EquaHzar  SGT-1000 Dual Ctoli</p>
        <p> LiUi-m Tunto  Dahin Glan-Door Audio Rack</p>
        <p>Get 10^ off our CD-2300 CD player (#42-5006, Reg. 219.95) when purchased with System 1000</p>
        <p>IMN WMti P$r ClMiMl, MiEbmiin RMS lalo 8 Ohiiii Fimb 18-a.BII Hi WWi N9 Mtw TImm 8.01 TND</p>
        <p>m</p>
        <p>my expenaes, 1 picked up my own fob. btact, be pdd my en^ fee into thb tournament - my flnt U.S. BASSevent.</p>
        <p>Since fi^</p>
        <p>SThS</p>
        <p>BASSevent.</p>
        <p>Since fishinu the mostly men Unv-</p>
        <p> . U.S.</p>
        <p> , [toshesneverhida</p>
        <p>INdtlem with her boat partfMrs*</p>
        <p>Cutas*</p>
        <p>12</p>
        <p>Reg. 19.95</p>
        <p>Touch-redlal. Pulse dialing.</p>
        <p>White, #43^ Brown, #43-502</p>
        <p>Clock Radio</p>
        <p>Chronomatic-251 by Realistic</p>
        <p>Six-Band Portable Radio</p>
        <p>Patrolman SW-60 By Realistic</p>
        <p>Save *40</p>
        <p>CB With Channel 9 Priority</p>
        <p>TRC-474 by Realistic</p>
        <p>Save*60</p>
        <p>Cut</p>
        <p>36%</p>
        <p>Dual alarms, big 0.6' play. #12-1550</p>
        <p>,49.95</p>
        <p>LEDdls-</p>
        <p>Reg. 99.95</p>
        <p>Reg. 139.95</p>
        <p>BatlartM</p>
        <p>xtra</p>
        <p>Like having your own 24-hour news bureau! Hear 5-18 MHz shortwave, VHP/ UHF, police, air, PM and AM. #12-779</p>
        <p>Give your whole family fun and security whHe driving. Instant switching to Emergency Ch. 9 for highway help in a hurry. #21-1539</p>
        <p>FERGUSON</p>
        <p>MQillm/WamL.,</p>
        <p>  i</p>
        <p>KOHLER Ptumbtn^ Praduets</p>
        <p>8011 South Memortel Drive</p>
        <p>756-6101</p>
        <p>Viilt Our RBB8TERED Showroom</p>
        <p>' n</p>
        <p>Dual-Powered Calculator</p>
        <p>EC-417 by Radio Shack</p>
        <p>Cut 41%</p>
        <p>Solar/battery power. #65-562</p>
        <p>AM/FM stereo Headset</p>
        <p>STEREO-MATE by ReaHsbc</p>
        <p>42%</p>
        <p>Off</p>
        <p>Weighs only 6^ ounces with batteries. #12-125 Batteries extra</p>
        <p>I Electronic Melody-Malcer</p>
        <p>Off</p>
        <p>4495</p>
        <p>Concertmate-3(X) by Realistic</p>
        <p>^rr</p>
        <p>liAlJLUJlUUU</p>
        <p>Reg. 49.95</p>
        <p>Four preset tones, 1(X&amp;gt;HiX&amp;gt;te memory. #42-4003 Batttrioa extra</p>
        <p>Electric Pencil Sharpener</p>
        <p>SPKULFWnUK</p>
        <p>with extra btades. #61-2796</p>
        <p>Batiarioa extra</p>
        <p>Check Your Phone Book for the RadWihaeH Store or Dealer Nearest You</p>
        <p>'SWITCHABLE TOUCH-TONE/PULSE plwnss work on bott tone and pulse Imes There^.^    do</p>
        <p>vicas requiring tones, like the new long-distance sywi and computeruad services PULSE-SIGNALING phories work on both rolary (kal and tone hnes, bul do not produce tones. FCC registered Not for party meo. We service what we sell</p>
        <p>Radio Shack rivoMng credit Payment may vary dependng upon account balanca^_</p>
        <p>Moot Mpior Crwdtt Cards Aeeoptod</p>
        <p>rwcaa aptvv at mnTiciPATiNo stows am&amp;gt; oe Auns</p>
        <p>i</p>
        <pb facs="00096780_0034" />
        <p>^2 Tjw Pity ttoftootor. Qwnvllle. N.C.  Sunday. November 22.1967</p>
        <p>TANK IFNANARiT</p>
        <p>by Jeff Millar &amp;amp; Bill Mndt</p>
        <p>HaaiCMlMeBaikctbal</p>
        <p>SmttfaU^IKnvilleM hrin-Wallaoe n, GreeM</p>
        <p>n, Greenaboro ^  70,  Frauda  Marion</p>
        <p>5;sffiair "</p>
        <p>Bdtacombe (M) at Tarboro WUbains (iM) at Aababero</p>
        <p>ss^'wsr^</p>
        <p>WiiifBlaM^AverattOS</p>
        <p>(tIKS)</p>
        <p>UBeofaHaa (M) at W. CaldweU</p>
        <p>N. c.</p>
        <p>Erwin (M) at Shdby (il-l)</p>
        <p>L.........J5H  m</p>
        <p>JS  15</p>
        <p>..J5  15</p>
        <p> .............J  16</p>
        <p>L................Al  16</p>
        <p>wanjjyHwiaing...........ja  i</p>
        <p>
        </p>
        <p>..JO  10</p>
        <p>.17  13</p>
        <p>.16  M</p>
        <p>MI</p>
        <p>L 15</p>
        <p> li  isti</p>
        <p>t. 14  16</p>
        <p>...................14  M</p>
        <p>asffi</p>
        <p>lar-ICbaetySebaab</p>
        <p>..JO 11 ..Jl U -.10  .. 10 ..U  15</p>
        <p>Pacific Dtviflaa Laken 8 o 1.000 -4 4 .500 4 3 5 .375 5</p>
        <p> _____3  5  .375  5</p>
        <p>Portland  3  5  .375  5</p>
        <p>GoUen SUte  1  6  .111  7%</p>
        <p>FddayiGaBca</p>
        <p>iWUKImMliB 11$, BOStOPoS CUcai^HAtUnUOl Denver 156, San Antonio 141 Utah 111, Indiana 81 LaoAnfldesOippera lll,Phoeaix</p>
        <p>Loa Angeles Lakm 119, DaOaa 116 Portland 110, Wasbiitoa 101 Seattle 90, MSlwnitoe87 SatardavaGaaMS Boatonat New Jersm, 7:30 pjn.</p>
        <p>pjn.</p>
        <p>Golden SUte at New York, 6:30</p>
        <p>p.m.</p>
        <p>esa</p>
        <p>Detroit at Chicago, 0:10pja. UUhatSanAntoe3o,8:3D^^ Denver at Loa Aigelee CHpiiera,</p>
        <p>tTLStAndrewiit -amOoncoi^llieh.S7 il7,Albany,Ga.7l M*nandillailenS5 t MIDWEST</p>
        <p>..SH _</p>
        <p>pnaa4)mSial04,KeangSt8t</p>
        <p>MB.-8kntnJnte45</p>
        <p>SOUTBWESr</p>
        <p>i 76, N.C. Central</p>
        <p>AydewGrifUa (104) at N. PMt &amp;lt;0-</p>
        <p>*-^dUville.</p>
        <p>1).</p>
        <p>IhotnaavOle (114) at Lexington</p>
        <p>MOOIr-IU|yil66B, N$wbeiTy 5</p>
        <p>(U^)tE.DppllB(ll-</p>
        <p>Pliila.mannae797,Wilkiall</p>
        <p>Yort,Pa.LGaSwdSn</p>
        <p>WhioMr tarHataai nntRaand</p>
        <p>7.GreeBlUac6 16.GaatAalibitMkl3 ^jnaGMlfiiaaO Ce. a. Lee Oo. 6 35, wilm New Hanover</p>
        <p>mu (U l) at Bit Airy (10-</p>
        <p>l-A</p>
        <p>itoa-Weat (114) at Cal-</p>
        <p>GbofMinaley 10, GboPage? ^Eprin 1^ nliU4^pin^</p>
        <p>hss^m,</p>
        <p>7,Bae3</p>
        <p>i(7-S)atSWOulow(10-(IM) at E. Mon-</p>
        <p>Wea^CaB^eOeybaO</p>
        <p>ham^ef.</p>
        <p>ggggpnweM5m5.10, ,^JaelaiHiviIle df. S. AUbama 14.</p>
        <p>Crollna-</p>
        <p>ChuSSelou, 15-11,15-11</p>
        <p>154</p>
        <p>Candna-</p>
        <p>DatMurphydM). _</p>
        <p>Ba^K,WeatCheiter7S</p>
        <p>SBSS</p>
        <p>"S^^gs.</p>
        <p>IhraakKatLoaAiveieB</p>
        <p>I n. Wltaia 36 14 7,</p>
        <p>HDwanheeat</p>
        <p>10:30ein. ladb at Portland, 16:30p.m.</p>
        <p>iSBa&amp;gt;^"</p>
        <p>^ vsvyr""</p>
        <p>l^jgaig</p>
        <p>aUlI</p>
        <p>lUttanabK</p>
        <p>IbpGme.  S la</p>
        <p>National Traaamia</p>
        <p>'^aasa.'''</p>
        <p>i </p>
        <p>ofAmirieai Ya|aalavia,BaBSt</p>
        <p>l</p>
        <p>o o</p>
        <p>muniiimi</p>
        <p>KOBIEMS</p>
        <p>E O</p>
        <p>Bladen 7</p>
        <p>52 &amp;gt;s</p>
        <p>.fe-8</p>
        <p>'AransadhM</p>
        <p>1-A ,8walnCo.6 ra,N,lloanM</p>
        <p>Oy IW Aiiiriatil Prm</p>
        <p>AWriAIA</p>
        <p>Walt</p>
        <p>J}</p>
        <p>E</p>
        <p>Z</p>
        <p>&amp;lt; X</p>
        <p>24 HOUR SERVICE</p>
        <p>7S2-366I</p>
        <p>tcSiun Pottaxd and &amp;lt;Son</p>
        <p>NDMA PU&amp;gt;/eivJG PRODUCTS</p>
        <p>400 WEST 10TH STREET QREENVILLE. N.C.</p>
        <p>CfflCBflO susr...</p>
        <p>&amp;lt;,Z:Sfi,%'s&amp;amp;</p>
        <p>Visit our Rstaii Gift Shop for a large selection of totes, backpacks, travel luggage, dive bags, and other recreation carry ails. Monogram Service Available.</p>
        <p>PARROn CANVAS CO.</p>
        <p>WEST END CIRCLE 756^11</p>
        <p>(MRMnMRMI</p>
        <p>FARMVIUI FURNITURE</p>
        <p>CMPANY</p>
        <p>ORIENTAL RUGS</p>
        <p>YOUR SOURCE IN THE EAST FOR FINE HANOIMAD</p>
        <p>AND MACHINE MADE ORIENTAL RUGS AT SPECIAL SAVINGS</p>
        <p>WMP4PER4MRICS</p>
        <p>DECORATOR FABRICS AND WALLPAPER BY GREFF  KRAVET  VANLUIT  SCHUMACHER</p>
        <p>FaRNviLLE FURNIttlRE COMPANY</p>
        <p>122*126 S. MAIN ST. - FARMVILLE. N. a PHONE 753-3101</p>
        <p>.GnadValqrSt</p>
        <p>aWMBtH</p>
        <p>11  5  5  M    M</p>
        <p>11  7  1  M  7T  10</p>
        <p>  0  1  8    S</p>
        <p>CAMPBBLLOolm^* ** NwibOMrim</p>
        <p>W  L  T  n  or  GA</p>
        <p>0  0  1  II  M  </p>
        <p>0  I  I      71</p>
        <p>1    1  II  M  II</p>
        <p>7  II  S  17  17  71</p>
        <p>^ M  </p>
        <p>II  I  i  B    Si</p>
        <p>0  0  1  10    II</p>
        <p>dj^tan</p>
        <p>3S!</p>
        <p>NeeYerkOhiiL,__</p>
        <p>SmDits&amp;gt;i6,UnAa|ihii^</p>
        <p>_ Mmi^TctBH</p>
        <p>DnerltCbieaio</p>
        <p>rm</p>
        <p>NuanaaB 71</p>
        <p>metnortalHoW**'</p>
        <p>s,</p>
        <p>.ouf hospwa*'</p>
        <p>e months,  on^eacj'  Iretfto  tho</p>
        <p>d tremendous P ,,.03 '"^,^1 our hosp'tai h</p>
        <p>........</p>
        <p>S-</p>
        <p>PCMH,</p>
        <p>Jack. Vd. Richardson</p>
        <p>THE WHOLESALE OUTLET</p>
        <p>SOUTHPARK SHOPPING CENTER</p>
        <p>756-8652</p>
        <p>STORE HOURS</p>
        <p>MONDAY-FRIDAY 10 AM4 PM SATURDAY 10 AM4 PM</p>
        <p>Sune.</p>
        <p>aasL</p>
        <p>SUAVE SHAMPOO AND CONDITIONER</p>
        <p>16 OZ.</p>
        <p>SUAVE</p>
        <p>MOUSSE</p>
        <p>5 0Z.</p>
        <p>09</p>
        <p>$1</p>
        <p>09</p>
        <p>Suave</p>
        <p>L</p>
        <p>SUAVE</p>
        <p>SKIN</p>
        <p>LOTION</p>
        <p>10 OZ.</p>
        <p>09</p>
        <p>Get a Coupon good for a FREE Suave Anti-Perspirant or a $1D0 Cash Refund</p>
        <p>when you buy any two Suave Products.</p>
        <p>SUAVE</p>
        <p>HAIRSPRAY</p>
        <p>8 02.</p>
        <p>AEROSOL AND NON-AEROSOL</p>
        <p>09</p>
        <p>SUAVE</p>
        <p>ANTI4ERSPIRANT</p>
        <p>AEROSOL</p>
        <p>DEODORANT</p>
        <p>40Z.</p>
        <p>88!^'</p>
        <p>09</p>
        <p>SUAVE</p>
        <p>ANTifERSPIRANT</p>
        <p>SOUD</p>
        <p>deodorant</p>
        <p>zoz.</p>
        <p>09</p>
        <p>SUAVE</p>
        <p>AfmfERSPIIlANT</p>
        <p>ROU-ON</p>
        <p>DEODORANT</p>
        <p>2.5 02.</p>
        <p>09</p>
        <p>Vtj;</p>
        <pb facs="00096780_0035" />
        <p>Th D1tr*&amp;gt;rtliOlOf.qwgWHIe. N.C. Sunday. NovembT22.1967 B-13</p>
        <p>fiill liSttlI Awesome</p>
        <p>:' HAMPTON, Ga. (AP) - On a cold  !afternoon made even colder by a Ifl biQng wind, a small crowd at Atlanta Intefnational Raceway sat huddled on' blankets, doing very little 'cheering.</p>
        <p>I ^The spectators watched the action the 1.522-mile, high-baidied oval . quietly, ahmost with (tedain, until the ^Ifo. 3 Chevrolet of Dale Earnhardt 'qweared on the track.</p>
        <p>} When the newly-crowned ^ 1987 WinsUm Cup champion turned a fast lip averaging 173.513 mph, breaking the year-old Atlanta Journal 500 qual- ifying mark of 172.905, the spectators came alive with shouts and cheers.</p>
        <p>Then it was quiet again, broken on-4y by the roaring of engines as the</p>
        <p>cars went out one at a time during Fridays qualifying session for Sundays 500-mile season-fnal.</p>
        <p>Finally, the crowd came alive one more time as local favorite Bill Elliott, from nearby Dawsonville, Ga., moved slowly out of the pits in his swift No. 9 Ford Thunderbird.</p>
        <p>Elliott was the man who set the record that Earnhardt had just broken, and Elliott is hoping to finish secoil to Earnhardt in me season standings.</p>
        <p>T like the idea of knowing what I have to do when I go out there, Elliott said. Im always going to go as hard as I can out there, but knowing what you have to beat might give you just a little bit extra.</p>
        <p>i</p>
        <p>Trinity Sweeps Tourney Games</p>
        <p>Ti.</p>
        <p>KINSTON - Trinity Christian Sclwol swept a pair of basketball games from the host team in the first , -round of the Bethel Invitational i'oumament Friday night. Trinitys boys took a 64-46 win, while the girls, m their first game of the year, came iWay with a 34-27 victory.</p>
        <p>Trinity fell behind in the opening -period ol the boys game, 15-14, but !!ost no ffound in the second frame, Itrailing by only 27r26 at intermission. Then, in the third period, the Tigers f took command of the game, outscor-&amp;lt;^ing Bethel, 17-7, to charge into a 43-34 |Iead.</p>
        <p>I Trinity polished off Bethel, 21-12, in die final quarter.</p>
        <p>* Kirk Welch just played an ^unbelievable game for us, Coach Don Southerland said. Welch pulled l^off 18 rebounds, had 10 steals and dished out five assists while scoring pmnts to lead the Tiger win.  Kreston Welch added 16 points while ^ Gerrard Fulton hit 12.</p>
        <p>^ Doug Moody and Darby Deaver eaim had 14 points to pace Bethel.</p>
        <p>Trinitys girls held an 8-6 lead after :one quarter and pushed out to a 16-11 ^}ead at the half. That was increased ^to 25-19 in the third quarter. Trinity</p>
        <p>then outscored Bethel, 9-8, in the last</p>
        <p>Rhonda Harris led Trinity with 16 points while Becky Stocks had 10. Jennifer Alexander added 13 re-' bounds, while Natalie Godwin pulled 11.</p>
        <p>Dawn White led Betiiel with nine points.</p>
        <p>Trinity was to face Faith Christian for the championships on Saturday night.</p>
        <p>Girls Game</p>
        <p>BETHEL (27)</p>
        <p>Shivar 31-3 7, White 4 (1) (M 9, McCoy 3</p>
        <p>1-3 7, T^dall 0 0-2 0, Ward 0 (M) 0, Rouse 1 0^2, Howell 104)2. ToUlt 12 (1) M2 27. TRINITY (34)</p>
        <p>Stocks 4 2-610, Harris 7 2-716, Alexander 1002, Godwin 12-4 4, Gillin 02-3 2. Totals 138-2034.</p>
        <p>Bethel................................6  5  8  8-27</p>
        <p>Trinity...............................8  8  9  9-34</p>
        <p>Boys Game</p>
        <p>BETHEL (46)</p>
        <p>Harrison 31-17, Pmy 11-3 3, Hardison 4 0-3 8, Moody 5 (1) 3-4 14. Biyan 0 00 0, Deaver 5 (4) 04) 14. ToUls 18 (5) 5-1146. TRINITY (64)</p>
        <p>Ki. Welch 8 (1) 00 23, HarreU 2 30 7, Griffin 3 0-16, Fulton 6 0012, Kr. Welch 7</p>
        <p>2-516. Chandler 0 0-10, Alexander 0 OO 0, Jones 004) 0, Dixon 0 04) 0. Totals 26 (1) 11-1964.</p>
        <p>Bethel..........................IS  12  7  12-46</p>
        <p>Trinity.........................14  12  17  21-64</p>
        <p>Montreat-Anderson Again Tops Pitt CC</p>
        <p>5 BREVARD  Montreat-Anderscm Junior College hpnded Pitt Com-^nunity College its second straight toss in less than a weeks time Friday flight, taking a 95-79 win in the first l^tHind of the Brevard Tipoff Baskef yall Tournament.</p>
        <p>3 The two teams met to open tne 987-88 season earlier this month, &amp;gt;ith Montreat-Anderson coming :33way with the win.</p>
        <p>^ 'The game was close in the early goring with Pitt opening up a 26-17 lead % the midpoint of the first half. Cf^'But we went cold at that point, Coach Charles Coburn said. We were taking good shots, but we just coukbitseemtohit.</p>
        <p>^ As a result, Montreat-Anderson vouthit Pitt 32-4 the remainder of the I; half and charged into a 49-30 lead at .intermission.</p>
        <p>That was the difference in the game, Cobum said. I thought we outplayed them' in the second half,</p>
        <p>I but it was just a little bit too late.</p>
        <p>Pitt outscored Montreat-Anderson, [4W6, but it was too little, too late.</p>
        <p>Eddie Inge led Montreat-Anderson I with 13 points while Wayne Marshall aWed 12. Trent Horne, Brad Brower,</p>
        <p>Johnny Wilson and Chris Alexancter each added 10.</p>
        <p>Pitt was led by Ricky Congleton with 24 points while Paul Hollingsworth added 17, and Mike Hathaway and Eric Dunn each had 12. "</p>
        <p>C(mglet(Hi played a great game for us. He had 15 rebounds to go with his 24 points. Hollingsworth also played well. We had 21 turnovers, which Pm disappointed in - not so much the number as the way were making them, Cobum said. We were also somewhat hurt when Jeffrey Crudup was suspended for this weekend when he didnt attend classes on Tuesday.</p>
        <p>Pitt was to face Blanton Community College, an 82-68 loser to host Brevard, in Saturday nights consolation game.</p>
        <p>PITT CC (79)</p>
        <p>HaUiaway 5 (2) 0412, Congleton 9 (2) 4-5 24, Dunn 5 2-4 12, Hollingsworth 4 9-9 17. Barnes 21-15, Michaels 13-5 5, Williams 0 444.ToUls26 ( 4 ) 23-34 79. MONTREAT-ANDERSON (95)</p>
        <p>Brower 3 (1) 3-610, Sutton 16-6 8, Wilson 4 (2) 04) 10, Johnson 3 04) 6, Thomas 4 (l) 0-19, Marshall 6 04) 12, Alexander 5 04) 10, Walker 0 3-5 3, Inge 5 3-413, Fanney 12-2 4, Home42-410. Totals 36 (4) 19-2895.</p>
        <p>Pitt.......................................30  48-79</p>
        <p>Montreat-Anderson................49</p>
        <p>It gave Elliott enough impetus to beat Earnhardt on Friday, turning a lap averaging 174.341. That wasabit shy of Earnhardts track qualifying record of 175.497, set in March, but it was good enough to earn Elliott his series-leading eighth pole position of</p>
        <p>fliA Gdidc/hti</p>
        <p>I felt hke we had a lot of con-</p>
        <p>The top 20 qualifiers f(H- Sundays Atlan-a Jiwmal 500 NASCAR stock car race.</p>
        <p>fidence coming in at this track, Elliott said. I knew Dale or Davey (Allison) would be the cars to beat, but that with the right set of circumstances and picking the right set of tires, we could do it.</p>
        <p>The conditions turned even colder by the time he went out in the late afternoon diadows.</p>
        <p>I think that helped us some, he said. It was getting into ^dow in (turns) three and four and that</p>
        <p>maybe gave us just a little bit of an advantage over the guys that went out earlier.</p>
        <p>TTie race will be televised live by ESPN.</p>
        <p>day):</p>
        <p>1. Bill Elliott, Dawsonville, Ga., Ford Tlninderbird, 174.341 (breaks race qualify record of 172.905 set by Elliott in</p>
        <p>2. bale Earnhardt, Mooresville, N.C., Chevrolet Monte Carlo  173.513.</p>
        <p>3. Lake Speed, Jackson, Miss., Oldsmobile Delta 88,172.318.</p>
        <p>4. Harry Gant, Taylorsville, N.C., Chevrolet Monte Carlo SS, 172.210.</p>
        <p>5. Davey Allism, Hueytown, Ala., Ford Thunderbbrd, 172.096.</p>
        <p>6. Cale Yarborough, Timmonsville, S.C.,</p>
        <p>Oldsmobile Delta 88,172.058 7. Morgan Shepherd, BuickL^bre, 171.994.</p>
        <p>Conover, N.C.,</p>
        <p>8. Rick Wilson, Bartow, Fla., Oldsmobile Delta 88,171.692.</p>
        <p>9. Ken Schrader, Fenton, Mo., Ford Thunderbird, 171.584.</p>
        <p>10. Greg Sacks, Maitland, Fla., Pontiac Grand Pib2-H2,171.482.</p>
        <p>11. Benny Parsons, Ellerbe, N.C., Chevrolet Monte Carlo SS, 171.407.</p>
        <p>12. Terry Labonte, Thomasville, N.C., Chevrolet Monte Carlo SS, 171.391.</p>
        <p>13. Alan Kulwicki, Concord, N.C., Ford Thunderbird,171.006.</p>
        <p>14. Rkdn Rudd, Chesapeake, Va., Ford Thundei^ 170.937.</p>
        <p>15. Bobby Allison, Hueytown, Ala., Buick LeSabre, 170.905.</p>
        <p>16. Rusty Wallace, Charlotte, N.C., Pontiac Grand Prix 24-2,170.814.</p>
        <p>17. Geoff Bodine, Julian, N.C., Oievrolet Monte Carlo SS, 170.745.</p>
        <p>18.^'Hut Stricklin, Calera, Ala., OldsmobUe Delta 88,170.283.</p>
        <p>19. Buddy Baker, Mooresville, N.C., OldsmobUe Delta 88,170.729.</p>
        <p>20. Phil Parsons, Denver, N.C., OldsmobUe Delta 88,170.225.</p>
        <p>SocMr Champs</p>
        <p>A.G. Coi won the Pitt County Community Schools Soccer Play Day titte for grades 64. Memhers of the team are, first row, left to right: P J. Corbett, David Donghtie, Jeremy Davies, David Brown, Chris Roberts; second row, Mike Smith, Josh Boms, James Stanley,</p>
        <p>Allen Colombo, Dustin Moore, Norbnrt Smith; third row. Matt Leggett, Chris Ray, Eddie Strickland, Coach Ron Cherabini, Robbie Abbott, Matthew PoUock, Michael Pilgreen and Maurice Moore. Wellcomes A team finished second, with Wellcome B, third.</p>
        <p>RAM PICKUP</p>
        <p>vouDoiniunwamFOR muRmf msmueoMKmPKXiPSORDODeiuuam.</p>
        <p>Pick up any new full-sized Dodge Ram in stock with an automatic transmission and your pickup also comes equipped with $500 cash back from Dodge. Two- or four-wheel drive. Even our Dodge Ram 100a better value than Ford's F150 S to begin with, especially since Ford leaves you stuck with a stick and a higher price to boot* Or pick up a new mid-sized Dodge Dakotaf and $500 cash back is automatically yours, regardless of transmission. Pick up the competition's deal and you've got to shift your gears to save JVPW fW like this. After you've heard Ford's stan-  II  9</p>
        <p>dard offer, you'll see. Now more than ^ ever, Dodge is the automatic choice.</p>
        <p>*Bos0d on comparably 9quipped and base list pnc0</p>
        <p>comparisons. tixdudes Dakota S.  fiPwrlPurKo</p>
        <p>BUCKLE UP FOR SAFETY.  DIVISION  OF  CHRYSLER  MOTORS</p>
        <p>omuA</p>
        <p>Joe Cullipher Dodge</p>
        <p>3401 S. Memorial Dr., Greenville, NC</p>
        <p>756-0186</p>
        <pb facs="00096780_0036" />
        <p>Pitrdue Opens</p>
        <p>By The Associated Press Second-ranked Purdue opened its basketball season on a winning note and with a warning.</p>
        <p>game, Boilermakers Coach Gene Iteady said. I think my team has matured a lot since last year.</p>
        <p>Last year, Purdue posted a 25-5 record and tied Indiana for the Big Ten title. Indiana went on to win the NCAA basketbaU tide.</p>
        <p>routed Oral Roberts 119-79.</p>
        <p>The first round concludes tonight with Virginia Tech at Middle Tennessee and Jacksonville at Florida.</p>
        <p>We were very cautioiK and apprehensive about playing this team, Ready said of Aitansas-Little Rock. The bench was the key for ib. I thoi^t Troy Jones did an excellent</p>
        <p>for us, as well as (^an) Beming and (Steve) Scheffler. They gave our</p>
        <p>Friday night, Purdue, led by Todd Mitchelis "   ' "  "  </p>
        <p>___22  points,  breezed past</p>
        <p>Arfcansas-Lite Rock 102-88 in an op^ng-round game in the NIT Big Apple college basketball tournament.</p>
        <p>Also posting first-round victories Friday were No. 8 (Seorgia Tech, Iowa State, Seton Hall, New Mexico and UCLA.</p>
        <p>Georgia Tech roiled over Alcorn State 114-71, Iowa State downed Texas 10043, Seton Hall defeated George Mason 8543, New Mexico stopi^ Weber St. 88-72 and UCLA</p>
        <p>starters some needed rest.</p>
        <p>We knew coming into this game it was going to be intense because thev (Aikansas-Little Rock) play good, aggressive defense.</p>
        <p>Mitchell scored seven straight points late in the first half as the Boilermakers used a 9-1 spurt to take a 51-37 lead over the Trojans with 43 seconds left. Purdue had four players</p>
        <p>in double figures, includins Lewis, who scored 18 points and pufled down</p>
        <p>a career-high 11 rebounds.</p>
        <p>We had two concerns coming in. One was playing at Mackey Arena and Purdues experioice, Aikan-</p>
        <p>sas-Little Rock Coach Mike Newell said. These were the two factors that contributed to the defeat.</p>
        <p>I th^t in the first half (James) Scott, (Johnie) Bell and (Michael) Covington, who are three new players on our team and havent played Diviuon I ball, forced some shots. They werent bad shots, but they werent the right ones. We werent very patient on offense and we dug oursetves a hole by rushing ourshcs.^</p>
        <p>Georgia Tech was never in trouble against'Alcorn State as both Tom Hammonds and Brian Oliver scored a career4iigh 29 points. Tech never trailed in the game and held its biggest lead at 10341 with just over five minutes remaining.</p>
        <p>Hammonds sat out the final nine minutes after giving Tech an 89-55 lead. OUver M with 6:24 to play after giving Tech a 10041 advantage.</p>
        <p>Ferrell added 20 points for Tech, while Roosevelt Tate led the Braves</p>
        <p>with 25 pomts, 19 coming in the sec-</p>
        <p>Dennis Scott became the first player in Tech history to record a tirite double. He scored 17 pckts, had a team-high 10 rebounds and a team-hifft 10 assists.</p>
        <p>Hammonds, playing despite a broken little finger on his right hand.</p>
        <p>ALCORN STATE</p>
        <p>Davenport</p>
        <p>Rogers</p>
        <p>Tate</p>
        <p>Carter</p>
        <p>Smith</p>
        <p>Ware</p>
        <p>Riley</p>
        <p>Harris</p>
        <p>Pinckney</p>
        <p>White</p>
        <p>Thomas</p>
        <p>Totals</p>
        <p>27</p>
        <p>17</p>
        <p>27</p>
        <p>25</p>
        <p>21</p>
        <p>17</p>
        <p>18 5 18 14 13</p>
        <p>200</p>
        <p>MP FG FT R A P Pt 4-10 1- 1 5 2 4  9</p>
        <p>hit 12 of 16 shots and Oliver was 13 of IS.</p>
        <p>Hes amazing, Coach Bobby Cremins said of Hammonds. The kid jiBt totally amazes me. For him to be out 2V weeks with a broken finger and come and play like that, hes a true All-American.</p>
        <p>Iowa States victory over Texas was paced by Jeff Grayer, who scorea 36 points, and center LaFester</p>
        <p>roster, turned the ball over Uthnes in the first half and 31 tim In the game.</p>
        <p>Travis Mays, Texas hmeiflmiiM  w|2!</p>
        <p>starter, led the Longhorns points.</p>
        <p>Iowa State Coach Johnmr Orr said the Cyclones tired at</p>
        <p>'ormanoe.</p>
        <p>otherwise he was pleased season-opening perforroanc</p>
        <p>2-8 0-0 11-18 3-6 1-9 0-0</p>
        <p>1-4 3-6</p>
        <p>2-5 0-2 4-7 4-4 0-1 0-0 0-3 0-0</p>
        <p>3-4 0-0 2-7 0-0</p>
        <p>Rhodes, who had a career-high 27 while inaking his first start.</p>
        <p>The Cyclones rattled the youthful Texas team with a full-court press that led to numerous easy baskets. The Longhorns, who have 10 sophomores and freshmen on their 13-man</p>
        <p>We really moved most of tbs time. We got a lot of steals, a lot of easy baskets, he said. U wedhave converted everything, we leally would have had a load of poiMs. I think our quickness was the Ug tor, theres no question about thaL</p>
        <p>30-77 11-19 37 16 28 71</p>
        <p>GEORGIA TCGH</p>
        <p>Two Top Teams Beaten</p>
        <p>Scott</p>
        <p>Ferrell</p>
        <p>Hammonds</p>
        <p>OUver</p>
        <p>Christian</p>
        <p>Neal</p>
        <p>Munlyn</p>
        <p>Whitmore</p>
        <p>Martinson</p>
        <p>Boisvert</p>
        <p>Reese</p>
        <p>Totals</p>
        <p>MP FG PT R A F Pt</p>
        <p>32 7-14 0- 0 10 10 24 6-11 8- 8 3 0 28 12-16 5-5 3113-15 3-3 13 0-0 1-3 0-10-1 2-4 2-4</p>
        <p>20</p>
        <p>17</p>
        <p>16 1-4 2-6 8 2- 3 0-0 6 0-5 0-0</p>
        <p>5 1-12-2101  4</p>
        <p>200 44-74 23-32 49 26 21 114</p>
        <p>By DAVID DROSCHAK Associated Press Writer i Greensboro Grimsley and Munrtiy I ^both used their second-round high  sclwol football playoff games as  paybacks for regular-season losses,</p>
        <p>0 ousting two of the states top-ranked  teams.</p>
        <p>- Kirk McGuinn kicked a 33-yard field goal as time expired to give the Whirlies a long-awaited KK7 victory over top-ranked crosstown rival Greensboro Page in 4-A playoff action Friday night.</p>
        <p>McGuinn's field goal hel]^ ohI 16 years of gridiron futility for Grimsley against the Pirates, a winless streak that dated back to</p>
        <p>1 1972.</p>
        <p>f The win also avenged a 56-7 loss i earlier in the season to ^ Pirates i and sends Grimsley, IH, into flie 4-A I quarterfinals against West Meddra-f burg, 10-2. The Indians blanked Gastonia Huss 224 to set up next Fri-&amp;gt; days meeting in Charlotte.</p>
        <p> The loss ended Pages seasm at i IM.</p>
        <p> In Bryson City, defending 1-A</p>
        <p> champion Murphy avenged a regu- lar-season 27-23 loss to pranked S Swain Cwmty with a 474 victory Fri-</p>
        <p>day night. Benny Smith and Mel</p>
        <p> Nicely scored two touchdowns each</p>
        <p>Anthony Barbour rushed for 143 yards and scored three touchdowns as Gamer defeated Pinecrest 284. Barbour now has 2,480 yards rushing, breaking the unofficial state singleseason rushing record of 2,450 yards, previously set in 1979 by Claytons Andra Mangum. Barbour also has 40 touchdowns, three shy of the state mark set by Princetons Mike Atkin-soninl979.</p>
        <p>Northmm Durham handed Wilmington New Hanover its first loss of the seasim as Ronnie HHmias sc&amp;lt;N%d three times and also intercepted a pass. The Knights will now host Jacksonville, a team that dumped previously unbeaten Greenville Rose 74.</p>
        <p>Hardings Ray Durham returned the opening kickoff</p>
        <p>and Ciurl Pickens caught eight passes for 94 yards as Murphy rolled up 381</p>
        <p>I yards of total offe</p>
        <p>!|^  Swain County, the 1965 state cham-</p>
        <p>pions, ended the season at 11-1.</p>
        <p>I Greenville Rose, WUminghm New I Hanover, Burlin^n Cummings, &amp;gt; North Iredell, Edenton Holmes and Newton-Cmiovar also fell frwn the unbeaten ranks.</p>
        <p>; With 3-A Havelock losing last week * in the playoffs first round, 2-A Whiteville is the only top-ranked  Wolfpack,</p>
        <p>team remaining. The Wolfpack,</p>
        <p>which got a TD reception from tight ^ Chester McGlodtiim, advanced</p>
        <p>85 yards for a score to help defeat Gastonia AshlHook, that despte Junimr Halls 151 yards rushing.</p>
        <p>In 3-A, Tarboro and Southwest Edgecombe will battle for Edgecombe County bragging rights and a chance at the semifinals next week, while Asheboro and Burlington Williams will Imx^ up in another surprising matchup.  j</p>
        <p>Asheboro, 16-2, traited No. 2 Bivl-ington Cummin^ 64 with 4:15 Idt, then drove 69 yards in nine plays to tte the score. Odis Covinjgton, who gained 156 yards on 30 carries, scored on a 4-yard run with 23 seconds remaining. Russ Shoemaker kicked the extra point to give Asheboro a 74 vic-tm7 but only after an offsides p^ty.</p>
        <p>Cummings used two big pass plays to move the ball downfieid and ap-peared to have made an mtoeUeveable comback. But Roimie Enoch lost the lall at the Asheboro 5 aftmr being hit and Tyrone GoldsUm recovered the ball in the md zone as time ran out to preserve the victory.</p>
        <p>to the qurMnals with a 214 victory over FiKiuay-Varina.</p>
        <p>Gamer, Northern Durham and Charlotte Harding all advanced to 124 in the 4-A playoffs with key victories.</p>
        <p>up 356 yards on the ground.</p>
        <p>Two-time defending 2-A champion Lexington will host conference nval Thomasville in one 2-A quarterfinal match next Friday. Tm Yellow Jackets used Kevin Sims 141 yards and one TD to down Monroe 28-7, while Thomasville defeated Charlotte Catholic 214.</p>
        <p>Bunker Hill also looked im-jvessive, rolling up 562 yards &amp;lt;m the ground in its 59-27 victoiy over Star-mount. Three Bunker Hill players ran for more than 100 yards, led by Paul James 192 yards on 21 carries.</p>
        <p>Red SfHTings remained the (mly unbeaten 1-A team, but barely. The Red Devils ran their mark to 124 with an 6-7 victory over Lumber River Conference rival St. Pauls. James Blacks 1-yard TD run and quarterback Eric McDonalds two-{xnnt c(mvBon bootl^ with 10:36 left proved to be the winning points. After the score, St. Pauls fumbled the ball on its next two possessions and never recovered.</p>
        <p>Red Springs will travel to East Montgomery, which defeated conference rival North Moore 21-14 behind Alex Ingrams 33-yard scoring reception and 1-yard run.</p>
        <p>Columbia also looked impressive in</p>
        <p>Alcorn St..................................38 41- 71</p>
        <p>Georgia Tech...........................A6 58-114</p>
        <p>Three-point goalsAlcorn State 0-7: Rogers 0-2, Carter 0-1. SmitI 0-2. Georgia Tech 3-6: Scott 38.</p>
        <p>TurnoversAlcorn State 20, Geoi-fpa Tech 16.</p>
        <p>Technical foulsNone.</p>
        <p>Officials-Burr, Marje, Sylvester. A-4,409.</p>
        <p>Have You Missed Your Daily Reflector?</p>
        <p>First Call Your Indepondent Corrlor.</p>
        <p>If You Aro Unoblo To Roach Him Call Hw Daily Rofloctor.</p>
        <p>752-3952</p>
        <p>Botwoon 6:00 P.M. And Wookdays And 8 A.M. 'Til Sundays.</p>
        <p>6:30 P.M. 9 A.M. On</p>
        <p>dumping North Edgecombe 344. Andre Cummings i</p>
        <p>; ran for 163 yards and three touchdowns.</p>
        <p>THANKSGIVING HOLIDAY SCHEDULE FOR CITY DEPARTMENTS</p>
        <p>CITY HALL &amp;amp; MUNICIPAL OFFICES: Closed Thursday, November 26 and Friday, November 27</p>
        <p>SANITATION SERVICE: Refuse pick-up will only be provided once during Thanksgiving Week, on Monday or Tuesday. Commercial containerized pick-up will also be provided on Friday.</p>
        <p>GREAT BUSES: Will not operate Thanksgiving Day.</p>
        <p>RECREATION &amp;amp; PARKS: All facilities are closed on Thursday and Friday.</p>
        <p>SHEPPARD MEMORIAL LIBRARY:</p>
        <p>Thursday, November 26.</p>
        <p>Facilities will be closed on</p>
        <p>The 3-A championship may still run through Shelby tbough.</p>
        <p>_ as the d^oiding state champs ndled past Belmont South Point 414. Cedric Surratt nehed for 133 yards on nine carries, including a 54-yard dash to open the games scoring. Shelby ran</p>
        <p>^ Wbot</p>
        <p>Leavii^nmie</p>
        <p>BB B Bn BBB B B BlT</p>
        <p>Heres how it works:</p>
        <p>1. After deelAnf Sie anount you need, check the boi in the left-hand ciJunui of the chart  ,</p>
        <p>2. Sim and 4ate on the Une(i) bciieadi the chart Married peraona can be extended credit aa aole indMduaia; however, hwome and aaaeta of only the pcraon dming win he conaMeted in delennininidi^ty.</p>
        <p>3. if you want youc loan inauied, dm 6 anlhoiftalion for credit life inam^ ancc.  ''</p>
        <p>4. Mail Ihia dgned Ameemcnt (Note) to ua at Crcdithrift 228 E.</p>
        <p>BwL, Rpten Annex, Gteenvifle, NC 27834.</p>
        <p>5. On approval, well put your check in die mail in a jiffy! Thataal Bew la to it You nay even make your monthly payment by mail. SUBJECT ONLY TO OUR USUAL CREDIT POLICIES. EXPIRES DEC 31.1987.</p>
        <p>Piraar TiU in the blank, bdow. Type or print:</p>
        <p>HOLIDAY LOAN REQUEST</p>
        <p>- PleaaecaUaKlime)</p>
        <p>C * 1 O__^</p>
        <p>Empioyar</p>
        <p>Married Unm.rvied .Scnarated</p>
        <p>AAfevw.</p>
        <p>AAJrmMM</p>
        <p>Hn.k, PndHrni</p>
        <p>Kmplnvrr nhnnr numhrr</p>
        <p>Un,. .1 (ku .AImmV</p>
        <p>Net monthlv inmmr flake hnrac navi*</p>
        <p>Complete only if applyina joindy. Married ncofde can be extended credil aa vole individuab; however, inconM and aaaeb of only the pcraon dmtof '*111 be conaidered in determinina elimdHty.</p>
        <p>Cilv Stale</p>
        <p>rheckinf 1.</p>
        <p>Check Ike amount yon wmt</p>
        <p>AoMNUlt</p>
        <p>Fmamsed</p>
        <p>No. of Moolkly PqroiailB</p>
        <p>Amoviitof</p>
        <p>MootUy</p>
        <p>Paymoita</p>
        <p>rmance</p>
        <p>CkargB</p>
        <p>(hreThiie</p>
        <p>Inanraace</p>
        <p>Pfcmmmg</p>
        <p>(Optioul)</p>
        <p>Total of Paymnila</p>
        <p>AmhmI</p>
        <p>PwcentatB</p>
        <p>Rate</p>
        <p>36</p>
        <p>176.28</p>
        <p>8746.06</p>
        <p>165.90</p>
        <p>S2.746.0e</p>
        <p>21.9%</p>
        <p>1,500.00</p>
        <p>36</p>
        <p>57.21</p>
        <p>559.56</p>
        <p>49.42</p>
        <p>2,059.56</p>
        <p>21.9%</p>
        <p>1,000.00</p>
        <p>36</p>
        <p>38.14</p>
        <p>373.04</p>
        <p>32.95</p>
        <p>1,373.04</p>
        <p>21.9%</p>
        <p>(NOlt):</p>
        <p>For value received. I/m promlae to pay you, Ike kndcr, the amount of ihla note (faicludinf inleiwt at the A.F.R. ai</p>
        <p>iched in die chart for 6m numbar of</p>
        <p>et out in the duirt helowl I/m vritt make the number and amount of paymenli u chacbed in I conaaeudva monlha drawn. Pimnmti vriM bedn 30 dtya from die dale of fbe chech we leoelve fer tke the procccda ef the loan C'dic fint payment due dale)L After diat I/m wdl maba monthly paymenu on Ac eamc dale until thla loan it paid infiilL</p>
        <p>The rale of intereat b compounded at the Annud Feroanlage rob drawn in the chart Iha applicable chaiie b not moR than act forth in abb law. I/we may prepay dib loan at any dmc and be endtled to a icfimd of unearned chaipM aa requhed by law.</p>
        <p>H I/m fail to mdw any paymant on dmc, you may dcclaie the endn unpaid pilneipd bdanee pha accrued diarr* due and payaUe at once vdOout wiitbn noda. If there b a belaace remainini on the Fhbl Due Dua, I/we acne In pay bbrmt on dial bdanee at the mb of IlO% per annum. 1/we wiB receive a abbment of the loan m mmhid by bw. tflba loan b not approved, thb Ayeemrat will be letumed to me. I/m aclorawledie that I/we received thb locn ^paement with Ulrraturc dbeloabit (emu aareqidicd by law.</p>
        <p>Simatufc of prindpei borrower</p>
        <p>Social Security number of principal borrower</p>
        <p>Addreu</p>
        <p>^lm*tv* of cohorrower</p>
        <p>Phone</p>
        <p>muaunoN or amount roiAMZD!</p>
        <p>The amount Financed b the amount paid to you, the Boiroweifa), unlem you want Ciedil lift hbminea. If you want Credit Life InaiarmMe, the Amount Flmmeed Indudm the wnounl you wM leceivo. pIna the onmmt pdd to *e I</p>
        <p>Date</p>
        <p>Company for</p>
        <p>ia,ooaooaiui</p>
        <p>6m dttide Credll Ufa htuianae Pmmbm drawn in 6m ahart below. For eitmple, if you want to borrow</p>
        <p>LOO and widi to have your lomi inauied, yeu wil receive Il.984.10(l2.00a00- l6S.90)Mid the |6l90 will be pdd to the bMunnce Company for your Credit Life inmrMMc probcden.</p>
        <p>INSURANCE; Credit Life hwuHice b nt lemiml to obbbi credit and wiU not be piovidMl unbm you dm 6m au6iibt6Mi to 6m left If you apM to pay 6m atWlkmd eoal for 6m premium. It wil be dohMbd feom 6m Amount FiMiiMd in order to debimiao 6m cmh yon rrii leorlvo. CMH Life Inonrince b not tvailoUi for any borroworwhob piereo6y ige 68 or older.</p>
        <p>AUTHORIZATION FOR CREDIT LIKE INSURANCE</p>
        <p>J want Credit Life Inmrance on thb loan and</p>
        <p>undcniand the prrmium will be the amount drawn in 6m chart above.</p>
        <p>228 E. GreeavVIe Blvd.</p>
        <p>(TiptoiiAwMn) Greenvlle. NC 27834 3554666</p>
        <p>Sqpalun- of borrowerl</p>
        <p>to be inaureST</p>
        <p>Loam 89.000 to $80,000 Or mora mada by  ----MORTC</p>
        <p>CREOITHRIFT MORTOAOE and LOAN.</p>
        <p>i</p>
        <p>L</p>
        <pb facs="00096780_0037" />
        <p>i*</p>
        <p>8UNMY 1*6 PM</p>
        <p>M0N&amp;gt;TVE8.4lf|B). 8 AM8 PM CLOSED TNANk8QIV</p>
        <p>(8QIVINQ DAY, THURSDAY, NOVEMBER 26TH REOPEN FRIDAY,</p>
        <p>NOV. 27 AT 8 AM</p>
        <p>ALL PRiCiS OUR BIQ ADVERTISEMENT 1ST WEDNESDAY ARE STILL IN EFFECT! IF YOU MISPLACED^YOUR COPY, WE HAVE PLENTY IN THE STORE! HAPPY THANKSQIVINQ!</p>
        <p>211 JARVIS STREET</p>
        <p>PRICES EFFECTIVE THROUGH WEDNESDAY, NOV. 25</p>
        <p>HOME OF GREENVILLES BEST MEATS WE RESERVE THE RIGHT TO LIMIT QUANTITIES.</p>
        <p>if</p>
        <p>ifr</p>
        <p>- PRIDE OF THE FARM YOUNG</p>
        <p>TURKEY BREAST</p>
        <p>5-7 LB. AVG.</p>
        <p>LIMIT ONE</p>
        <p>GRADE A YOUNG</p>
        <p>TURKEYS</p>
        <p>16-20 LB. AVG.</p>
        <p>limit one</p>
        <p>LIMIT 3. EXTRAS... 45lb.</p>
        <p>WHOLE OR HALF</p>
        <p>CORNED</p>
        <p>HAMS.l.</p>
        <p>SWIFT</p>
        <p>BUHERBALL TURKEYS</p>
        <p>PLNW of 10 lbs.</p>
        <p>OTHER SIZES AVAILABLE! </p>
        <p>PEANUT CITY SMOKED WHOLE OR HALF</p>
        <p>COUNTRY HAMS.</p>
        <p>LB.</p>
        <p>M</p>
        <p>59</p>
        <p>GWALTNEY</p>
        <p>BACON.</p>
        <p>BIG1 LB. PKG.</p>
        <p>$119</p>
        <p>RICHFOOO JELLIED</p>
        <p>CRANBERRY</p>
        <p>SAUCE</p>
        <p>DEL MONTE</p>
        <p>SEEDLESS RAISINS.</p>
        <p>FRESH FROM OUR DELI</p>
        <p>COCKED HAD.... 2'*</p>
        <p>1399</p>
        <p>PEPPERED</p>
        <p>ROAST BEEF.L.</p>
        <p>REGULAR OR LIGHT</p>
        <p>KRAFT</p>
        <p>MAYONNAISE</p>
        <p>GWALTNEY TENDERIZED</p>
        <p>SMOKED HAMS</p>
        <p>SHANK</p>
        <p>HALF</p>
        <p>ALL VARIETIES ALL NATURAL</p>
        <p>BREYERS</p>
        <p>ICE</p>
        <p>CREAM ^aton*</p>
        <p>KRAFT CHILLED</p>
        <p>ORANGE</p>
        <p>JUICE.</p>
        <p>carton</p>
        <p>99'</p>
        <p>RICHFOOO</p>
        <p>LB. PKG. QTRS.</p>
        <p>4P1</p>
        <p>n</p>
        <p>RICHFOOO</p>
        <p>V?^#'shellsk</p>
        <p>59</p>
        <p>JUST ARRIVED! ASSORTMENT OF FRESHLY SHELLED NUTS PERFECT FOR BAKING OR MUNCHING!</p>
        <p>CALL OUR FOOD SERVICE DEPT. FOR FRESHLY 8 BEAUTIFUUY PREPARED MEAT, CHKSE AND VEGETABLE PARTY TRAYS. 24 HOURS NOTICE REQUIRED.</p>
        <p>NOUMIT!</p>
        <p>COCA-COLA</p>
        <p>LITER</p>
        <p>BOTTLE</p>
        <p>RICHFOOO  /\  AlK</p>
        <p>shortening ts 99*</p>
        <p>BOUNTY</p>
        <p>PAPER TOWELS</p>
        <p> LIMfT 3 ROLLS QIANT ROU</p>
        <p>FRESH FROM Om BAKBtY</p>
        <p>$H 99</p>
        <p>COCA-COLA.'*</p>
        <p>OZ. CARTON 0F8</p>
        <p>*1</p>
        <p>49</p>
        <p>+ dtposH</p>
        <p>RICHFOOO</p>
        <p>PUMPKIN PIES,</p>
        <p>MINCE PIES,</p>
        <p>SWEET POTATO PIES.</p>
        <p>SUGAR</p>
        <p>26 OZ.</p>
        <p>LIMIT ONE</p>
        <p>FRESH LOCAL</p>
        <p>COLLARDS..</p>
        <p>OCEAN SPRAY 1111 IE</p>
        <p>annuS'^GG</p>
        <p>YEUOW f UC</p>
        <p>ONIONS.f 9</p>
        <p>FRESH</p>
        <p>CELERY.....</p>
        <p>O $iOO</p>
        <p>SWEET</p>
        <p>WHITE CLOUD .. &amp;gt;</p>
        <p>TOILET tissue... .;S95*</p>
        <p>POTATOES</p>
        <p>00</p>
        <p>RICNFOOO ASSORTED FLAVORS</p>
        <p>CAKE MIX.</p>
        <p>18 OZ. BOX</p>
        <p>RICHFOOD 1 PLAIN OR SELF-RISING</p>
        <p>ALL PUI^POSE</p>
        <p>SLB..</p>
        <p>BAG</p>
        <p>FLOUR</p>
        <p>WHITE POTATOES</p>
        <p>DEL MONTE VEGETABLES CUT GREEN BEANS, GARDEN PEAS, WHOLE KERNEL &amp;amp; CREAM STYLE GOLDEN CORN</p>
        <p>I ij  '4</p>
        <p>Wchfood</p>
        <pb facs="00096780_0038" />
        <p> V</p>
        <p>ers</p>
        <p>ByBARBmMAYER APNeWsfeatiires</p>
        <p>Nowadays, a customer buying a new sofa is likely to be offered an extra-cost ^ Wairaiity to pn^t new upholstery from staining that adds between $50 and $100 to we cost of a sofa.</p>
        <p>According to HFD, a home furnishings trade newspaper, these warranties</p>
        <p>**have beomie a vital profit center for many retailers who frequently reap</p>
        <p>|xsfitsasl^as600,700oreven800percentofthecostofthetreatment.</p>
        <p>Jolm Connolly, founder of Fiber Seal Intematinial in Fremwit, Calif., wWch</p>
        <p>if treatod at the mill primly, fabric doesnt need to be treated again, according to Ray Dunton ofDiqxmt. He added that tests have shown that damage to latex backings can occur if fabrics are treated with a solvent con</p>
        <p>taining silicone.</p>
        <p>A problem for consumers who purchase upholstered furniture is that they sometimes have little way of knowing whether the fabric has already been</p>
        <p>treated. While it is indusbry practice to attach information on fiber content and chemical treatments to fabric sv</p>
        <p>markets a warranty (vogram using Did*&amp;lt;mts Teflon, said abwt 100,000 Fib^ Seal warranties are sold each mcmth through more than 3,000 furmture</p>
        <p>retailers all ova* the country. He said 61 percent of retail furmture stores now affored some ty^ of warranty.</p>
        <p>By sftlHng our warranty to six out of 10 customers, the net bottom line wouidbei -------------------------</p>
        <p>_____________________________________swatches and to finished furniture, it is</p>
        <p>common for some retailers to cut the tags off upholstered furniture, said Gerlach.</p>
        <p>Dunton said in some instances fabrics treated at the mill could benefit from a second coat of stain repeller if a different welting has been used or because of needle holes or untreated thread. But Gerlach &amp;lt;</p>
        <p>Another treatment offers absolutely no benefit and ma\</p>
        <p>k disagreed, nd may oner disadvantages in terms of degrading the backii^ and seams. Needle holes in fabrics</p>
        <p>dont change water repellency rating since the surface of the fiber is what gets stained, he said.</p>
        <p>At the recent national furniture market in North Carolina, spokesmen for Banmlounger, Drexel and Pennsylvania House wwe among those who said that all or many of their fabrics are already treated at the itoll or, if not, can be treated at the manufacturing level for a small additional cost.</p>
        <p> i $21,000 additional profit, and the investment is only one pail at a time</p>
        <p>the ciiemical, he asserted.</p>
        <p>But bow necessary to the coisumer is the warranty? According to Minam Gleberman, vice mesident J. H. Ha^ey, a retail furmture chain in suburban New York, which sells the SoU Shield program, The warranty gives customers psychological security and a guarantee in writing.</p>
        <p>However, any fabric that is already treated at the mill or manufacturing le^ with one of the stain repellers does not need any additional treatment, at</p>
        <p>leastatfirst.  ^ ^  j</p>
        <p>This is the consensus among u[rfiolstery fabric specialists and spokesmen for 3M Co. and DuPont, which supply most of the fluorocarbon chemical stain repeller applied to upholstered furmture.</p>
        <p>Tom Gerlach of 3M said: We feel the best protecbon is put on at the fabnc</p>
        <p> mill because it is put on with the greatest number of controls.   v  .  *</p>
        <p>It can be effectively put on fabrics in the retail store warehouse provided in-  rather than a silicone, especially if a fluorocarbon may have b^ applied at</p>
        <p>structions are followed carefully. But you have to qualify the fabrics on a  the mill level. Fluorocarbons are effective against both oil- and wa^-borne</p>
        <p>seam-stress tester to see if they hold together and to make sure the treatment  stains and account for the lions share of chenucal treatments on furniture,</p>
        <p>does not dissolve the backing. Utex tockings are dissolved by almost all these solvents, Gorlach added.</p>
        <p>Before making a decision about an extra-cost fabric (arotecton rilan, a consumer should check carefully to see if the fabric is already treated. If the answer is no, ask the retailer how and where the treatment will be applied, by whom, what kind of training and what kind of diemicals will be used, suggested Laren Hubbard of Barcalounger Co.</p>
        <p>If you do opt for an aftermarket treatment, make sure it is a fluorocarbon.</p>
        <p>stains and account for the lions share of &amp;lt;</p>
        <p>However, at least two companies still offer silicone upholstery treatments, according to Connolly, which are effective only against wateriborne stains.</p>
        <p>On The House</p>
        <p>By ANDY LANG</p>
        <p>ByANDY LANG APNewsfeatnres Complete refinishing jobs on your furniture sometimes can be averted if the blemishes or other irregularities are not too severe. Minm* scratches and other fairly inconspicuous marks can be covoed or disgrised with simple items you may have around the home or can easily obtdin.</p>
        <p>Ordinary paste shoe polish, for example, usually will hide a scratch in a varnished or lacque^ finish. Try to matdi the polish with the crior </p>
        <p>the finish, using a brown, tan or black I bkd witti the tone (tf ttie</p>
        <p>polish to________</p>
        <p>wood. When the repaired area has been buffed thoroughly, it will, take on a gloss, fine for a piece of glossy furniture but not feasible fw one without a shine.</p>
        <p>Another household product that can te utilized to cover a scratch is iodine, just as it comes.from the bottle for an ordinary daHi finish, but Udniied with denatured alcohol for a light finish. The iodine must be</p>
        <p>end of an artists tiny brush. Mix a little linseed oil with a tinting color if a iNPecise cola* match is essential. Test it first on an unconspicuous part of the furniture, such as the underside, to determine how it will lorii.</p>
        <p>Hie meat of a walnut or butternut often will give you the color you want. Rub it weU into the scratch. You can buy a wax stick that will accomplish the same thing. In the absence of one, a crayon from a diilds crayoi set may be used effectively. Other possibilities are shellac or a tiny amount rif an ml stain. Slightly larger blemishes often will yidd to a little rottenstone powder and oil. In all these applications, care must be exercised to avoid creating</p>
        <p>handled carefully to avoid dama^ -      *  apply  it</p>
        <p>a finely finished surface, so , with something like a toothpick or the</p>
        <p>HOME DESIGN</p>
        <p>Buy Plans Direct and Save</p>
        <p>Dasi8n22004</p>
        <p>Imagine this impressive brick home on your lot. The distinctive styling of the front will distinguish any neighborhood. Inside, this plan is equally remarkable. The huge family room merits a fireplace, wetbar, and a</p>
        <p>fp</p>
        <p>sweeping view of the patio. The master suite is truly lavish, with his-and-hers closets and vanities. Note the ample closet space in each bedroom and throughout the house. The charming kitchen and eating nook are flooded with light.</p>
        <p>Uni floor*2,070sq. ft. Garoge - 474 sq. ft.</p>
        <p>GARAOC</p>
        <p>jatrn(-r</p>
        <p>u Jiury i</p>
        <p>'  'k  ^TIO</p>
        <p>GDR</p>
        <p>YES, send me Plan # 22004</p>
        <p>(MMwM LM anO f fMryK Stwno SpecMciMn OuM  j</p>
        <p> 5 sets (Construction Package).</p>
        <p> 1 set (Study Package)...............</p>
        <p>Additional sets @ $15 ea..</p>
        <p>,a$lM value . a IIU value</p>
        <p>Postage and Handling (Allow 4 weeks for delivery)</p>
        <p>Total for Plana Special Offer: Catalog of</p>
        <p>I more than 150 custom home plans postpaid | ouly t$JO |</p>
        <p>I</p>
        <p>I</p>
        <p>1 saw this house in the</p>
        <p>Num al Nf wt|M|Wr</p>
        <p>I Name</p>
        <p>I Address</p>
        <p>I</p>
        <p>aty A Slate</p>
        <p>Zip.</p>
        <p>Make check or money order payable to and send to: UNITED FEATURE SYNDICATE</p>
        <p>UNITED MEDIA. P.O. Box 5380, Cincinatli, Ohio 45201  ^  J</p>
        <p>paste wax are other po^ibilities.</p>
        <p>The powdered pumice-oU method is perhaps the best for nearly all kinds of rubbing, but must be handled extra carefully. Hiats because it cuts a bit faster than rottenstone. And it must be checked to see there are no impwties or tiny, almost invisible foreign objects in it. The tiniest grain of anyt^ in the powder may leave unsightly scratches. A clean pad of felt is considered excellent for the rubbing. ,</p>
        <p>new problems.</p>
        <p>White rings or other white marks on furniture require special attention and often call for the rottenstone and oil treatment after the whiteness has heen removed. If the rottenstone doesnt seem to have done the job, do the same thing with powdered pumice. The stem may be done in reverse order. Cigar and cigarettes ashes are mild abrasives that sometimes work. Camphorated oil and a</p>
        <p>lay be</p>
        <p>with the pumice powder, but water should be avridol if the finish is shellac. The water may leave whiteness on the shellac. However, using water with the pumice enables it to cut very well witout leaving an oily residue. Oil, &amp;lt; the othor hand, slows down the cutting action, which can be a benefit to a novice wood fin-</p>
        <p>(The techniques of using varnish, shellac, lacquer, stain, bleach, remover, etc., are detailed in Andy</p>
        <p>Langs booklet, Wood Finishina in the Hone, which can be obtained by</p>
        <p>sending 50 cents and a long, stami self-addressed envehqie to Know-How, P.O. Box 477, Huntington, N.Y., 11743.)</p>
        <p>Heres The Answer</p>
        <p>ByANDYLANG</p>
        <p>APNewsfeatores</p>
        <p>Q. -1 intend to make some outdoor wooden furniture. Is there some special kind of glue that should be med, since the future will be k^ outdoors most of the year?</p>
        <p>A. - Yes. Use resorcinol glue. It cones in two containors. Whoi the contents of each are mixed, the resultant glue is waterproof, which is necessary. Glues that are water-resistant may not hold up in all kincb (tf weather over a period of time.</p>
        <p>Q. ^ My wife would like to change pocketbook.</p>
        <p>the color of her leather Can the leather be painted and, if so, what kind of paint should I use?</p>
        <p>A.Go to your neighborhood shoe store or cobbwr and buy a kit that includes materials for coloring leather. This is a certain way of getting the right product for the]</p>
        <p>Q. - We have been getting lower and lower water pressure In our 100-</p>
        <p>house over the vears. A had become</p>
        <p>plumber said the pipes clogged and a whole new plumbmg system was required. He also said installing air chambers on the line would do no good. How can I find out whether he is telling me the truth?</p>
        <p>Garden Clmic</p>
        <p>eiW7Lmw'tOo..mc.</p>
        <p>isher, giving him a little leeway in the error department.</p>
        <p>Hidina or disgidsing scratches or other bremishes must be done only</p>
        <p>after any wax on that wood has been removed. Use a solvent or commercial wax remover, always being certain to follow recommended safety practices. When something is strong enough to take off wax, it usually is flammable. Provide plentv of ventilation and dont smoke while working.</p>
        <p>A. - You can get a second opinion, but chances are he is right. A 100-year-old plumbing system needs more than a few repairs. Air chambers are for reducing the poun-(ting noise known as water hammer.</p>
        <p>Q. -1 expect to hang vinyl on our kitchen wau. Is there any special way of handling it around corners?</p>
        <p>A.  Because of its extra thickness, it is best to lap the vinyl around comers by a couple of inches. Follow the manufacturers instructions regarding the kind of paste to</p>
        <p>use. Its important the recommendation be followed (</p>
        <p>Ml how 1(^ the paste should set before the vinyl is</p>
        <p>Q. Please give me some information about the Florida leucothoe.</p>
        <p>A. Florida leucothoe (Leuct^hoe populifolia) is a native, txtiad-leaved evergreen shrub that did not receive the attention is desorved until the winter of 1984-85 killed or killed back many other broad-leaved evergreens and left it standing uninjured as a strong candidate for more</p>
        <p>widespread use in the landscape. Florida lei</p>
        <p>nunua leucotboe is a handsome, large shrub reaching 6 to 10 feet tall in cultivation. It bears cream-cohxed flowers in late spring. Though it normally grows in shady areas in nature, ciutivated plants do quite well in ftill sun if moisture is available. The leaves have not scourched here in Raleifdi even at below-iero degrees F. and in full sun. Florida leucothoe can be sheared to maintain</p>
        <p>Q. - I want to remove old calcimine before applying regular paint. How do I get it or A.  Wet the surface with warm water, then go over the area with a fine grade of steel wool.</p>
        <p>(Do-it-yourselfers will find much</p>
        <p>helpfiil toformation in Andy Langs handbook, Practical Home</p>
        <p>Repairs, which can be obtained by sending $2 to this newspaper at Box 5, Teaneck,N.J., 07666.)</p>
        <p>Leucothoes are members of the heath family (Ericaceae), the plant family that includes azaleas, rhododendrons and blueberries.</p>
        <p>Q. How many tablespoons of fertilizer should be added to the planting hole when planting a large shrub?</p>
        <p>A. Do not place concentrated amounts of fertilizer in the planting bole - it can seriously injure the roots. Please follow label recommendations on the fertilizer bag or box for time of application and what rates toapply.</p>
        <p>Q.How many leaves can I add to my garden soil, and how can I hasten</p>
        <p>thir decomposition? Four to 6 inches</p>
        <p>various heights and will gradually .....Mse.  well-</p>
        <p>thegardeni</p>
        <p>111 iMnirin n I</p>
        <p>pniDifsiiis 1 turned into</p>
        <p>spread by suckers in loose. aerated soils. It is very easily propagated by cuttings at most times of the year except when in active spring growth. It is adapted to Zones H.</p>
        <p>of leaves added to site should not cause any if they are wetted and into the soil as soon as possi-ip^ing nitrogen fertilizer (one pountT of 33 percent nitrogen per 100 square feet) wiU hasten decomposi-tiott. Since decomposition is an add-</p>
        <p>forming prooees. apply an equal ammJofWwitotbe^^</p>
        <p>hie.</p>
        <p>LaujE's</p>
        <p>Artificial Christmas Trees 6 Foot Balsam</p>
        <p>Fire resistant Sets up quickly Complete with stand #91101... &amp;gt;</p>
        <p>6Vk Foot Balsam</p>
        <p>Easy to set up Fully fire resistant Indudes stand #91107 .</p>
        <p>7^ Foot Balsam</p>
        <p>Easy to assemble Opens like an umbrella #91123.........</p>
        <p>IQQChrUMS</p>
        <p>UtMM</p>
        <p>2-WrPLUHW6</p>
        <p>, If one</p>
        <p>, ^ ssiSSSvim^</p>
        <p>Christmas liee Lights</p>
        <p>UL approved Indoor/ outdoor use Constant or flashing light Choose 35 or 100</p>
        <p>asset</p>
        <p>91112 . .</p>
        <p>100 Set</p>
        <p>91113</p>
        <p>$&amp;lt;|88</p>
        <p>^88</p>
        <p>Cordless</p>
        <p>Screwdriver</p>
        <p>$1599</p>
        <p>Charging stand can be mounted to wall or bench Reversible Locks for manual use #91705</p>
        <p>Rechargeable</p>
        <p>Vacuum</p>
        <p>Lightweight and portable ^hable</p>
        <p>dust filter bag s^'^l</p>
        <p>Cordless mount included UL approved #98694</p>
        <p>Jumbo Roll Christmas Wrap 50 Sq. Ft. Roll</p>
        <p>Cheerful Christmas odors and patterns Brighten up all your hdiday gifts #91131</p>
        <p>Holiclny Savinqs Everyriny From Lowe s</p>
        <p>1.000</p>
        <p>liUHIs viwUlt</p>
        <p>Louies</p>
        <p>moDB 2728 Mmorlal Drive</p>
        <p>Qreenville 756-6560</p>
        <p>I</p>
        <pb facs="00096780_0039" />
        <p>The Dally ReWector, Qreenvtite, N.C. Sunday. November 22.1987 B-j,;, Environmentalists At Odds</p>
        <p>By JEFFBARNARD ^ Associated Press Writer GRAra PASS, Ore. (AP) - Forestry (mials are racing against in-sects and fungus to salvage timber {charred in Oregons biggest forest Hire this year, but environmentalists |say logging tne area would be like  mugging amirn victim. t Envii^onmentalists object to con-^structii^ of a road into the North</p>
        <p>reach some of the lumber that in a massive fire sparked bv Aug. 30 near the South Fork Silver Creek in southwestern pOregon.</p>
        <p>I With other fires threatening populated areas, firefighters couldnt be at first to stop a blaze runnii^ remote country, and by the time the fire was controlled Nov. 9 it had burned 96,500 acres.</p>
        <p>More than half of that was in the KalmiopsiS Wilderness, where logging is banned. The salvage plans concern the 46,000 acres outside the wilderness area, where 175 million board feet of timber died in the Silver</p>
        <p>T!ie challenge to the U.S. Forest</p>
        <p>2 ' ^</p>
        <p>z Hpi/iton Post Sold</p>
        <p>^ DAXAS (AP) - HediaNews  Gnmp Inc. has cinnpleted the pur-</p>
        <p>1 chase of the HousUm Post fw $150</p>
        <p># million, company President William f Dean Singleton said Friday.</p>
        <p>!{ Singleton said original plans to pay</p>
        <p> Post owner Toronto Sun p Cnp. of Ontario $150 million</p>
        <p>2 was revised to allow the payment of $100 million in cash now and a $50 million five-year interest-bearing note.</p>
        <p>Sun PubUshing also will be paid an additiQoal amount on March 31,1993, ^ based on girass newmper revenues I of the Post over a five-year period ^'ending Dec. 31. 1992, or $1.25 for % every $1 of additional newspaper  revenue over an annual base whicb I approximates the current 1987 estimated revenue.</p>
        <p> The acquisition of the Post is the</p>
        <p>* latest of SingleUms major acquis-P tions, begun in 1986 when he bought I the Dallas Times H^d from Times I Mirror Co. for $110 million.</p>
        <p>I Singleton also is acquiring the iDenverPost</p>
        <p>I Both the Houston Post and Times I Herald are second in circulation in t their markets, but Singleton noted I the Post purchase puts MediaNews in I thetwo largest maikets in Texas.</p>
        <p>Service and the U.S. Bureau of Land Management will be to lay out salvage sales within two years so Uie timber wont be ruined by fungus and insects.</p>
        <p>Tim is of the essence, said Mike Burrill, president of Eugene F. Bur-rill Lumber Co. in White City. We cant fool around here.</p>
        <p>Environmentalists predict that because the fire burned the decaying greenei7 that shields the fisrest floor, Ui^e will be a vast increase in sediment running into the Rogue and Illinois River systems, damaging spawning beds for salmon and steelhead.</p>
        <p>They say that increased erosion caused by carving access roads into</p>
        <p>the steep slopes above Silver and In-^0 creeks and the process of dragging logs up the sl(^ would aggravate this and be an environmental disaster.</p>
        <p>Hie timber industry wmt gain anything economically by logging the North KalmiopsiS, said David Atkin, a lawyer for the Oregon Natural Resources Council, which wants to create a Siskiyou National Park in the area.</p>
        <p>But the fishing industry stands to lose a great &amp;lt;teal,  the south coast</p>
        <p>commercial fishing and the outfitters and guides on the Rogue River, he said. Logging an area like this after it has been burned would be like mugging a bum victim. </p>
        <p>f Hie constitution of Frances Fifth I Republic came into force in 1968.</p>
        <p>JACKHAMMER DUET - New York Mayor Edward Koch, left, and Carnegie Hall President Isaac Stem make some load music together at official groundbreaking ceremonies for a 59-story building which will be the first addition to the famed concert hall in New York since 1896. The commercial building will include dressing r(wms, musicians lounges, rehearsal areas, reception areas and an expanded lobby, as well as commercial office space. (AP Laserphoto)</p>
        <p>PIANTERS BANK, N.C-A grandmother has singlehandedly captured two bears.</p>
        <p>The woman apparently entered the bank and deposited $1,(X)0 or more in a new Planters Savings Account or Investment Account (with a variety of maturity terms to choose from). Conflicting reports say she</p>
        <p>opened a new Planters Money Market Investment Account with $2,500 or added $1.000 to an existing Planters</p>
        <p>Planters Bank.</p>
        <p>()iir Reputation h Cnnving</p>
        <p>Saving or Investment Account .*</p>
        <p>All witnesses agree that she got a free Sugar Bear Some even say she received i\w free bears (for a Savings or Investment Account depiosit of $5,000or more**).</p>
        <p>Further details will be released at your nearby Planters Bank Capture your Sugar Bear today.</p>
        <p>The Forest Service says it wont have time to build enou^i roads to salvage all the burned timber in the North KalmiopsiS, and Su RoUe, leader of the Siskiyou National Faest recovery invject for the Silver fire, said roads probably will be built around less controversial places.</p>
        <p>Much of the salvage log^ will be done using helicqpters to pet to the timber before it rots, said timber staff officer John Hoffman. And if the fight goes to the courts, the Frnrest Sorice loses. By the time it would come up for trial, the commercial value &amp;lt;H the timber would be rotted away, Hoffman said.</p>
        <p>The Natural Resources Council</p>
        <p>doesnt plan any legal stalling tactics, but will keep watch on the Forest Service, Atkin said. "The Forest Service by law has to protect water quality and fishery habitat on the Rogue River Basin.</p>
        <p>If we feel that they arent meeting the requirements of the law, we definitely will file a lawsuit.</p>
        <p>Parts the Nmth Kalmiqpsis have bcn proposed for wilderness protection since 1964, and in 1983 nearly 50 pe(qde were arrested in a series of Iterth First! protests over construction of the Bald Mountain Road.</p>
        <p>After a fedmral |udge temporarily blocked coiBtnKtimi amid argu</p>
        <p>ments over environmental impact statements, the Forest Service agreed to stop building a 14-mile road that was to provide access to 200 mil-li(Mi board feet of timber.</p>
        <p>Because of the scrutiny, the Forest &amp;amp;rvice is being very careful, bringing in extra personnel from arcmnd the country to assess the en vironmental impact of the fife, salvage logging and reforestation, said Ms. Rolle.</p>
        <p>We just have a very short time frame before the snow flies to do this inventory, she said. We want to emphasize we plan to do an extensi ve public involvement process. </p>
        <p>Saiellife Has Panel Woes</p>
        <p>KOUROU, French Guiana (AP) -A West German telecommunications satellite failed to dq[)loy one of its two solar panels Saturday, hours after being (daced into orbit in a porfect laun^ by Europes Ariane rocket, officials said.</p>
        <p>French Premier Jacques Chirac praised the lerfomiaiice of the 20th Ariane mission as a symbol of European efficacy while a West German official said the solar panel problem on the TV-SAH satellite was not dramatic.</p>
        <p>TV-SATl was placed in transfer orbit Friday night 19 minutes after the late ni^t liftoff of the Ariane 2 rocket from its South American jungle base.</p>
        <p>It was the Ariane programs sec-(md successful launch foUowing a 16-month hiatus in which all rockets were grounded due to technical problems.</p>
        <p>The launch appeared to confirm Ariane as the wests only regular satellite launcher in the lucrative market of putting commercial satellites into</p>
        <p>West German technicians in Kourou did not appear upset by the</p>
        <p>satellites performance.</p>
        <p>Andreas Langemeyer, head of the TV-SAT iHoject fm* the West Goman government, told reporters maneuvers could be attempted in space to get the panel into place.</p>
        <p>The situation is not dramatic at all, said Langemeyer. It is simply abnormal. A team of engineers is studying the problem. Nothing is lost.</p>
        <p>He noted that the two solar panels are not to be completely deployed until the satellite reaches its definitive (Htit at 22,500 miles - in about 24 days.</p>
        <p>Technicians, therefore, have time to right the faulty panel, he said.</p>
        <p>Gerhard Komo*, director of the French-German consortium Eurosatellite which built the TV-SATl, said a similar problem years ago was strai^tened out in about two weeks.</p>
        <p>At worst, if we do not succeed in deplqying the panel, the satellite could stiO function, but with half its po^, therefore with half of its television channels, Kmmer said.</p>
        <p>TV-SATl, which will serve four</p>
        <p>television channels, is to provide what is being billed as the highest quality image to up to m million viewers around Europe It is to go on lineearly next year.</p>
        <p>The cost (rf launching the $108 mi! lion TV-SATl is $97 million. The sat ellite is expected to last for lo years.</p>
        <p>We have here one more proof that man is not master of everything,' Kornersaid;</p>
        <p>Fredffic dAllest, president of Arieanespace, the commercial arm of the European Space Agency, said the launch itself went perfectly.</p>
        <p>Its a great satisfaction," he added.</p>
        <p>The Ariane program was restarted Sqpt. 16 when the 19th launch placed European and Australian com munications satellites into orbit. The National Aeronautics and Space Administration [H-t^ram in the United States, Arianes chief competitor, was halted after the January 1986 ex plosion of the space shuttle Challenger. The United States has reverted to convoitkmal rocket laun chers like Ariane, but has not been launching satellites regularly.</p>
        <p>*DrBO(s madr or accounts opened bv trflni/er o)jundi Jrom existing Planter s 8anfc accounts do not &amp;lt;(uali/y for this t^er   one free hear per customer</p>
        <p>with qualify tn deposit Limit two free bears per customer with $3.()00 tiualifying deposit These bears are rare!  Mu! ftoC</p>
        <p>OurReputatk)nMay&amp;gt;fotBeEti^^ In Stone, But Our Cliente ^)eak Ibr</p>
        <p>Ittheres one thing that Farrior and Sons has V.yUi l\l^L)LlLciOLK[ ! built thath rock solid, its our reputation. Its a</p>
        <p>reputation thats backed by over twenty-five years of experience in the general contracting and metal ^rication business.</p>
        <p>Through dedication, precision, and strict attention to detail were proud of a solid reputation for quality workmanship in every job we undertake. Because we commit ourselves to meeting hig^ standards of quality, our clients speak for our reputation.</p>
        <p>"I am particularly impressed wii the excellent quality level of worlpnanship which Farrior and Sons, Inc maintained dmmghout the project. Additionally, your professicnial man agement staff attended to every detail and made the pb flow smoothly."</p>
        <p>Richard T. Dunning Ronald McDonald House</p>
        <p>"From the earliest negotiations to the completion of the construction, we found FarrUrr and Sons, Inc. to be exc^tkmally well managed and professional at all levels."</p>
        <p>H.H. Humphrey, Jr.</p>
        <p>Project Manager Virginia Power</p>
        <p>"Ufe am truly say that your company gave us the highest quality of worlpnanship. The materials and labor luwe more than met our expectations.</p>
        <p>Hubert N. Edwards Unity Freewill Baptist Church</p>
        <p>We would like to take this</p>
        <p>ity to thank all the businesses in Eastern North Sons, we commit ourselves to living up to our</p>
        <p>Carolina for their confidence. At motto, Equality builders of the East. lb our friends in Eastern North Carolina, we ook forward to our next twenty five years and continuing to build a superior reputation.</p>
        <p>(IJuaty Builders Of The Eiist</p>
        <p>I</p>
        <p>I</p>
        <p>I</p>
        <p>i</p>
        <p>aSONRlnc.</p>
        <p>ESTABUSHED1962 Industrial - Commercial  Institutional</p>
        <p>HigliiMsy264Witt* P.aBox127  Fvmvil%NC27828 (919)753-2008</p>
        <pb facs="00096780_0040" />
        <p>% . ajtaai</p>
        <p>nw tXMy Wf lector. QrenviHe. N.C.  Sund.Business Notes</p>
        <p>-</p>
        <p>^BuHh0$s Opens</p>
        <p>^ Marion Williams of Greenville an-Bounced that she is now</p>
        <p>Soonies Fashions, formerly Lorraines v Fashions, at 235 Lee St., Ayden.</p>
        <p>A ribbon cutting marking the transfer of ownership for the business was held recaitly.</p>
        <p>Ms. Williams said that store hours are from 9:30 a.m. to 6 p.m. Monday through Saturday.</p>
        <p>TIk new owner, who is a native of Rocky Mount, was formerly associated with Brown and Wood Inc. in Greenville. She is a member of Arlington Street Baptist Church.</p>
        <p>G-IV Promotion</p>
        <p>David Clifton of Grady-White Boats IiK. in Greenville has been {ffomoted to lead person in the assembly II department, the firm has announced.</p>
        <p>As lead person, Clifton will assist in the supervision of the boat building</p>
        <p>area,&amp;lt;</p>
        <p>CliifUm has been with Grady-White Boats since 1965.</p>
        <p>Greenville Location</p>
        <p>Kenneth J. McGee, president and chief executive officer of McGee Reprographics &amp;amp; Drafting Suroly Co. of Wilmington, announced that the firm has opened a store at 801 DicUnson Ave. in Greenville.</p>
        <p>McGee, who founded the company in 1982, said McGee Reprographics offers retail/wholesale sales of architectural, engineering and surveying surolies and equipment to the design and graphic art industry.</p>
        <p>count representative at Spectator Magazine in Raleigh and has been a writer in the marketing depuiment at Durham County Hospital Corp.</p>
        <p>She received a bachelors in journalism from the University of North Carolina at Chapel Hill. She and her husband reside in Greenville.</p>
        <p>New Senior VP</p>
        <p>Burney S. Warren III, president of First Federal Savings and Loan Association of Pitt County, announced that Sue S. Creech has been elected senior vice president by the rums board of directors.</p>
        <p>Warren said Mrs. Creech is responsible for branch administration, marketing, deposit administration and persimnel for the company.</p>
        <p>Official Retiree</p>
        <p>John Shannonhouse, general manager for Whites Stores and Carolina Bfills Fabrics since 1964, was honored recently with a retirement party given i^Bfr. and Mrs. Carlton Inylor of Greenville.</p>
        <p>Baeineeeman Cited</p>
        <p>Gov. James G. Martin recently preMnted a 1967 North Carolina Entrepreneurial Excellence Award to John Roberts, president-owner of Roberts Welding Contractors, Winterville.</p>
        <p>Martin said the award recognizes special achievements on the part of outstanding North Carolina en-trareneurs and small businesses. Rooorts received the houHr after his firm was recognized as one of the 500 fastest grawing businesses in the United States by INC. Magazine.</p>
        <p>Hie fourth anmial Entrepreneurial Excellence Award presentations, hdd in Chapel Hill, recognizes the development and marketing of new products and technote by North Caroliiia businesses. There were 55 individuals and firms hoiKHred this</p>
        <p>said. He has rejoined the bank as assistant vice president.</p>
        <p>ARA Designation </p>
        <p>Ann McRoy and Bfitch Gurganus, appraisers with Appraisal Lto. in Greenville, received *^Ac-credited Rural Appraiser designations at the American Society of</p>
        <p>Farm Managers and Rural Appraisers national convention recently to San Antonio, Texas.</p>
        <p>The ASFMRA said Ms. McRoy and Gturganus nrmared ioe and passed testing iMxicedures and meet the sodas standard of professional</p>
        <p>**ASfSra, established to 1929, is me of the oldest af^raisal and land mangement organizations to the United States.</p>
        <p>SUES. CREECH</p>
        <p>Mrs. Creech has been associated with First Federal since 1963, serving the past 24 years to various areas of the company. She and her husband, Jeny, have two children, Lisa and Ncad. Hiey are members of Memorial Baptist Church.</p>
        <p>Fqmiliarixafion Trip</p>
        <p>Pat Anthony of Quixote Travels Inc., 319 Cotanche St., returned recntly from a trip to London that was designed to familiarize travel agentswithwiththedty.</p>
        <p>^Hie trip tochided stops at Windsor Castle, the Tower of London, Buckingham Palace and various hotel inspections.</p>
        <p>JOHNSHANNONHOUSE</p>
        <p>Taylor presented Shannonhouse a plaque to appreciation of his years of service to the company. Fellow employees also presented the retiring omdal a gift.</p>
        <p>^nnonhouse told friends and company employees gathered at the Comfort Inn that he plans to pursue various smidce related activities to his retirement.</p>
        <p>The Taylors recently acquired the businesses from heirs of the late Sam White.</p>
        <p>Commercial Poet</p>
        <p>Century 21 Janet Bowser &amp;amp; Associates announced that James E. Hill has joined the firms staff as sales associate to charge of commercial real estate.</p>
        <p>Hie firm said Hill has 10 years experience in business with a background to management, sales and marketing.</p>
        <p>Hill is a 86)^ designated member of the Natkmal Association of Real Estate Appraisers with a designation to residential and commercial properties. His educational background IS to business administration and accounting.</p>
        <p>Hill and his wife, Quisty, have two dau^itars, Ifichelle and Meredith, and are monbars (tf the United Methodist Church of Grifton. They have resided to GrifUm for the last</p>
        <p>Session Gnduates</p>
        <p>Enust Buddy Holt II and Moulton B. Massey ID, (Xhowners of the Midas Muffler &amp;amp; Brake Shop at 3519 Memorial Drive, graduated recently from the Blidas Institute of Technology to Palatine, HI.</p>
        <p>The institute, owned and operated tw Bfidas International Corp., oCfoed Holt and Blassey a one-week session on Deliver the Blidas Promise, which trains personnel to meet consumer needs. The course covered 23 subjects from accounting to wheel ahgDment.</p>
        <p>SiCto</p>
        <p>STEVE TODD</p>
        <p>In addition, the spokesman sajd, rq;Ht)gra|toic services offored include bfueline printing, contact, laminating, mounting, nucrofilmtog, Xermting and large document electrostatic repro^tion. McGee said the firm also offers sorvice technicians to service print machines and graphic art equipment.</p>
        <p>BicGee adhounced that Steve Todd fnun Wilmington has bera named manager (rf the Greenville store.^ Todd was formerly with the con-sidting oigtoeming firm (rf Talbert-Cox Associates for over 14 years and joined McGee in 1966.</p>
        <p>The manager, who received</p>
        <p>bachelors d^fiees to psychology and philosophy from the University North Carolina at Wilmii</p>
        <p>fnun the</p>
        <p>  ..  rolina at</p>
        <p>resides to Beaufort County wiu his wif, Blary, and their two children.</p>
        <p>McGee is married, has two daughters and resides in Wilmington.</p>
        <p>Account Executive</p>
        <p>Biark Rosenberg, president of East Coast Creative Designs Inc., announced the addition of Nancy C. Ingalls as account executive.</p>
        <p>Rosenberg said Bfs. Ingalls will represent accounts and assist clients with advertising and marketing pro-</p>
        <p>rns. She will also be involved in creative processes and planning and develofmient services provi(M by the agency.</p>
        <p>Bis. IngalLs was formerly an ac-</p>
        <p>Leaderehip Seminar</p>
        <p>Claudia Purser, manager of the Hair Phis Sak at Caroltoa East BlaU, attended a twinlay meeting to Charlotte that attracted more than 90 managers of sakms operated by La Mar Beauty System.</p>
        <p>Ken Dorman of Redken discussed Reflections on Salon Management, ^Communication  Blanagements Most Vital Tool, and Bfotivation - The WUl To Blake It Happen. Jo Pattishall, consultant to personal development, spoke on ^'Professional Image.</p>
        <p>La Blarick Beauty System, founded SOyears ago, is based to Charlotte.</p>
        <p>RRot Participant</p>
        <p>Ray Breem of General Heating Inc. to Greenville was one of 67 technicians to the heating-ventilation-air conditioning indust^ chosen to take part to a pilot program aimed at reducing energy costs.</p>
        <p>The program, sponsored by N.C. Alternative Energy Corp. in Research Triangle Pan, focused on improving installation and service snUs, with the goal of more efficient energy use.</p>
        <p>Training took part at Montgomery Community College to Troy, with four weeklong sessions providing each technician with 40 hours of handsH experience and classroom instruction.</p>
        <p>A spokesman for AEC said it is h(^ that the pilot project will lead to a permanent program at MCC.</p>
        <p>_IC Industries conmaiL, is headquartarad to Chtoago. There are over 2,000 shops worldwide to the Blidas franchise system, the com-pujrsaid.</p>
        <p>ASTA Membership</p>
        <p>John F. White of IT6 Travel Center of Greenville has been accepted for membership to the American Society of Hravel A^ts Inc., according to Art White, president of the firm.</p>
        <p>White said ASTA is the worlds largest professional travel trade association with over 21,000 monbers to more than 128 countries. He said that among the benefits available to ITG Travel Center as an ASTA member are participation to educational seminars and access to a consumer affairs department</p>
        <p>The ^esman said that ITG Travel Cteter, located at The Plaza, specializes to corporate and vacation travel and has operated to Greenville stoceioes.</p>
        <p>Group Preeident</p>
        <p>Anne Sneed, president of Annes Temporaries Inc., was recently elected president of the Greenville Womens Business Owners Association.</p>
        <p>Ms. Sneed said the group wiU meet regularly to offer women entrepreneurs voluntary support and information as they plan, oegto and operate their businesses. The group offers education, networking and social interaction among women to business, she said.</p>
        <p>For more infbrmation about the association contact Bis. Sneed at 756-6610.</p>
        <p>New Qty Executive</p>
        <p>John R. Bunting III has been named dty executive of Wachovia Bank and Trust Co. to Robersonville, ac-cord^ to BID Baggett, regional executive.</p>
        <p>Bunting joined Wachovia to 1978 as personallianker to the Bethel office and was promoted to branch manager of the Aulander office to I960. In 1982 he served as branch manager to Ahoskie before being named retail banking manager to 1964. Later to 1964 he resigned his position to pursue other opportunities, Wachovia</p>
        <p>JOHNR.BUNHNG</p>
        <p>A native of Bethel, Bunting is a 1976 graduate of North Cardtoa State University.</p>
        <p>CPCU Deeignation</p>
        <p>Tina Saleeby has been awarded the professional msurance desi^tion, ^Chartered Property Casualty Underwriter, according to Dr. Norman A. Baglini, president of the American Institute for Property and Liability Underwriters.</p>
        <p>The institute awards the designation nationwide to those who complete a KkXMirse program and meet academic, ethics and experience requirements.</p>
        <p>Bis. Saleeby, an East Carolina University graduate with a de^ to management, is employed with Insurance Agency Services to Raleigh. The former Tina Longnecker, she is the daughter of Dr. and BIrs. Robort A. Klein of Greenville.</p>
        <p>Ms. Saleeby and her husband, Robin, rede to Raleigh with their dau^ter, Ashton.</p>
        <p>. of Raleigh an-of its enij^oyees ertificationsmim</p>
        <p>ICSC Certification</p>
        <p>J.M. Kane &amp;amp; Co. nounced that three received industiy certifications I the International Council of Shopping Centers.</p>
        <p>The onnpany said that Nathan R. Blilian of Oaytim and Sam L. Grist m of Wasmngton, N.C., received Ceitified ShopM Center Blamto-er designations, while Chrles E. Milian of Raleigh received his Certified Blarketing Director designation.</p>
        <p>(Please turn to B-22)</p>
        <p>Cash Registers</p>
        <p>&amp;amp;CoMpiaers</p>
        <p>Sales Rentals Leasing</p>
        <p>Century LkUa Systeme 2801A S. Evans SI Greenville/756-2215</p>
        <p>omRon</p>
        <p>fact...</p>
        <p>e WgpmducBmon captes than any other copycenlerm Eastern North Carolina.</p>
        <p>e Ow average chuge perooppialeaatfm 3^/ie per copy.</p>
        <p>e 9S%olourcopg orders are picked up thesamedaylheyan placed.</p>
        <p>ShouUnl YourNextCopyJob BeCopieclByA Professional?</p>
        <p>ACCU^</p>
        <p>SSCOPY</p>
        <p>tnaNuiiEajinlaGiagtimShefr</p>
        <p>Hanllloii-JhnQmU:fHS7;StiMI</p>
        <p>750-2400</p>
        <p>Season to Season</p>
        <p>We serve all your financial needs:</p>
        <p>Savings accounts Certificates of Deposit IRAs</p>
        <p>Home Equity Line of Credit</p>
        <p>Mortgage Loans Home Equity Loans Home Improvement  Loans</p>
        <p>Consumer Loans</p>
        <p>Interest Paying Checking Accounts-</p>
        <p>55 and Over "Free Checking  Accounts</p>
        <p>,Call us today for the best rates available</p>
        <p>HOMe FCDCRAL SAVMGS</p>
        <p>AMD LOAH ASSOOMIMI</p>
        <p>OF EASTERN NORTH CAROUNA  XS,</p>
        <p>m</p>
        <p>Downtown Qroonvlllo 76S&amp;gt;3421 Arlington Boulovurd 756-2772</p>
        <p>Weve Kept</p>
        <p>Over Forty Years</p>
        <p>By providing top-of-the-line products such as Havoline from Texaco, combined with dependable, dedicated service, Godwin Oil has become one of the largest oil suppliers in the area.</p>
        <p>Were committed to meeting your needs. For the individual consumer or the large corporation, well provide the quality products and service youre lookir^ for at prices you can afford.</p>
        <p>Godwin Oil. It makes sense to put our years of experience to work for you. After all, weve kept you running smoothly for over forty years.</p>
        <p>Call (jodwin Oil Company today at (919) 734-6226. Thats your number for bi^er savir^sand better oil.</p>
        <p> GODWIN^</p>
        <p>OILCOMPANY^n</p>
        <p>501 North James Street Gddsboiu NC 27532 (919)7346226</p>
        <p>Tixneo</p>
        <pb facs="00096780_0041" />
        <p>The Piaiy Reflector, Greenville. N.C. Sunday, Noyefhber 22,1967 ^.-(9Weeks Stock Markets</p>
        <p>NEW VORK (AP) - Nm York Stock Ex-choiiRi IrwRng tor tko rook ootoctod</p>
        <p>MARKET REPORT</p>
        <p>Pt kOi Hifk Low Loot Ckf.</p>
        <p>AMR  tvm m am aiu-avt</p>
        <p>ARXi  7M90 7 M tik-tk</p>
        <p>ASA 2o 2M4 4SM 4M 4Mk- AbtUb 111117 47  441k 4Mk&amp;gt;1i</p>
        <p>AoMLI 2.M 71471}SMk 47M 47 -11k AhrPrd 1124711 341k 34 3S14-Ik AlikAIr .14 113401 14 13 13- Aleono 4SI 12 37S0 2S 23 14-k  AtooSo .4I10 X4041 17 II II-</p>
        <p>Activity ovr the past 30 trading days</p>
        <p>Atalnt 4 5 4 S -  AHgPw 2.71 M2I13. 31 37 ^ </p>
        <p>7H3414M72 70 71-!-  il Ij 7 x41404 23 27 30-)- </p>
        <p>1434 1d1 I Alooo 1J0 17341 44 40 44-t-  Amox 41421717 14  17 T1</p>
        <p>AmHoo JOl 020403 24 23 S-1 AmBmd2J0IO442S 43  40 41-</p>
        <p>ACywo1A413x11437 30 34 34- AE1Pw2Mo 714722 24 24 24 4-  AE)0 .74 1440434 24 23 24 -I AFofflloJ4 12 47IO 13 12  13-f </p>
        <p>AHomo 3J4 12 7723 72 m 47-1 Amrlco 4 117747 04 04 04 AlnlGr JO 1214407 44 40 43T  AmStd IJO 73203  34  34  34- </p>
        <p>AmSlor  A4 134431  47  41  43 -4</p>
        <p>AT&amp;amp;T 1. 21 mm 27 27 2I-I AfflOlOk  1 14 1421  24  2M  24 -</p>
        <p>Amolk 0  40 14 3H  13  12  12</p>
        <p>Amoco 3J0 IS 20440 40 44 47</p>
        <p>AMP .70 2214142 44  41 44 +3</p>
        <p>Anocmp  174400  S  4  4-</p>
        <p>Anodrk Jl x747423 21  22V&amp;amp;-1</p>
        <p>Anhouo 40 1424043 32 27 307k- Anthony 44 4 271 10 7 10 f  Ard)On.Nb121S7k4 20 II 177k- Armco  47147  7  I  17k-</p>
        <p>ArmWI  .70 77404  30  24  27-1</p>
        <p>Auroo  0 7777  24  23  237k-1</p>
        <p>AthKMI 140 123714  43  40  S17k-1</p>
        <p>AttRlch 4142UI7 74 47 71-1 AttoiCp  72 207  34  32  32Vk-1</p>
        <p>Auoot  40 241771  14  13  I37k-1</p>
        <p>AVXiCl  .21 101473  II  17  II 4- </p>
        <p>Awrvs  .42 143134  II  17  11+ </p>
        <p>Avnot  JO 341121  24  20  22-1</p>
        <p>Avon t 2 11x1112724 23 24 +  Aydin 10 223 30 17 17-  -i-B-Bkrttun 44 30070 14 II I2-1</p>
        <p>MeOM I J014 22722 44 43 44 +  McOhO 2J2 XI13I741 41 47-  McGrH 140 17x11217 47 42 S3 -1 MclCm  1.31142474  27  27  21</p>
        <p>MMd I  .174 1411747  30  27  27-l</p>
        <p>mm  141 3034  32  30  31-!</p>
        <p>Spm  1.74 113017  44  42  42-</p>
        <p>lirdto.70 101143 30  33  34-!</p>
        <p>Mirck IJO 2020434171 147 l72-3 MirLvn I 424742 23d30  20-1</p>
        <p>NKijt 427173 0dl  I-</p>
        <p>MWE 1J2121I04 17 17  17+</p>
        <p>MMMI 14414x3101144 40  44 +3</p>
        <p>MlnnPL 144 71374 23 22  227k-</p>
        <p>2J0U 44704 3I 33 37 -  Moniin240 13l4W 73 40 707k-l</p>
        <p>Weekly Stocks In Spotlight</p>
        <p>NEW YORK (AP) - Yeorly high-low, wookly saloi, high, hw, cloiing prko ond not llvo iiocks trading lor moro Ihon n:</p>
        <p>chango of Iho 20 most activo Wgb Low</p>
        <p>44 27 GTE S.........</p>
        <p>Salos High Low Ust dig.</p>
        <p>  -  -  A</p>
        <p>B^Mf  &amp;gt;4^  &amp;lt;3  13-  </p>
        <p>1.70 711413 32 30 307k-1 BncOno .72 114742 22 21 31 BkNY IJO 104144 30 27 2l7k-l BnkAffl  14214 0 I  I</p>
        <p>BauiCh .04 14 4044 37  34 36+l</p>
        <p>Baxtor  .44 20 30440 23  21  22+</p>
        <p>Bacor  44j  4171 13  13  13 -</p>
        <p>viBokor  404      f32-1-32</p>
        <p>BolHwl .43 127344 40 41 47+! BollAtl 344 11 13474 49 47  47 - </p>
        <p>BollSos 2.20 II24437 30 37 37- BenfCo 2 2424 37 37 31 -1 BongtB  131714  4  3  3-</p>
        <p>BastPd  7340  7  4  7+  </p>
        <p>BolhStI 411020 13 11 12+ Bovriy  .20  10134 7  I  7 -</p>
        <p>Blacfcb . 147427 17  14  14-l</p>
        <p>BIkHRs I07W 24 23 24+! Booing l. II 20422 37 d2l 34+  BoiSoC 1.10 124473 43 47 42 +  BoHa pK3J0 120 S3 41 41-  Bordan 1JI 137473 44  44+  BoslEd 1.12 12720 17 19 19-  BristMs1J0173ll4l 39 37-1 BritPt 2.71a 1113110 44 42 43+1 BrwnFl22l3771 24 22 24- BmwksJO 017904 14 IS 14-! BrINth 2.20127447 57 44  44-2</p>
        <p>-C-C -CBS 3 11x7471 177 141 I42-10 CIGNA 240 412047 42 47 40-1 CMSEn 73411 13 13 13</p>
        <p>CNW 1II0I47 24 23 24+1 CPCs IJ4 712494   37 31 -</p>
        <p>CRSSi .24 11 143 12 II II- CSX 144 10x279 29 24 24 +  Caasar 131M417 14 17+! CamSp 140142710 41  44 S7+2</p>
        <p>CapCits .20 22 4404 320 277 3l4+4 CarPw tn 74471  33  33  33+  </p>
        <p>CartHn  13144 0  7  l+</p>
        <p>CaotlCk  200314  17  14  M-</p>
        <p>Calara JO 10434410 40 44 47- CantEn 2J4 410403 17 17  17+ </p>
        <p>C0nSoW2JI 07413 30 27 30 +  CnIIPS L72 1114447 21 20 20</p>
        <p>..17,434400 36 34 34+ 1</p>
        <p>17 11NlaMP................................... 14444400  13  12  12- </p>
        <p>34 22 AT&amp;amp;T.....................................................10,107j00  27  27  20-1</p>
        <p>174 102 IBM........................ 7,444,400  123  114  117- 3</p>
        <p>44  37GonEls....................................................4,7,IOO  47  43  44-  </p>
        <p>40  33  Exxon $.....................................................7401,400  41  31  -  </p>
        <p>70    EKodks....................................................4,907400  40  46  47-  1</p>
        <p>30  17  CnIIPS.......................................................6446,900  21  20  20</p>
        <p>42 37ConiEd ................................................4444400  44  - </p>
        <p>34 15Cltlcrps....................................................4,311,700  20  17  19- </p>
        <p>  27  AMSgnl.......................................................4,160,400  33  29  30+  </p>
        <p>40  20AExps......................................................44,400  25  22  24  -  1</p>
        <p>27  10  PotmEs ..........................................4433,300  23  21  21-1</p>
        <p>33  14  McDorl.......................................................4,710400  16  15  16</p>
        <p>44  32  Mobil...........................  .....4,490,400  30  33  37  -  </p>
        <p>40  24  Unbws.....................................................5,393400  33  29  30  -  2</p>
        <p>4  1StorTch.......................................................5,327,200  1  1  1-  </p>
        <p>  21Chry$$......................................................5412,000  24  21  23-1</p>
        <p>II  10  PhllPot.......................................................5402,700  11  10  10-  1</p>
        <p>27 14 PacGE..................  5471,200  17  17  10 + </p>
        <p>EaslGF IJ0 33 3302 22 21 EKodk 11.00 1449076 40 46 Eaton 2 97724 69 44 Echlln  .4414 00  14  13</p>
        <p>EmrtEs 1 14 x21137 30 21 Enron  241 2103  30  34</p>
        <p>Ensrch 40 39x6911 17 14 Elhyl  40127W  10  16</p>
        <p>Exxon t 2 1276014 41 30 - F-F-FMC 7 3241 31  34</p>
        <p>FPL Gp 2.12 1014602 31  30</p>
        <p>Falrchd  .20 ISM  7  7</p>
        <p>Fakrtd  432  4  4</p>
        <p>Fadars  .24 131397  6  4</p>
        <p>FadNM 42 1024334 30 27 FadOSs1. 1014007 34 32</p>
        <p>2Hk- 47-1 61 +1 13- 30+! 3S-2 14- 17-  -</p>
        <p>FInCpA 12427 2 I FnSBw .10</p>
        <p>2</p>
        <p>24</p>
        <p>27</p>
        <p>9</p>
        <p>2</p>
        <p>2-  26-  30 +  9+  3+ </p>
        <p>CanlrCp  4174  2</p>
        <p>Crt-taad  1  I 443  27</p>
        <p>^ Chmpin 40 114470 30</p>
        <p>ChamSp 44a 11x327410 . CharK  32240  3</p>
        <p>. CIWH IM 12444 27 24 24-1 Chavrn 2J0173N3I 37 30 ChrlaCr 47123 774 M 14 14-  Oiryts 1 44312024df1 23 -1 ClrdaK  MU4107  W  7  7-</p>
        <p>CIrCly .00114447 22 17 21 - CmcrptlJS 43117 20 17 17- Cll^ 4177 24 21  23+1</p>
        <p>ClarOKS MI310 27 24 27 +1 COasflS 40 74024 27 24  2S7k-l</p>
        <p>I CocaCI 1.121433434 3Mk 37 MW+I Coloco  3014  4  4  4</p>
        <p>ColgPal 141N1244  37 37- Catn  44l  W  7  7-</p>
        <p>ColGai &amp;amp;1II44I37 37 37 37-1 CmbEn I1710 27 24 24 Comdra  N3644  0  7  7-</p>
        <p>CmwE  3  420710 27  20  2M-</p>
        <p>Comsat  IM  1647 24  24  24- </p>
        <p>ConsEdlN 74444 44  - CansNG IJO 173902 30 34 37+  CnrallnJ0all 19027 24 23 23-1 CnStor  I12S4I  4  3  3-</p>
        <p>CanM  2  IIW41I 27  27  20+ </p>
        <p>CntlCp  240  17774 41  39  40+ </p>
        <p>OM 13103 23 21 22+  Coopr 141 1410914 47 47  + ' CornGI IMM4990   44+  CrayRs 14 9742 71 44 47-1 CrwnCk 12 Ml MS N 77-4 CumEn 2M 323170  47  -  CurtW liO I 110 47 d44 tf -2 -D-D-OPL 2JI 03144 34 23  14+ </p>
        <p>OanaCplM 14x4347 34 34 34+3 OalaGn 4427 22 19 3I+1 OaylHd .72 7x2327030 27 -1 Osara JS 13774 31 20 31 OaltaArIM 414114 37 d34 34-1 OstEd 140 4MII4 IMb 13- Digital  14 37103134 123 ll6-</p>
        <p>Disnw JII426244 41 43 +  Domb 3J0 724340 44  43- Dovar 1.12II407I 47  41 44+ </p>
        <p>OowCh 2.30 1440440 01 71 +  DowJns 44 147112 34 32  33 - </p>
        <p>Drosr .  7747 23 21 22- </p>
        <p>duPOnt 3. 12 31433 14 71 I1-1 DuksP 2.N 1090M  44 44- DuqLt 1.30 1 44704 13 11 13 +  - E-E-ERC  M 027 7 7 I- </p>
        <p>4 314 4 4 FIrasIn I 1014123 34 32 FtBkSslJ0 2174l7 30 19 FC4^  3 2646  7  4</p>
        <p>FstOlicIJO 2M4 23 21 Fints 3J0  01  40  39</p>
        <p>FstPa 2774 7  0</p>
        <p>FtWachlM 71730 33 32 FMEn 40 7 II 17 14 FIghtSI MU1474 32 29 FlaPrg 2. 73474 34 34 FlwGan  31  072  4  3</p>
        <p>Fluor  7447  13  11</p>
        <p>FHrillG  0  4M  4  4</p>
        <p>FordM 4 44I70 77 73 FrplMclJM 7 4013 21 20 - fr-0-GAF .WI400H 44 42 GTEs 2J2 12 x1743m 36 34 Gannatti 11712I7I37 34 GnCorp IJO 12 763 71 47 Gnl^ 113I41B40&amp;lt;M4 GanEI s 1J2 ISS71 47  43</p>
        <p>Gnttous  J4I4  123  7  7</p>
        <p>Gninst JS 0670 24 23 GnOMIIs 1.40 1710400 47  GOOot  So 744033 41 40</p>
        <p>GME J21S4MI 34 32 GPU J4a 47233 24 23</p>
        <p>34 -I 30-  7-  4- 4-  27- 33- 2 -  4</p>
        <p>33- 20+  4- 21-1  + I-  32-</p>
        <p>t4Xh</p>
        <p>32 +2 34- 3-  12- 4-  74+  20-</p>
        <p>Hmslks .20 3320373 14 14 Honwcll 2 X12M4744 HCA .73I410M7 34 30 Hollins 2 171077 14 14 Housint 2 7 4423 43 41 Houind 3JI I73M 31 30 Human .00 1212071 22  20</p>
        <p>i II </p>
        <p>1C Ind JO 171III4 27 27 IRT IJ2 13x311 14 14 inCp I.2S II20477  44 lUlnl JO 172127 13 12 IdahoP IJ0 143401 23 22 IdaalB 1740 2 2 IllPOwr 2J4 47304 24  24</p>
        <p>ITWs . 143900 32 27 lm^3J7s 110290 76  47</p>
        <p>ICA JOr 2 164 7 7 INCO .20  11277 16 14</p>
        <p>lngarRdSlJ4 14x772132 29</p>
        <p>InMStl JOi 14 4214 23 21 IS 1J 102204 34 34</p>
        <p>Gi^ IJO 17 2049   30</p>
        <p>41171 3 3 GoPk IJO 017240 34 30 GorbPd 1J2 20X3M4 34 33 GIbrFn J2i 4412 4d 3 GilMosUso20740 31 M Claxon.24011x3791017 17 GkMug 30203 W 7 Gdrlch 1J4 74097 34 31 Goodyr IJO 4IS411S0  47</p>
        <p>Gould 34SI 13 11 Graca 2J0 7434  41 Gracswi 24 22 21 GtAIPc JO 141761 37  34</p>
        <p>GtNNk s .72 II 10417 37 34 GIWFns.n 424404 14 13 Grayh 1J2 4 4296 24 24 Grumn 1 13 4369 24  20</p>
        <p>GHWst IM 144670 47  GIfStUt 410411 4  4</p>
        <p>u_u _</p>
        <p>Halbln 1  19040  M 23</p>
        <p>HarMs J3 1727M 22 21 Harlay 4 4714 13  13</p>
        <p>Harris MI3x4IMM 24 vIHacks 1007 2 2 iklaM .040 74 x4731 12 11 Halhnn ,4M 22 277 40 39 Hakn 1J4 14100M37 34 Hsrculsl.73 37170 47 43 Hrshay J3 14 xl1712 26 24 HawlPk M22 403M43  Holibn 34760 22  19</p>
        <p>HollyS 1 12 370 74 70 Hmslka .20 30 1204 27  27</p>
        <p>43-  34+2 34- -2 47-2 - 7-  23-2 -l 60+1 33-1 23-  37+1 3-  31-2 33-  4-  27-1 II- 10 +  31-2 47+  12- -2 22 -1 34-l 37+l 14+  24 - 22+1 47- SVk-</p>
        <p>Intlk</p>
        <p>IBM 4.I474SS4123I14 IntFIav 1.24 144374  41 IntMIn I 2440 34 33 lntPaps1.10 10x23404 37 34 Ipak 1J4 102747 22 22</p>
        <p>JRIvar .W14024 23 M Jwkr  4  14 14</p>
        <p>JohnJn 140 10x20470 70 74 Joslan M 14 2714 10 14 -K-K-Kmrts 1.14 727713 30  24</p>
        <p>Kaisric .141 4MI ll 7 Kanab 2373 1 i KanGE 140 104290 19 19 KanPLsl44l014 24 23 Katyln  13 377 M 13</p>
        <p>KaufBs J3 42247 13 II KalkM 1J4 177763 M 41 KarrMc I.IO MIMS  31 KlmbCsl.1417S22S4 42 KnghtRd I 14 0494  37 Kopars 1.MMx43M33 30 Kratt IM 1522737  44 Krogar 1.04 14 4774 M 24 - L-L -v|LTV  4332  3  2</p>
        <p>LoarPt  MO  3  3</p>
        <p>LaarnI s JO 13  1  14  14</p>
        <p>LaarnI s 40 13 07 11 II LaaEnt J4 M 711 24 23 Lshmn&amp;amp;2k 2524 14 13 Lilly 2J0 1414904 71 47 LIncNtI 3J4 7 MSI 42 40 Litton 142S33 77  74</p>
        <p>Lockhd 1. 417427 37  36</p>
        <p>Loaws I I1 11070 74 60 LnStar 1.70 31900 21 21 LILCo  71443  I  7</p>
        <p>ULand 1  2177 Md2S</p>
        <p>UPac JOb 7 3333 20 M LuckyS 43a 44390 24  23</p>
        <p>Lukans JO 141474 44 M</p>
        <p>3-  3-  14 -  II</p>
        <p>24-  14 +  49-   +1 75-  34- 70-  21</p>
        <p>O-  24-2 26-2 23-  +4</p>
        <p>24</p>
        <p>219k-  12- 24- 2-  12 - 39-  M -1 -2 25 - 50- M-  70 -4 20-</p>
        <p>HCk JO</p>
        <p>MDU l. Macmll .73 MfrHan 3.M</p>
        <p>MarMM2J4 Marrlol .M MartM I.M IMasco JO Maxusn Maxam MayDS 1.14</p>
        <p>Maytag s.90 McDarI</p>
        <p>I.N</p>
        <p>30IM17 3I 13 39S 17 17 4471 S3 13H6 27</p>
        <p>1 3447 3 15x434042</p>
        <p>2477 02 21 13107 30 106174 </p>
        <p>1310174 24 9410 7</p>
        <p>2 O Ht I1 17424 31 11 7360 21</p>
        <p>57100 14</p>
        <p>34 34-1 10 17 +  44 42+4 37 M -1 3 2+  41  41-  </p>
        <p>03  02+  </p>
        <p>27 29+  37 37+  21 22+  7 7-1 9 7-  20  27-1</p>
        <p>17 20 - 14 16IGinpOrdrV mpowry offtc# worker. Here today. There</p>
        <p>^ tomorrow. And with each new assignment, the unAiinss that Qoas with tha unknown...unfamiliar paopla, procaduras, aqulp-ment. Thato why the Manpower System of matching temporaries to assignmenls It 0 Important, If enablei us to make ture each temporarys 11(1118. work experience and pieferences fit our customers need*. The result: a temporary who leek more confident andworks more effectively. When you have more  AMDOiAICD'</p>
        <p>work than workers, call uo and see for</p>
        <p>yOUDelf,  IIMPOUAHt  StRVICCS</p>
        <p>7S7-SSOO</p>
        <p> _lUBoHidhi  St..  GteeavUle. N.C.</p>
        <p>'A</p>
        <p>14</p>
        <p>46+1 31 -3 16+  41-  30- 21+1</p>
        <p>M-l 14+  47-1 12-  23+l 2</p>
        <p>24-  31 +1 72 -2 7</p>
        <p>15-  30-l 23+! 34-! 117-3 +  34+1 37+  23- </p>
        <p>20-  14-  77+I 17+ </p>
        <p>27 -  W+  I-  17-  24+  13-  11+  43-  31-  43+  37+  . 32- +2 36+ </p>
        <p>Tndycft  37 0  14 14  14-</p>
        <p>TchSym  7 472  13 II  119k- </p>
        <p>Taktrns .60 264314 26 25 24 TeMyn  13 991 204 267 2U+1I Ttltx 107671 41  47  -</p>
        <p>Ttmco  3.04  17014    37  41- </p>
        <p>Tasara  3144 13  II  13+ </p>
        <p>ylTaxaco .74)  1223337 31  20  M-1</p>
        <p>TaxEsI  1 13 4374 24  21  32-!</p>
        <p>Mutual Funds</p>
        <p>MonPw 2J1143124 31 30 31- NWI1M2272M7037 33 Mk-1 Morion J4 13 4470 37 37 37+! Motarla J4 30 M321  M 41+  -H-N-NCR 1I4244M46 40 61-4 NL Ind .148 1744 6  4 4</p>
        <p>NWA .70 77S73 Mdl4 34 -1 Nako 1.2016X4M0 30 20 27+ NatOlst 3.20 04011 47 41 M +  NatFG I1.M 12 447 17 17 17lk-l Nil .24 11M 12 II 12 WSanH 26145 11 II II- NavMr 27112 4 4  4+</p>
        <p>NtvPwaIJO 71020 II II ll+  NEngEI 2 I43M 25  23 24+ </p>
        <p>NwlMsJIa 10x5430 35 30 3l-2 NIaMP 1.20 I3xl405 13 12 12-  NflkSo 11.20 31 24670 24 22 23-  Nortakt.108 63101 I 7 7- NoastUt 1.76 7 17 21 20 21-  NIndPS .151 145213 7  0  I</p>
        <p>NoStPw2.02 103M7 31 30 31 -  Nortrp 1.20 177103 27 21 M- Nortan 2 3077 40 37  37+</p>
        <p>Norwst IJO 1772 36 35  35+ </p>
        <p>Nynax 3M 11 12077 M M +  -0-0-OcclPat2J0 27 403SI26 23 26-l OhIoEd I.N 024320 17 20+  OklaGE 2.10 11 1701 30 27 30 -  Olin IJ0122M7 37 35  17 + </p>
        <p>ONEOK 2J6 II1054 27 26 24-3 OrngCo I 143 6 4 6 -  OwanCn 31634 14 13  13+</p>
        <p>Oxford JO I11417 11 10 II +  -P-0-PPGs 1.20 1212720 34 31 34 +4 PacGE 1.72 1040712 17 17 II +  PacLtg 3 1114 40  40+  PacTSlJ41l3l74l M 26  27+ </p>
        <p>PacifcplJl 74676 31 32 33+t PanAm 267 3 3 3+  PanECn 2 X0064 23 22 23 Patten .041 6I3N 4  4I 4-</p>
        <p>P8nnayt1J01IIIN7 44 '+ PaPL 2JI1014V7 34 34  34-1</p>
        <p>Panwlt 3J0II144I  37 37-2 Psnnzol3M 447707 73 67  70+1</p>
        <p>PapBys .00 214140 13 12 12- PapsiCo JO 1424740 33 31  32+ </p>
        <p>ParkEI .60 H7I 24 20 2I-1 Pfinr I.N 12 x16l73 41   41+ </p>
        <p>PhalpO J0I71M07 37 36 37-l PhllaEI 2.10 70279 17 17  17+ </p>
        <p>PhilMr 3 1230204 71  06 70 + </p>
        <p>Phitoln J4II2334 14 13 14- PhilM JO 40127 11 N N-l Phlcarp 1464 3 3 3 Pllsbry 1.12 1417002 31 27 M- PInWst 2M 0 4404 21  27 17- </p>
        <p>PitnyBw .76 14x634734 32 33- Pmshl 306713 10 7 7- PkrDgn.lO I4IH 12 11 12 - Potard S . II 22237 23 30  30-2</p>
        <p>POrtGC I.N 13 4171 23 22 23+  Primea si JO 711633 27 d24  24-l</p>
        <p>ProclG 3.70 36IM31I7 12 M +  PSvCol 2 7 4413 20 20 H-  PSInd 62271 12 12 12+  PSEGs 2 1413232 24  23 24+</p>
        <p>PugtIP 1.76 122390 17 10 17- Pl^n .12 134669 4  4 4</p>
        <p>PuHaHm .12 01155 0 7 7- Pyro 10 6 4 4  4 -</p>
        <p>QANTEL 42342 1 1 1+  QuakiO 113101   +  QuakSC JO 1761 14 14  14-1</p>
        <p>Quastar I.H 14 x704 12 31 31-  -R-R-RJR Nb 1.73 1024917 40 46 47+  RLC M231073 6 4 4- RalsPur 1J4 76731 67 64 67-l Ramad NI21N 6  4 S+ </p>
        <p>RangrO 442137 4  3 3+ </p>
        <p>Raylhn IM 1213333 M 45 66-l RtadBI 36M 2 1 2 -  RayMt s JO 1116117    44+1</p>
        <p>RHaAM J6 163024 33 31 13 - vjRoblns 41777 16 15 15+ Rockwl J6 017370 17 17 II- RoHaas .72 115377 30 21 27+  Rohr 112356 17 M I7-I Rorar 1.MM3016 M N N- Rowan 145M 4 4  4-</p>
        <p>RoylD 6.32a II 3I4 107 105 W6-  Rydar J2 10x10405 25 22  21-2</p>
        <p>- 5-5 -SPSTk N W 373 25 24 25-  SFaSoP I 1247 2)155 40 47 9k- SaraU Sl.20 M11443 36 33 34- SCANA 2J2 7 3417 31 30  11- </p>
        <p>SchrPI SIM 17 20206   43-l ScMmb 1.20 34744 33 27  31-1</p>
        <p>SooKP IJ6llx2467 43 61-2 Saagrm I.I0116I0I 46 42 44 -  Saars 2 I x40224 37 34 14- ShallT 4.I*I341 72 67 70 Shrwin .46 7xl704N 21 21-1 Singar JO 21 x31417 44  SI+6 Sk^ . I11001 13 12 12,.+  SmkB s IJ4 II 13422     -2</p>
        <p>Sonat 2  14031  M 24 24+</p>
        <p>Son^ .2* TON N 32 36+3 SCalEd 1.30 II 12014 31 30 11-  SoulhCo3.14 714114 22 21 22 Soutind .611 21 13670 57 44 4I+I SwBalls3.MI01S142 37 14  34-1</p>
        <p>SwtPS 2.12 11 1714 24 24 24- SguarO 1J4I126M   -3 Squibb SI JO 13 XMTTS 73 U 64-l Stalay Ml3x3017 II 17 -  Starlbg 1.43 1410103  46 47-4 StavoJ 1.20 72614 27 N 26 StapSh s J4 11 X423I32 II ll9k-3 SunCo 1 164447 40  47+1 Syntax s I141M47 32 27 30 - Sysco J2 I73HI 27 24 36- </p>
        <p>TECO S IJ4 II4774 23 22 S TRWs IJ0 144030   - TacBt 17 904 1 1 1 Tallays M 753 13  10 11-1</p>
        <p>Tandms 31 17307 24 21 22- Tandy JO 1214431 M 33  33-!</p>
        <p>NEW YORK (AP) - Waakly Imeiting Compantaa giving lha Mgh, taw and Ian grtcM Mr lha weak wHh tht nat changa from Iho provtoui wiok's lait prico. All quolattam, supplied by Iho National toociattan of urn\n Ooitare, Inc., roftact not arnot vatuoa, at whkh socurttits couMhava bain sold.</p>
        <p>High Law last Om AALCapG  111 7.N SJD-.</p>
        <p>AARP tani:</p>
        <p>CapGrn  10J0  17.10  17.10-J7</p>
        <p>GintaMn  14.17  14.17  14.17-J2</p>
        <p>GanBd n  14.73  MM  14.71+  J1</p>
        <p>Grwinc n  20.27  MJ7  M.W-  M</p>
        <p>TxFBdn  14J0  ISM  1SJ7-Jl</p>
        <p>TxFShn  ISM  15.27  1S.27+.01</p>
        <p>ABTMMwait:</p>
        <p>Emirg  6J2. 6J7 6J2+ Jl</p>
        <p>FI G^  10.11  W.M  10.10+  M</p>
        <p>FIGwlh  13J3  1173  13JS-JS</p>
        <p>Grwlhinc  IIJO  11J2  11J-.14</p>
        <p>InlGv  10.24  10.22  10i24+  J3.</p>
        <p>Sacinc</p>
        <p>TFLM</p>
        <p>Utlllncm</p>
        <p>AddtaonCap</p>
        <p>AOTEKn</p>
        <p>AdwilGv</p>
        <p>Chari</p>
        <p>Canstl</p>
        <p>CMvYM</p>
        <p>Weekly Pmnt ... Leaders</p>
        <p>NEW YORK (AP) - Tha tallowing IM shows Iho Now York Stock Exchange stacks and warrants that haviigona up lha moat and down the moat In Iht pail wiak baiid on parcint d change.</p>
        <p>No sacurlttai IraWng balew $2 or looo sharos&amp;lt;</p>
        <p>HIYMd Sumit WiingEq AMAbnds:</p>
        <p>ClaiGlhn CiMiln GIbGlhn ModTNn AMEV Fm*! CapW Fiducary Grwlh Sptcin</p>
        <p>AcrnFdnr AfuturaFdn Adufst AdvaM:</p>
        <p>Govt nr Gwthnr Inconr Spclnr</p>
        <p>7J1</p>
        <p>7J1</p>
        <p>7J1- .22</p>
        <p>AigirGrPtnr</p>
        <p>7.14</p>
        <p>7.07</p>
        <p>10JS</p>
        <p>M</p>
        <p>WJ4+ .04</p>
        <p>AMenctCap;</p>
        <p>71</p>
        <p>I1J6+ .03</p>
        <p>Allane</p>
        <p>4J1</p>
        <p>6</p>
        <p>I3M</p>
        <p>12J7-.N</p>
        <p>Balan</p>
        <p>1U1</p>
        <p>11.21</p>
        <p>7.40</p>
        <p>7J3</p>
        <p>7J3- .04</p>
        <p>Canada</p>
        <p>4.74</p>
        <p>6J7</p>
        <p>7J4</p>
        <p>7J2</p>
        <p>7J4+ Jl</p>
        <p>Conv</p>
        <p>1.47</p>
        <p>1.44</p>
        <p>Ojuntpt</p>
        <p>12.75</p>
        <p>12.44</p>
        <p>6M</p>
        <p>6J3</p>
        <p>6J7-.M</p>
        <p>OlvMind</p>
        <p>l.</p>
        <p>1J4</p>
        <p>7J0</p>
        <p>7J1</p>
        <p>7J5-J7</p>
        <p>GoM</p>
        <p>1.71</p>
        <p>IJ7</p>
        <p>OJS</p>
        <p>o.</p>
        <p>IJ4- .17</p>
        <p>MB TxFr</p>
        <p>0.76</p>
        <p>1.71</p>
        <p>7.74</p>
        <p>7J4</p>
        <p>7J6-.14</p>
        <p>HIYWd</p>
        <p>I.N</p>
        <p>1.41</p>
        <p>0J7</p>
        <p>0J4</p>
        <p>U5+ Jl</p>
        <p>Inn</p>
        <p>14.23</p>
        <p>14.03</p>
        <p>6.24</p>
        <p>6J3</p>
        <p>OJO-.17</p>
        <p>IraCalTx</p>
        <p>11.51</p>
        <p>IIM</p>
        <p>IM</p>
        <p>IJO</p>
        <p>IJ1-J4</p>
        <p>Moninc</p>
        <p>11.N</p>
        <p>11.N</p>
        <p>7.14</p>
        <p>7.11</p>
        <p>7J2</p>
        <p>7M</p>
        <p>7J4-Jl</p>
        <p>Qunarn</p>
        <p>.</p>
        <p>37.14</p>
        <p>0.77</p>
        <p>ITS</p>
        <p>&amp;amp;T7+ J3</p>
        <p>Surveyor</p>
        <p>IM</p>
        <p>0.23</p>
        <p>17.44</p>
        <p>17 Jl</p>
        <p>17J3-M</p>
        <p>Tech</p>
        <p>23J0</p>
        <p>21J7</p>
        <p>WM</p>
        <p>7.77</p>
        <p>7.70-M</p>
        <p>AmtrCaplM:</p>
        <p>Comstk</p>
        <p>I3M</p>
        <p>I3.N</p>
        <p>12.73</p>
        <p>12JI</p>
        <p>12J1-J7</p>
        <p>OxpBd</p>
        <p>677</p>
        <p>4.N</p>
        <p>17.44</p>
        <p>J6</p>
        <p>MJ&amp;amp;-.77</p>
        <p>EMire</p>
        <p>11J1</p>
        <p>11.24</p>
        <p>14J6</p>
        <p>M.17</p>
        <p>14.17-JO</p>
        <p>ExdiFid</p>
        <p>44.04</p>
        <p>41J6</p>
        <p>17.74</p>
        <p>.OS</p>
        <p>17J4- .71</p>
        <p>FodMlg</p>
        <p>13.03</p>
        <p>12J0</p>
        <p>7.74</p>
        <p>7.</p>
        <p>7.74- M</p>
        <p>FundAm</p>
        <p>10J3</p>
        <p>.</p>
        <p>16.11</p>
        <p>35.72</p>
        <p>1173- Jl</p>
        <p>GovlSoc</p>
        <p>10.N</p>
        <p>10.21</p>
        <p>7J0</p>
        <p>IJ4</p>
        <p>U4- .21</p>
        <p>Grown</p>
        <p>I6M</p>
        <p>15J1</p>
        <p>Harbor</p>
        <p>01</p>
        <p>11J6</p>
        <p>0J7</p>
        <p>IN</p>
        <p>0J7+ .01</p>
        <p>HIYUtnv</p>
        <p>X 677</p>
        <p>1.77</p>
        <p>lOM</p>
        <p>W.</p>
        <p>J4- .11</p>
        <p>MunlBend</p>
        <p>X WJI</p>
        <p>W.25</p>
        <p>7J7</p>
        <p>7M</p>
        <p>7.16-.02</p>
        <p>OTC</p>
        <p>6.23</p>
        <p>4.73</p>
        <p>7.72</p>
        <p>7J1</p>
        <p>7J6- N</p>
        <p>Paco Fnd</p>
        <p>M.77</p>
        <p>J1</p>
        <p>4.20- .23</p>
        <p>11.20- .11 6.90</p>
        <p>0J4- .04 13.46-1.10 IJO- .03 0.71</p>
        <p>0.76+ J4</p>
        <p>I.40- .01 15J2+ .40</p>
        <p>II.41+ .05 11.96+ .04 9.13- .02 27.16-1.05 0.- .20 21J7-1.30</p>
        <p>Am Invest n  4.73</p>
        <p>Am Invine n  l.</p>
        <p>AfflNalGrth x SJ7 Am Natlnco x 10.44 APITrnr  7.12</p>
        <p>f Mull  IJO</p>
        <p>I1J7</p>
        <p>Amway 6 Analytic i. Armstng n AquHi Funds;</p>
        <p>SJ6 4J6- JO IJ7 0J2- 02 4.22 4J3-.01 10.07 10J7-.17</p>
        <p>7.17 7J1-.I5 7.74 7J1- .14</p>
        <p>11.17 12.17</p>
        <p>6. 6J4- .13</p>
        <p>Aril  7.34</p>
        <p>Hawaii  10J7</p>
        <p>Orag  7JS</p>
        <p>AscPIStk  IIJO</p>
        <p>AvonO n  7.07</p>
        <p>Axa HuMhtan;</p>
        <p>Fund B n 7.31</p>
        <p>7.10 7J4+ M MJ4 WM+ .03 7M 7M+ .07 I3 I3J1- 14 7J7 7J7+ .01</p>
        <p>changii</p>
        <p>wairsc</p>
        <p>Kurlttai trading balew $3 or fOOO aralncludad. Not and oercanlago I aro'lha (Pffiranci bafwian last</p>
        <p>1 USPCI s</p>
        <p>3 TIgir Ini</p>
        <p>I WnUn Mpt</p>
        <p>4 Rayallnl</p>
        <p>5 GthyFIr s</p>
        <p>6 Pm Am</p>
        <p>7 0</p>
        <p>7 _______</p>
        <p>10 SpraguaTc It UllKmllan 13 PPG t</p>
        <p>II UmFlrsI M FlaStetl</p>
        <p>IS SinJuan Ra</p>
        <p>Chg I + A Up + 2 Up +  ^ + I</p>
        <p>+ 2</p>
        <p>Pet.</p>
        <p>deling and this wiik'f cloalng. UPS Last 24</p>
        <p>12</p>
        <p>2</p>
        <p>0</p>
        <p>15</p>
        <p>1</p>
        <p>67</p>
        <p>14 + I Up 7 + I Up 42 +6 Up 35  + 4 Up</p>
        <p>17 +2 Up 24 +2 Up 12 + 1 Up</p>
        <p>WeeUy jbMritae Slock Aid Bewls</p>
        <p>TxEHY</p>
        <p>TxEIn</p>
        <p>Yantare</p>
        <p>4J3 A23 4.25-.01 WM ION 10.N+ .01 10J0 N.44 10J0+ .05 I4JI 13.N UJO- .26</p>
        <p>Tom tor wMk</p>
        <p>+  Up + 1 Up + 4 Up</p>
        <p>M SIngv Co  43 +6  Up</p>
        <p>17 BilTHwt .......-  </p>
        <p>plA  67  +  7  Up</p>
        <p>II GonlEMy  3  +    Up</p>
        <p>17 v)LT^ AA  5  +    Up</p>
        <p>M PaniHIIKn  W  +  1  Up</p>
        <p>21 Conoco n  13  +  1  Up</p>
        <p>22 Clinc  7  +    Up</p>
        <p>23 TDKCp  67  +6  Up</p>
        <p>10 Tramen  Inc  2  +    Up</p>
        <p>24 Sony Corp  N  +  3  Up</p>
        <p>DOWNS Name Last</p>
        <p>1 EnvhnTrt</p>
        <p>2 FkiC^</p>
        <p>jgati""'</p>
        <p>S1J</p>
        <p>10.0</p>
        <p>25.0 14J 10J 1SJ M.7 MJ</p>
        <p>14.0 13J 13J 117</p>
        <p>12.7 12J 12J I2J 12J 11.4</p>
        <p>11.1 lOJ 10J 10J 10.2 m</p>
        <p>7.7</p>
        <p>Year aga 1 to (tota</p>
        <p>Jan</p>
        <p>11M to data</p>
        <p>AMERICAN BONDS ToM tar wnk Year ago</p>
        <p>4S,SHJ00</p>
        <p>4S.320J00</p>
        <p>56JJOO</p>
        <p>1J77,710JOO</p>
        <p>2,1S4J7OJ00</p>
        <p>t11710J00</p>
        <p>011J3OJ00</p>
        <p>Aiericai Slock Exdmge</p>
        <p>AmBalan</p>
        <p>AmcapFd</p>
        <p>AmMutt</p>
        <p>BondFd</p>
        <p>ClncBM</p>
        <p>upK</p>
        <p>Fundmlnvs x Govt X GrowlhFd IncomiFd InvCoA NiwEcon NawFtrspFd TaxExpt TxECa TxEMd TxEVa WshAAut AfflGwlh AmHtritgi n</p>
        <p>10J7 10J1</p>
        <p>7.71 7J5</p>
        <p>17.71 16.74 I3J) 12.12</p>
        <p>21.07 20.77 23J3 23.21 I4J4 1100 13J5 1176</p>
        <p>14.07 14J0 lOM M.71 )1 13 17J0 17.17 10.70 lOJl MJ7 I0J6  13.34 11.21 07 11J7 )3 IIJ7 I1J7 7J4 7J1 1.17 1.13</p>
        <p>WJ7- .04 7.57- 17 17.06- JS 21+ .04 2IJ1- .04 23.21- .03 00-1.04 7&amp;amp;-.07 1SJ3- J6 05- J3 - .23 1*- . lOJl- .11 UJ7+ .01 13JI+ .03 21+ .14 47+ .01 11J4- .10 7J4+ Jl 1.13- J3</p>
        <p>IncoFd n  4.13</p>
        <p>Stack n  4.77</p>
        <p>BB&amp;amp;K n  10 J6</p>
        <p>labsan Oraup:</p>
        <p>Bondn  1J7</p>
        <p>Entrp n  10.</p>
        <p>Gvrth n  12.17</p>
        <p>Shadow  7.11</p>
        <p>TxFr n  1.23</p>
        <p>UMB Stack n  U N</p>
        <p>UMB Bd n  10.75</p>
        <p>Volut n  14.77</p>
        <p>BalrdBICh  10J4</p>
        <p>BalrdCa  I3.N</p>
        <p>BakrUSGv n  14.25</p>
        <p>Barttalt Funds;</p>
        <p>BascVI n  11.23</p>
        <p>Msh n  1.01</p>
        <p>Fixidl n  7.44</p>
        <p>BooconHIII n  24.</p>
        <p>BonchBC  1141</p>
        <p>BMhamCapKal;</p>
        <p>CalTFl n  10.</p>
        <p>CalTFIn n  10.13</p>
        <p>Cap TNT n  W.17</p>
        <p>GtWAAn  9.M</p>
        <p>NtTFI n  7.07</p>
        <p>NITFL n  10J4</p>
        <p>TarlTfOn  HJ7</p>
        <p>TarlTTSn  4I.M</p>
        <p>Tanooo n  M</p>
        <p>TarlOHn  31.23</p>
        <p>TarKIW n  14J4</p>
        <p>BtfgarBw lOOn Min BtaSIGr n iCa</p>
        <p>7.11 7.14- 17</p>
        <p>4.12 113</p>
        <p>6J4 4J4- 12 I0J1 J1-J4</p>
        <p>I.SI IJ7+ .01 I0J7 WM- .24</p>
        <p>II.71 11.77- 2$ 7.10 7.M- . 0.10 0.21+ .04 11.74 1IJ- .22 10.71 W.7S+ .04 14JI 14J0- M 1012 NJ4 12.27 12.27- 43 15.22 1125+ .01</p>
        <p>11.04 11J4- 09 1.01 1.01 7.40 7.44+ .01 24.07 24.17- 01 11J2 11.44- 09</p>
        <p>10.09 10.07- 03 10M .09+ 03 10.15 10.17+ 04 7J1 7N+ 01 7J4 7J4+ .01 10.12 MJ2 00.10 .+ 31 4I 41J4+ 24 12.n 13J6- 10 31.00 21.21- 13 I4.M 14.04- .13</p>
        <p>14.N</p>
        <p>11.</p>
        <p>7.14</p>
        <p>14.46 16J7- 36 11.77 11.71+ .03 7J7 7,11- 01</p>
        <p>din n</p>
        <p>BnGrln</p>
        <p>NEW YORK (AP) - American Stock Ex changa trading tar the wick sttactad isiues:</p>
        <p>Satas</p>
        <p>PE h* Wfh Low Last Chg.</p>
        <p>124 15 14 14Vk-</p>
        <p>Pel.</p>
        <p>OH 31.7 OH J</p>
        <p>4 Soumrt^</p>
        <p>6 SignalAprt s</p>
        <p>7 m) Union</p>
        <p>I SvcRosour 7 ComwMtg  viSfflHhlnt</p>
        <p>II l&amp;amp;iiiiCp $</p>
        <p>12 riTod^</p>
        <p>13 Athlon Ind M FIschbCp</p>
        <p>14 TldMvNr</p>
        <p>M Soumrk pM 17 Minis n M HillsOipt n 17 Rockaway M ApachdPf</p>
        <p>21 RaadngBM</p>
        <p>22 UtdlMarMfg</p>
        <p>32 RdgBat ad|pl</p>
        <p>un</p>
        <p>M GinlHoin 24 OOECO</p>
        <p>2  -    .</p>
        <p>W-4 OH 27.2</p>
        <p>3  -  1  OH  27J</p>
        <p>4  -1  OH  24.7</p>
        <p>4  -  1  OH  24.1</p>
        <p>3  -    OH  23 J</p>
        <p>4 -1 OH 22.4 4 - 1 OH 22.0 6 - I OH 21.7 14  -3  OH  21.1</p>
        <p>2 -  OH 30.0 W -2 OH 17.2 6 -1 OH 3 4 -1 OH 17J 14 -3 OH 17J 7 - I OH 16.7 6 -I OH lit 5 -I OH 1</p>
        <p>4 -  OH 111 3  -  OH 111 4 -  OH 111</p>
        <p>3- OH 113</p>
        <p>2 -  OH lie M -1 OH 117</p>
        <p>TxbMa .ni73l3H 37 40-2 TxPac JO 31 3 25 14 25 - TtxUni 3M 63N717 M 27+) Tcxtra a 1 6IM77 23  22 +  Tlgirln 7MU6I2 7 l2+2 Tima 1 226577 K 76 7i-l TkmM 1J414X50M71 67  -1</p>
        <p>TImkan I x14MM 53 51-1 Tokhem Jl  12 577  d16  W-1</p>
        <p>Teico  71N  1  I  1-</p>
        <p>Tramm 1J4 6as 14 32 32-  Tranco IM 72 24 36 2) -1 TravtarlM 715405 36 14 35- Tricon 13ta 17 27 25 N -  Trihuns JO 236755 N 33 14-l Trinova J6I340M N 33 25 ThcsEP3J011I76S 54 51 54+ </p>
        <p>-U--UGI 2JII35  25  24  24-</p>
        <p>UNCInc Jta  7 713  7  6  4- </p>
        <p>USFG IM 711H) 13 32 12+  USG 1.13 7xlN7210 37  27+1</p>
        <p>USX IM 7 27  26 27 -I</p>
        <p>UCarb I. 1540013 24  21  21</p>
        <p>UnEllc 1.72 75715 22 22 23)k-  UnPac 3 I) 127 H 51 51- Unisys s .73 51517011 27  -2 UnBrnd J013 3 41 M 4)+3 USWisllMMINflSI   SO-</p>
        <p>UnTtch IM 24 X3HII14 dio 10-3 IMTal 1.72 M6M2S 21 24- Unocal 1 1512002 20 25 2S9k-2 U^S JOM207S0 33  27 309k-l</p>
        <p>USLiFEIM 712B 3)  27 M+</p>
        <p>UtaPL 2J2 172670 20 M M+ </p>
        <p>-v-v-</p>
        <p>Vartan MMOMI 22 d I7N-2 VarHy 1M 2 2 2-</p>
        <p>-im.|g-</p>
        <p>Wackht JO IS 3N 14 13 11-  WalMti .I2 27454n37 35 27-1 WalU s IM 14 722 57 50 57+  WarnC MM204N27 34 27 +1 WarnrL )M  1712072  70  M  66-3</p>
        <p>WashH UN  6 Oil  II  W  - </p>
        <p>WshWI 2. x346762431 23 WlllsFi1J6 271)a42 17 40-l WUnlon 1517 2 3  2 - </p>
        <p>WMgE 1.73 7I71UM 44 45+  Wtaforh )M 13 513 27 34 17+) WhrMsl.7217 27 N N+ WMHak I  7)271  24d21  24-</p>
        <p>William IM  5756  24  22  23 -1</p>
        <p>WblOix IJ615M02 41dl7 + Wbmbo . 1775 I 0  0 - </p>
        <p>Whvlhi1J3 71171117 31 ll-3 Wynn M IS 4 17  </p>
        <p>-X-Y-l-Xarw 3132S0M 57  55  56-1</p>
        <p>ZnHhE 7SN 14 13 13 COpyrloht by Tha Asaocd Presa 1707.</p>
        <p>Acton s</p>
        <p>AdRusll 3N 41  41+l Alu I34MN 23 24-  Amdahl .M13IWI1 11  27  37-</p>
        <p>APcH JN  57 57 579b-1 AmRoyl l.7ta 4 2 I 7 7-  ASclE 131202 2 2 3 Ampal J6 4 221 2 1 1 AnM 1 M 5 5  5</p>
        <p>AnCm n 70 6  5 5- </p>
        <p>Armtrn M 2 2 3- Asmrg . 31 6 5 6 -  Astntc 2024     116-1-M</p>
        <p>Atari 73140 6 5 6+  AHsCM 13 1 1  1 - </p>
        <p>AMaswt 227 14 11 12 -1 BAT Jta)44 0 7 7-3-M Bmslr g 40 4 4 6-  BargBr J1I3KN7 14 14 15 BowVW.Wr 417 dO 7- Brscng M 4 10 17 17- CMICp 2087 2 3 1- CarnCrn 741 7 0 0- ChmEnn 12 3 3 ]- ComFdsJS 61336 7 6 7 -  CMqri 3U7 1 1 2- ConOG 1171 I I 1+  Crens MMlMO 24 21 2S+1 Damson 06 S-M   </p>
        <p>DalaPd . 41 0 7 0- Oahnd UN 1 is-ta IS--  DemaP 27377 M  )&amp;amp;+  Du^  J011  2U  M  14  15-</p>
        <p>EdiB gsJ7 41 13771    17  9b-</p>
        <p>Endvn 1 3H 4 4 6+ ENSCO U40 3 3 2- EMMkl I12M1 1 3 3- Fidda  M  604  4  4  4+ </p>
        <p>FAusPrlJOt sm 0 7 7- Fluka IJN71 5 WdM 17 -1 FruHL n 6M3 4  4 4+</p>
        <p>FurVtt M1317N 4 3 1- GRI  5  01  4  4  5-</p>
        <p>GMYIg 447 14 14 15+  GtoHKs J613 4 M M 27+  GtdFM 1203 f   </p>
        <p>GrtLkC J4M21S4 4Nb 42  -3 GCdaRnM I14M12 W W-l Haihrs J7HS21S 11 II II- Hdco . 4 4M 17 16 M9k-  HollyCp 43 U7 13 H 13-  HiraShS 6377 6 4 S9k- HrnHar 74WS 1)  7  +</p>
        <p>HouOT Jto 4I3M I   9k- </p>
        <p>Whal Wie Stock MaiketDid</p>
        <p>Bnxtiivn n Bructn</p>
        <p>irilAlMrBp;</p>
        <p>CapGrn Eqinc n GoWlnvn HiYieWn</p>
        <p>27</p>
        <p>11.76</p>
        <p>11.41</p>
        <p>13.47</p>
        <p>I1J3</p>
        <p>IJO</p>
        <p>10.20</p>
        <p>H.07</p>
        <p>M .74- </p>
        <p>11.71 11.74- 01 11 JS 11.41+ 04 14 16- .31 12.77 06- 21 IJJ 1.45- 04</p>
        <p>7.71 7.70- . I7J7 17.07- 38</p>
        <p>7J4 7J1 7J1- .22 WJ7 7. 7.10- IS 15.47 15M 15J4- 13 I1J4 11J7 1IJ7- .01</p>
        <p>Twt</p>
        <p>This Prov Yaar Years WnkWaak aga aga</p>
        <p>Advances  I  020  m  IJ32</p>
        <p>Dadiras  I.2H  1,134  t,M7  404</p>
        <p>Unchingid  211  220  247  213</p>
        <p>ToM IMMS  2,IH  2,174  2J10  lUt</p>
        <p>Now yrty hghs  7  7  IN  374</p>
        <p>Ni#yoarty  Iws 177  147    37</p>
        <p>Amx Weekly Dollar Leaders</p>
        <p>NEW YORK (API -The tallowing is o ibnodon</p>
        <p>list of Iht most activo stocks I tha dollar vetamt.</p>
        <p>Tha toM is band on tha madton prico of the stock tradsd multiplitd by the shares Trad</p>
        <p>Nmm ToltlHNI Satasthds) Last NY Tbim  t.141 M6  27</p>
        <p>Amddil  t&amp;gt;1,tin11  17</p>
        <p>EchoBayg  s  S2SJ76 13771  </p>
        <p>TcxaoAh&amp;amp;  tlS,2 2M7  II</p>
        <p>ImptrOil A  g  I17J17 4171  M</p>
        <p>LorlmarTtl  $7 MSN  7</p>
        <p>t1SJ17 141  W</p>
        <p>S14,7   24</p>
        <p>t77l 3240  42</p>
        <p>GuHCdoRs  n  S13JH 1I4N  W</p>
        <p>MBOflWI I in</p>
        <p>WMWLabB</p>
        <p>AhaG^</p>
        <p>AmC2l</p>
        <p>DOWJoees</p>
        <p>NEW YORK (AP) - The following gives Iht range of Iht dosing Oew Jones onragis tar the week ondUNovM</p>
        <p>1^1 gIM m 42 37  M-4</p>
        <p>STOCK AVERASES</p>
        <p>71202 I 1 I- InlBknt  24  2  3  2-</p>
        <p>KIrhy  2004  3  3  3</p>
        <p>LdmkSv M  S 164  4  4  4-</p>
        <p>Ltand  01H4  4  4  4-</p>
        <p>LarTd I45NM 7  7+</p>
        <p>MCOHd  n  7  7  7+</p>
        <p>MCORs  712    716</p>
        <p>MSR  375  1  1  1</p>
        <p>Midtas J4MI272 11 11 11- MichlE J4S3W2  7  I  7+ </p>
        <p>NHMnt  .  1H6  0  6  6-1</p>
        <p>NPrac 1.MI 11 2N 21 22 21+1 NYT)maJ414167dM 27 -3 NCdOG 2S1131 13 12 12- Numac  M2  a  6  6+</p>
        <p>OOktap  2  II  7  7N-1</p>
        <p>Pallas J4  4412 24 27 21-) PMU)s J4I 317SI 7 6 7 - Plflawy IM  3 70d61 6I-)1 Ranhg  JN  711  I  7  7-</p>
        <p>RavtA  1574 Mdl2 21-2</p>
        <p>SaeCip  Xt  1  2  3  3+ </p>
        <p>SolHron  1) 103  6  S  6 + </p>
        <p>StarlSfl  11 4N  0  0  0</p>
        <p>TIE  2724  2  2  2-</p>
        <p>Tatoseh  I  4  3  4+ </p>
        <p>TtxAir 20007 13 dll 11-l ToHPIg M XI7MM 13 14+1  "n ----</p>
        <p>First HMi Uw Lasf Chf. M I074M 61-3tM</p>
        <p>Ind 1M7.W.1 Trn 74&amp;amp;27 7M.27 726.17 7M.27-I7.M UH I02J0 2M IN.W lO&amp;amp;W-1.70 OSSHiTMJO 7MJ7 703.M 7NJ3-I0.S4 BOND AVERAGES M Bndi  06J7  06J7  OIM  0U&amp;gt;-eJ3</p>
        <p>unis  out  OIM  0SJ7  0SJ7-0.M</p>
        <p>Indu  NJl  NJ6  0L71  N.75+OJ4</p>
        <p>COMMODITY FUTURES INDEX I27M 131J7127M 121J7+1J2</p>
        <p>Stu Weekly Dollar Leaders</p>
        <p>NEW YORK (AP) -Tha tallowing is a ibamdon</p>
        <p>TwCty 1  I 114 6 6  6-</p>
        <p>TuMlix  14IN 2 2 2-</p>
        <p>Unkarp M  1211  6  4  59k-</p>
        <p>UFaodAJR  S 154  1  I  I</p>
        <p>UFoodB  5 75 1 1 I</p>
        <p>UnvPal  Nl  4  4  6+ </p>
        <p>WHfB .M M267 II  10-  WlhftI 1.N M 3N 174 174 Ml -0 WNMd  047  2  1  1-</p>
        <p>WDWn  74137 14 13 139k- </p>
        <p>WhhRwl  14  1  1  1-</p>
        <p>copyright by Tha Associatad Prass 1707.</p>
        <p>Hsl of lha most active stocks I the doltor volumo.</p>
        <p>The total li basad on tha madlan price of lha thick tradsd muttipltad by Hit thamh-adid.</p>
        <p>Name TafttMN) Satatlhdi) Last</p>
        <p>IBM  11,114,173 74444 117</p>
        <p>GTE Carp s |tl1,M6x)741HN Merck  M71JS110414171</p>
        <p>OigiMEq  5477J4717M2124</p>
        <p>GonEkt t  t3M,7N07M1 </p>
        <p>FordNtatr  tl6UI7l 75</p>
        <p>PhUipMor  337J77 302N </p>
        <p>EshSm t  IXJ24 40l7a 47</p>
        <p>DowChtffl  saiwi4euo</p>
        <p>duPont  S13JM3 01</p>
        <p>Squibb  $6412 x44771 M</p>
        <p>Exxon t  1101.107 7NI4 </p>
        <p>AmtrT&amp;amp;T  0272JM 1073 M</p>
        <p>ConEdisn  t1.l44644 </p>
        <p>Gun Motors  $lf&amp;amp;7N4a 40</p>
        <p>TaxFreen</p>
        <p>1664</p>
        <p>WJ2</p>
        <p>MJ5+ 04</p>
        <p>USGvtn</p>
        <p>MM</p>
        <p>MJ4</p>
        <p>MM+ 01</p>
        <p>CalameaCvn</p>
        <p>J2</p>
        <p>7.71</p>
        <p>7.71- 07</p>
        <p>CalMunn</p>
        <p>IM</p>
        <p>143</p>
        <p>146+ 01</p>
        <p>CalTrsin</p>
        <p>I0J4</p>
        <p>.77</p>
        <p>J4+ .04</p>
        <p>CNUGvn</p>
        <p>7J7</p>
        <p>7JI</p>
        <p>7J7+ .04</p>
        <p>Calvirtfinep;</p>
        <p>Ariel</p>
        <p>14.71</p>
        <p>1142</p>
        <p>1167- 17</p>
        <p>Equity n</p>
        <p>13</p>
        <p>MJI</p>
        <p>U61-3.N</p>
        <p>Inco X</p>
        <p>1141</p>
        <p>1144</p>
        <p>1146- 37</p>
        <p>Sodain</p>
        <p>21J4</p>
        <p>22J5</p>
        <p>1170-107</p>
        <p>TxFUdn</p>
        <p>41</p>
        <p>41</p>
        <p>J1</p>
        <p>TxFLng n x</p>
        <p>MJ7</p>
        <p>MJI</p>
        <p>MJT- M</p>
        <p>USGov X</p>
        <p>MM</p>
        <p>MJ3</p>
        <p>MJ2- .07</p>
        <p>WshAnr</p>
        <p>UN</p>
        <p>MJ2</p>
        <p>MJ1-2.N</p>
        <p>Caaitaaa Group:</p>
        <p>FundSW X</p>
        <p>OJS</p>
        <p>IM</p>
        <p>142- 44</p>
        <p>Income x</p>
        <p>107</p>
        <p>IM</p>
        <p>107- M</p>
        <p>PBHG</p>
        <p>&amp;amp;M</p>
        <p>163</p>
        <p>m-iM</p>
        <p>Tiend x</p>
        <p>M</p>
        <p>54</p>
        <p>61- M</p>
        <p>Camota Fimdi:</p>
        <p>CappGrwlh</p>
        <p>27</p>
        <p>I2M</p>
        <p>17- 07</p>
        <p>gjfToHtt</p>
        <p>7J4</p>
        <p>7M</p>
        <p>7J0- N</p>
        <p>7J5</p>
        <p>9JI</p>
        <p>7J5+ .01</p>
        <p>Cardbial</p>
        <p>41</p>
        <p>II</p>
        <p>30- N</p>
        <p>CarddGvt</p>
        <p>&amp;amp;71</p>
        <p>IM</p>
        <p>171+ 11</p>
        <p>CmlryShra</p>
        <p>ChpoMolIrn</p>
        <p>17J7</p>
        <p>7.N</p>
        <p>17M</p>
        <p>7M</p>
        <p>17J0- 07 7J0- 17</p>
        <p>ChishwfNn</p>
        <p>OOJI</p>
        <p>67M</p>
        <p>67M-I.H</p>
        <p>CWNAFimdk</p>
        <p>Aomv</p>
        <p>7J7</p>
        <p>1</p>
        <p>7.- a</p>
        <p>Growth</p>
        <p>17</p>
        <p>51</p>
        <p>40- N</p>
        <p>MYM X</p>
        <p>7.72</p>
        <p>7JI</p>
        <p>7J2- N</p>
        <p>Income x</p>
        <p>7JI</p>
        <p>7M</p>
        <p>7J0- a</p>
        <p>MuniBd X</p>
        <p>7J2</p>
        <p>7.</p>
        <p>7.- a</p>
        <p>Vitat</p>
        <p>07</p>
        <p>IIM</p>
        <p>11.73- .</p>
        <p>ONhank IRJ+CIT</p>
        <p>Bolanfn</p>
        <p>' 1J1</p>
        <p>IM</p>
        <p>IJO- 03</p>
        <p>EquHfn</p>
        <p>IM</p>
        <p>US</p>
        <p>1J5- 05</p>
        <p>bicam fn</p>
        <p>1J2</p>
        <p>1JI</p>
        <p>1.61</p>
        <p>SMTrm In</p>
        <p>IM</p>
        <p>IJ7</p>
        <p>IJ7</p>
        <p>OaramoNFNi;</p>
        <p>Combndn</p>
        <p>I2J1</p>
        <p>07</p>
        <p>I3JI- .</p>
        <p>GevBdn</p>
        <p>24</p>
        <p>M</p>
        <p>24+ .03</p>
        <p>Stackn</p>
        <p>7J4</p>
        <p>OM</p>
        <p>7J9- 12</p>
        <p>Sew</p>
        <p>4141</p>
        <p>M</p>
        <p>J7- 64</p>
        <p>AtfwGuU</p>
        <p>22J7 22J2 22J2- .35</p>
        <p>CUTE</p>
        <p>645</p>
        <p>151</p>
        <p>6J4+ Jl</p>
        <p>CtopCNi</p>
        <p>.N</p>
        <p>42J3 4U&amp;amp;-M</p>
        <p>CorpCsll</p>
        <p>4157 41N 4136- 37</p>
        <p>Otndln X</p>
        <p>6N</p>
        <p>ITS</p>
        <p>ITS- n</p>
        <p>Eqlyinc</p>
        <p>41</p>
        <p>M</p>
        <p>M- .17</p>
        <p>Fund</p>
        <p>MM</p>
        <p>MM</p>
        <p>J7-.1S</p>
        <p>GovMlg</p>
        <p>M</p>
        <p>- n</p>
        <p>GvISoc</p>
        <p>11M</p>
        <p>1IJ3</p>
        <p>1IM+ .M</p>
        <p>Grwlh Shrs</p>
        <p>J4</p>
        <p>J0</p>
        <p>J0- .11</p>
        <p>HlghYliW</p>
        <p>7.17</p>
        <p>7.17</p>
        <p>7.17- Jl</p>
        <p>Income</p>
        <p>647</p>
        <p>645</p>
        <p>166- M</p>
        <p>IncFla</p>
        <p>7.M</p>
        <p>IN</p>
        <p>177- .11</p>
        <p>^Tf</p>
        <p>MM</p>
        <p>MJ5</p>
        <p>MJI- M</p>
        <p>627</p>
        <p>614</p>
        <p>127+ M</p>
        <p>MnTE</p>
        <p>651</p>
        <p>651</p>
        <p>153+ H</p>
        <p>NYTE</p>
        <p>6M</p>
        <p>627</p>
        <p>627- .61</p>
        <p>OhTE</p>
        <p>637</p>
        <p>6M</p>
        <p>617+ .</p>
        <p>Smindx</p>
        <p>7J6</p>
        <p>7M</p>
        <p>7J&amp;amp;- .21</p>
        <p>TXIm</p>
        <p>7J4</p>
        <p>7J2</p>
        <p>7M+ .01</p>
        <p>TaxExpl</p>
        <p>74</p>
        <p>72</p>
        <p>74+ Jl</p>
        <p>USIdx</p>
        <p>17</p>
        <p>I1J4</p>
        <p>I1.N- .</p>
        <p>CNtmbta Feeds:</p>
        <p>Flndn</p>
        <p>I3M</p>
        <p>13M</p>
        <p>M</p>
        <p>Gribn</p>
        <p>.</p>
        <p>JI</p>
        <p>J7-Jl</p>
        <p>Mun er</p>
        <p>IIM</p>
        <p>)1.</p>
        <p>11.M+ M</p>
        <p>Spdnr</p>
        <p>21N</p>
        <p>24J1</p>
        <p>lUI-IM</p>
        <p>Cimmtetien:</p>
        <p>Govt</p>
        <p>11.15</p>
        <p>11.N 11.15+ M</p>
        <p>Grawth</p>
        <p>7M</p>
        <p>7,</p>
        <p>7 )2- .17</p>
        <p>Greinc</p>
        <p>7.77</p>
        <p>7M</p>
        <p>7J6- M</p>
        <p>ComwnhA&amp;amp;B</p>
        <p>IJ4</p>
        <p>)JI</p>
        <p>1.42- Jl</p>
        <p>ComwtlhC&amp;amp;O</p>
        <p>IN</p>
        <p>IN</p>
        <p>I.N- Jl</p>
        <p>C^Graep:</p>
        <p>7J4</p>
        <p>7J1</p>
        <p>7M- .</p>
        <p>Growth</p>
        <p>7J3</p>
        <p>7M</p>
        <p>7J6- n</p>
        <p>IncoFd</p>
        <p>7JI</p>
        <p>IN</p>
        <p>7JI+ m</p>
        <p>NWPt</p>
        <p>11.77</p>
        <p>IIM</p>
        <p>IIJO- 27</p>
        <p>TaxEx</p>
        <p>7J7</p>
        <p>7M</p>
        <p>7M</p>
        <p>USGov</p>
        <p>IM</p>
        <p>IM</p>
        <p>IM</p>
        <p>Vitae</p>
        <p>7J5</p>
        <p>7J7</p>
        <p>M7- 17</p>
        <p>Cmlltahwl:</p>
        <p>Govt X</p>
        <p>.</p>
        <p>15</p>
        <p>16- 01</p>
        <p>(ContiiMNdMpiNtB-lS)</p>
        <p>VUachoviaA symbol ctf strength, sQbility an&amp;lt;i service for over a centuryWachovia Bank &amp;amp; Tmst Company, N. A.Member of the Federal Deposit Insurance Corporation</p>
        <pb facs="00096780_0042" />
        <p>H&amp;gt;20 Ttw D&amp;gt;lly fWI&amp;lt;ctor. QreanvHle, N.C.  Sunday, Novmbw 22.1967</p>
        <p>1M *J M-.W iiji n.</p>
        <p>1M4 nil iiii- .11 iiJi iijo n.a^^ m J5 *J1 t.25+ n.n 11 J$ 11.91-.11 unmil</p>
        <p>(CwmwwdHiem Ni B-if)</p>
        <p>^ fSS</p>
        <p>im lua Njs-.n</p>
        <p>11J 1141</p>
        <p>OriHtaiMl:</p>
        <p>Ml Ml M7-.il %M M7 M9-JB 9. 9J1 945- 1M7 IMS Wv-4I 44.71 44J1 44.71-41 9.79 9.7 9.T94- 43 1441 I4J1 1441-41 941 941 943- 45</p>
        <p>941 941 941 941 947 9411- 44 1544 1544 1547- 41 947 941 947+ 44 15.71 1449 1449-.7 41 4I AH-45</p>
        <p>4I 4I 41-4</p>
        <p>11.99 1141 1143-41 1141 U41 1315+ 41</p>
        <p>N41 W4I W4I-44 104 N.19 W.19-41 1144 1144 1144-.17 1049 104 1049+ 41 949 941 949- 41 W.41 1041 N41+ 47 1141 1149 1149-.M</p>
        <p>0.91 Ml 147-41 941 1.91 193-.10 11.19 114 1144-41 941 199 941 941 940 944-44 Hn Ha M41+41 HJt 9.91 9.97-45 UN 9.99 HN+41 174 1749 17.-.17 IN IN IN 44 174 140-41 747 741 743-.n N147 M197 MI47+ .14</p>
        <p>1141 1144 n.11-19 1141 1140 11.01+ .01 941 9.19 9.19-.10 7.N 740 740- 47 1744 1741 1743-.17 941 949 941+ 43 1145 1149 1143- 07 11 N I1M+ .01 Ml 7.97 047-. 7.74 745 741- . W W45 W45-41 945 9 949- 07 W.1 N.24 M.N+ 41 941 9.M 940- 01 14 1447 14.7</p>
        <p>1171 1131 1141-44 940 941 94*-. 11 11.11 1140-  . M.n-41 7.51 7 7+ .</p>
        <p> 4I  9.N 149 Ml 13 H.N 7.N 7 IN IN 1141 II 33 W47 . ll M.N  1141 7 7.91 741</p>
        <p>+ . +  M3-</p>
        <p>1341-.a 74- 19*-41 1143- + M .+ 44 M43-.il N43-47 743-</p>
        <p> WN M4S- .11 9 944 9+ 44</p>
        <p>179 IN 174+. 17.11 M M43-.11 .14 .11 i14+  15 1545 1541-.N</p>
        <p>1 157 151 1 171 151 7.N IN 9.75 9 IN 1 IN IN  1745 1 119 151 1 157 IN 741 7 m 7</p>
        <p>&amp;gt;143- 1N+ 41 140-41 15-. 191- 949-49</p>
        <p>1*5</p>
        <p>1744-47 111+ 41 151+ 41 M7+ 41 7+ 743-</p>
        <p>IN</p>
        <p>111 IN</p>
        <p>174 1 941 9</p>
        <p>7.N 7.15</p>
        <p>Ut-Jt 1N+ 41 171-.03 941+ 41 7+ .01</p>
        <p>.W .H 10.09+ . 41  41+ .01</p>
        <p>11.N II 1143- 945 940 045- 41 941 9 943- 11  -  77 45 1049-47 MN M41 1441-47  2131 mi- .15</p>
        <p>31 31 mo-</p>
        <p>11 1349 3174-  .17 il5 N17+  11.14 11.07 11.14+ </p>
        <p>2147 11 1141-.11  NS J0+  147 MS M5-.U   WJ0-.I1 9 9 949+ 41 11N 11.75 11.71- 9 Ml 113-.11 945 940 949-.IS 11 W.72 W.73-47   </p>
        <p>9 9 945+ </p>
        <p>Ml SNSLr SNMIr SNTocbr SNTnMr SNUWr FMuCapn nMMdliPNl: Dynamtein FSBGwn FSPEgyn FSPEurn FSPFnn FSPUn FndTxn GoMn HiScin HIYMn MuNrin InconNn Ltiirn PKlflcn SNctn Tachn KWrcn FtlEa^n m HfiMn: BundAopre Ditcovury Govi Graurtli HViYd</p>
        <p>lOSTa</p>
        <p>NiTE</p>
        <p>PtnPcGn</p>
        <p>InltSK NNRhc MVTwFr OpNan SbkN tSk Exmpt Vthm FtTrUSGov</p>
        <p>1 541 M*-.1l 117 1 117 747 7 743-.M IN IN 173+ 1147 II 1141- 1 IN 143- 747 7 743-. M4S 47 43- 139 M 119+ </p>
        <p>41  43- 11 1111 11+  W 9.97 + Ml</p>
        <p>11.91 1145 1145-.17 N4I 41 Nil-. IS 1 IN 173-.14 NlS 4I N41+  II 11 1143-47 IN U4 113-47</p>
        <p>II aa H+ </p>
        <p>14 UN M+ </p>
        <p>ms N mi+ </p>
        <p>747 7 74- 11.N 11.77 1141-.15 IlN UN UN+  9 941 941-. W49 M41 +  US UI7 U41+  U97 M M47- UN UN UN+ Mr W47 17N 17.73-45 U US 11+  47 9.N + Mr 1U4 U41 US+ 41 S.N 1247 B.93*  U n.N IMM-  1191 1174 1191+ .17 US UN US+ 41 1145 II 1145+ MS IN IN IN-.n UN UN 11+ </p>
        <p>CMn InfTr TtllncSlin i</p>
        <p>'Wl-^</p>
        <p>SS"</p>
        <p>KyTE</p>
        <p>NIdiOb</p>
        <p>NCwo</p>
        <p>OMoOl</p>
        <p>FTE</p>
        <p>9 1 943+ II N N4I-</p>
        <p>UN US US-.</p>
        <p>IN Ml 1N+ U UN 41- 9 9 941+</p>
        <p>9.U 9 9- 9 9 9+</p>
        <p>171 IN 1N+</p>
        <p>117 IN 1H- II II II- IN 9 M3- II.S N N-. N N4I N+ 9 IN 0</p>
        <p>IN IN 1N+ II II 1I43+  MS UN R8+ S 1 IN IN-</p>
        <p>M 9 943-S 7.N 7 743- P 0 943- IN IN 1M-.  IN IN-.n</p>
        <p>UN U u-.n U N U14- UN US UN+ 141 IS U3- US US un-.N</p>
        <p>UU U U15-. OMI lUS 1UN-I.N UN USI U4V-41 U UN u-.n 9 0 MS+</p>
        <p>047 0 040+ 174 171 174+</p>
        <p>IN IN 1N+</p>
        <p>Mndn</p>
        <p>GmNin tacGmi IMGr n</p>
        <p> W N43+ </p>
        <p>II II 1143+ Ml   W43+  11 II 1143+</p>
        <p>f, , I P ^</p>
        <p>VSM</p>
        <p>0 0 0-</p>
        <p>UN UN U74-.N 11 11 11+  1 Ml 1- 0.U 0.11 0.11-41 0 0 0</p>
        <p>IN MS IN 044 041 041 7 7 743- IN  +  0 177 177- im UN U03- 141 IN 1- I 1 143- 0 945 943- UU U1I UU+  7 7 7.U-.U</p>
        <p>GUI IWMln MYTFn UNM Eq UNWInr</p>
        <p>9 9 043-</p>
        <p>II II IMF-.n 0 9 + 1 IN UI-. 1 1 1</p>
        <p>US UU uu-.n</p>
        <p>UN U U- 4i  a-</p>
        <p>II 11 11- 177 1 M+-.U UN U U07+  7 7 741- IS IN i-.n</p>
        <p>W^VWi</p>
        <p>11 11 II-.17 IN IN 191+ UN UN U4l-.n 0 0 041-41 UN UN U43- 41</p>
        <p>II 11 1140- M4I U U- 0 0 041-.17</p>
        <p>II 11 1147- Ml 0.17 0+ UN UN UN- UN U7S UTS-.17 41N 41 S44-1 0 0 943-</p>
        <p>UN UN - 41N 41 414I-</p>
        <p>o.n 0 0+ Mr UN  U43-. 0 0 f+  9 9 9+  UN UN UOO+ 41 UN UN UN- 9 949 940+   Ull UM 0 041 0+  W US UN UM UlS UU+ </p>
        <p>IN IN !+ IN M7 M3- I 11.17 N - I Ml I M3- U UN U-.H &amp;gt; 9.U 0 0- 7 7 74+-.N IN S 143-.U IN Ml M3- UN UN 043-   I lU 113-</p>
        <p>tr</p>
        <p>Ml</p>
        <p>1</p>
        <p>41+</p>
        <p>EMSraNi</p>
        <p>Mnr</p>
        <p>11 1171</p>
        <p>UJ3+</p>
        <p>Mttnr</p>
        <p>V V 844+ MS</p>
        <p>lllnr</p>
        <p>MI</p>
        <p>IN</p>
        <p>N+</p>
        <p>1</p>
        <p>in</p>
        <p>MS-</p>
        <p>knar</p>
        <p>7</p>
        <p>7</p>
        <p>747-.12</p>
        <p>EMlar</p>
        <p>N47 U NJ3-</p>
        <p>nr</p>
        <p>Ml</p>
        <p>111</p>
        <p>MK.1S</p>
        <p>CSlar</p>
        <p>IN</p>
        <p>IN</p>
        <p>1-.</p>
        <p>r</p>
        <p>18</p>
        <p>18</p>
        <p>43-</p>
        <p>N UN</p>
        <p>U-</p>
        <p>ISrar</p>
        <p>un UN</p>
        <p>un+</p>
        <p>iFrar</p>
        <p>Mi</p>
        <p>+ </p>
        <p>ram</p>
        <p>ra</p>
        <p>M</p>
        <p>M</p>
        <p>M+</p>
        <p>Ear</p>
        <p>V V.11</p>
        <p>1742-.15</p>
        <p>UN UM UN- Mr 1441 US 1441+  US 14 US- U U97 14-</p>
        <p>Ml IB 1- 0 Ml 0- 9.U Itt 113- 9 IN MI+  U4I UM B-</p>
        <p>1 143-  1 MO 111-. S UN S43- UN US as- N 1 1 1-</p>
        <p>0 043- IN IN-.11 IN IN 1N+ 14 UN UN+ S UN II.N 11.13-.N</p>
        <p>UN U UN- 7 7 743+ IN 177 173- M Ull 9 941- UN US 1153-</p>
        <p>2147</p>
        <p>21</p>
        <p>21.14- .8</p>
        <p>GNnn</p>
        <p>847</p>
        <p>2147</p>
        <p>847-.12</p>
        <p>UMrteMir&amp;gt;</p>
        <p>9.11</p>
        <p>9</p>
        <p>9.11+ </p>
        <p>Thml:</p>
        <p>Ami</p>
        <p>tti7 1247</p>
        <p>H41-.12</p>
        <p>HR:'</p>
        <p>M.</p>
        <p>M</p>
        <p>M41-</p>
        <p>OwtncN</p>
        <p>2</p>
        <p>UN</p>
        <p>M+-</p>
        <p>U</p>
        <p>un</p>
        <p>U75+ </p>
        <p>N</p>
        <p>+ </p>
        <p>Whnalt</p>
        <p>UN</p>
        <p>UN+ </p>
        <p>9.</p>
        <p>9</p>
        <p>94*- </p>
        <p>Inc n</p>
        <p>2</p>
        <p>M7</p>
        <p>23K41</p>
        <p>TiFm</p>
        <p>9</p>
        <p>9</p>
        <p>9</p>
        <p>M</p>
        <p>U</p>
        <p>+ </p>
        <p>biARtn</p>
        <p>N</p>
        <p>UIGuSc</p>
        <p>237</p>
        <p>18</p>
        <p>2</p>
        <p>11.</p>
        <p>U91</p>
        <p>U91- 41</p>
        <p>GNiGr n</p>
        <p>9</p>
        <p>9.15</p>
        <p>941-41</p>
        <p>UkMNG</p>
        <p>9</p>
        <p>947</p>
        <p>9+ </p>
        <p>MN</p>
        <p>N.N</p>
        <p>1273-. 49- </p>
        <p>nss</p>
        <p>H</p>
        <p>H43-</p>
        <p>LMTna</p>
        <p>UnGOvar</p>
        <p>UN UN 1243- 41 8 .M 843+ </p>
        <p>9</p>
        <p>9</p>
        <p>945-</p>
        <p>Eurcgt</p>
        <p>WtM</p>
        <p>M</p>
        <p>M43-111</p>
        <p>Unirnr</p>
        <p>ua</p>
        <p>U12</p>
        <p>U13-</p>
        <p>K54</p>
        <p>N-47</p>
        <p>Ml</p>
        <p>jiiim</p>
        <p>17</p>
        <p>MN</p>
        <p>UN</p>
        <p>8.N</p>
        <p>1M3-1</p>
        <p>17.334.M</p>
        <p>8 8 843-41</p>
        <p>11</p>
        <p>11</p>
        <p>1141- M</p>
        <p>Mdilc</p>
        <p>8</p>
        <p>134*</p>
        <p>H4+-7.12</p>
        <p>iBlwla</p>
        <p>8 8</p>
        <p>1223-</p>
        <p>N 1 *242- .</p>
        <p>GnArn</p>
        <p>wniclav:</p>
        <p>.</p>
        <p>UM</p>
        <p>U73-</p>
        <p>UriAUNIi</p>
        <p>M</p>
        <p>M.M</p>
        <p>M43-</p>
        <p>AIMtaM</p>
        <p>IN</p>
        <p>145</p>
        <p>M4-</p>
        <p>74</p>
        <p>71</p>
        <p>74+ </p>
        <p>EMualn</p>
        <p>M</p>
        <p>UN+ 41</p>
        <p>BiaGOU</p>
        <p>9</p>
        <p>9</p>
        <p>9+ </p>
        <p>1147</p>
        <p>UN</p>
        <p>.-</p>
        <p>ENUiTrn</p>
        <p>841</p>
        <p>U41</p>
        <p>2*4*-</p>
        <p>0ml OM</p>
        <p>7</p>
        <p>7</p>
        <p>743-</p>
        <p>U</p>
        <p>UN UN+ Mt</p>
        <p>EltaiTxEx n</p>
        <p>U</p>
        <p>U</p>
        <p>+ 4*</p>
        <p>FGVnhi</p>
        <p>2N</p>
        <p>Ml</p>
        <p>274-.n</p>
        <p>N</p>
        <p>N</p>
        <p>W</p>
        <p>SMn</p>
        <p>8</p>
        <p>841- 41</p>
        <p>GcuHk</p>
        <p>2N</p>
        <p>2N</p>
        <p>2N+ Ml</p>
        <p>9</p>
        <p>9</p>
        <p>9+ 41</p>
        <p>SMUnga</p>
        <p>11</p>
        <p>11+ 41</p>
        <p>Td!r</p>
        <p>U</p>
        <p>un</p>
        <p>U+ </p>
        <p>1249</p>
        <p>12</p>
        <p>1243-</p>
        <p>UN</p>
        <p>U8</p>
        <p>U8- .11</p>
        <p>TxFrCN</p>
        <p>9</p>
        <p>9</p>
        <p>9+ </p>
        <p>1147</p>
        <p>128</p>
        <p>1242-</p>
        <p>GnTKEB"n</p>
        <p>12</p>
        <p>12</p>
        <p>UM+ Mt</p>
        <p>TnxHY</p>
        <p>U</p>
        <p>N</p>
        <p>U8+ </p>
        <p>1</p>
        <p>274</p>
        <p>274-</p>
        <p>tNUamgi</p>
        <p>ViMggr</p>
        <p>9</p>
        <p>9</p>
        <p>947-.11</p>
        <p>11</p>
        <p>11.</p>
        <p>11.+ MS</p>
        <p>9</p>
        <p>9</p>
        <p>944-.</p>
        <p>UMmaira:</p>
        <p>N47</p>
        <p>U8</p>
        <p>U8+ </p>
        <p>UN</p>
        <p>UN 1M1- .74</p>
        <p>BroHlVd</p>
        <p>9</p>
        <p>9</p>
        <p>9+ </p>
        <p>UN</p>
        <p>+ </p>
        <p>GMINn</p>
        <p>N</p>
        <p>UN</p>
        <p>U93-.N</p>
        <p>Fund</p>
        <p>1171</p>
        <p>1141</p>
        <p>1151-41</p>
        <p>UM</p>
        <p>W</p>
        <p>M42-</p>
        <p>Gauavsn</p>
        <p>+ </p>
        <p>InOORN</p>
        <p>Ml</p>
        <p>18</p>
        <p>MI+ </p>
        <p>9 IN 9+ </p>
        <p>N 41. 4143-.N U17 Ull UI7+  US* U U54+  9.74 9S 9.74+ MS f.n 9.N 9</p>
        <p>741 7 7+  9 Ml 9+ MS .N .N UN+  .17 Ull U17+ 41 1141 1117 I1I7-  S S4+- . 11 UN UB+  9 IN 9+  II.N II 1140-.11 I 171 1+ MS</p>
        <p>UN U U- UN UN U43-</p>
        <p>1141 1114 1119-.14 ll.n US UN- 9.15 9 943-</p>
        <p>Munidpil I 7.N 7.75 7.73-N</p>
        <p>SlliMlGlhnr</p>
        <p>Mni|nlnv</p>
        <p>SMilMOip:</p>
        <p>CoimnnSlfe</p>
        <p>Pro^</p>
        <p>Tnlx</p>
        <p>FmnFii:</p>
        <p>Bolann</p>
        <p>Gudlin</p>
        <p>Munin</p>
        <p>10 11M W43-.S 11.93-</p>
        <p>1241 II</p>
        <p>IN 151 153-. 7 7 740- 9 9 940- 9 9.N 9+ </p>
        <p>17 17 1745- Ull UN I24+-.N 7 7 7+.04</p>
        <p>ExdiFdn Gndbnr Inuil</p>
        <p>in lUS 1U40-141 71 71 n.N-240 N S S4+-1</p>
        <p>USTaiFrn MTbdo , Volte nr IMOU Ni</p>
        <p>tncNMn</p>
        <p>Uj^^GHin</p>
        <p>isiln ^ In vonr </p>
        <p>41  41+ </p>
        <p> a-</p>
        <p>
        </p>
        <p>UN UW U13-41 1  M5- S n 21.93-. 9.91 9.N 9.93-41 12 II.N 11.13-47 I1.N II 11+ </p>
        <p>AfmrMn</p>
        <p>AMdNidn</p>
        <p>Imwin</p>
        <p>Oenmogron</p>
        <p>MnliiFdi:</p>
        <p>CipOppirn</p>
        <p>Otaoown</p>
        <p>HvMunn</p>
        <p>HYBdin</p>
        <p>mMunn</p>
        <p>2</p>
        <p>M</p>
        <p>I</p>
        <p>IN</p>
        <p>111 2</p>
        <p>  43-41</p>
        <p>1 143- IN 173-</p>
        <p>cSrr</p>
        <p>IS 117 117+41 UM UN 14+  9 9 9+ nil 1145 1145-</p>
        <p>UN</p>
        <p>7.73</p>
        <p>UN</p>
        <p>9.</p>
        <p>10</p>
        <p>Ml</p>
        <p>Ml</p>
        <p>115</p>
        <p>UN</p>
        <p>UM</p>
        <p>S</p>
        <p>UN</p>
        <p>UM</p>
        <p>4.01</p>
        <p>4</p>
        <p>Ull</p>
        <p>17</p>
        <p>0</p>
        <p>II.N</p>
        <p>1044</p>
        <p>17</p>
        <p>0</p>
        <p>45</p>
        <p>'fflsy ,</p>
        <p>SpKin ^</p>
        <p>Nodin ToMRNn UnivrMn SIkMM</p>
        <p>Fundi!</p>
        <p>Invtl Ivr SIrnlOn SIraHnGllin HmiFmNi!</p>
        <p>Go^cn Innn hmt</p>
        <p>?C</p>
        <p>Tom</p>
        <p>TmpMm Group! Forign  1107</p>
        <p>GmT  UN</p>
        <p>Gtobol II  11</p>
        <p>Growth  13</p>
        <p>Inoom  Ull</p>
        <p>World  Ufl</p>
        <p>ThonmnMcKlon: GloUnr  9</p>
        <p>Gwthnr Inconr Opornr ToxEx nr USGvnr Tmoalilnc TrmonGr TfWlFMldt:</p>
        <p>Bdldx liilGvl Eqindx Vohw MhCiidury:</p>
        <p>GIftr Growlhn LTBondn Solodn</p>
        <p>UN U0I-1.N 7 743- .N UN+  3 3+ M U + MS 0 MI+41 1 M3+  7.N 1.01-.11 15 1155- US 1444-. B.M 2244-.13 12 1140-S 10 117*-.</p>
        <p>t*&amp;gt;M41 I44+-. UN 13 I1N-.M 1341 Utt U4*- UN UN M40-.N IlN U UN+ 41 Ull 110* 11U ,</p>
        <p>01.17 US U03-I 54 N 5147-40 95 9174 9143-t.N</p>
        <p>las IS mn-is lUN imo 1UII-1 TTMS 74 7440-M4 S 74.N 7105-241</p>
        <p>4 4+  4 4.H- IM 113-.17 as U1I+ .11 17 1743-</p>
        <p>9.M 3+ </p>
        <p>II lt+ MS U41 1M+-41 17.11 17.11-.15 9 9+ Mi 19 W-</p>
        <p>17 1743- UN U93- MS</p>
        <p>11 1141- UN 12.73- U07 UW+ M 11*4 M44-</p>
        <p>UN</p>
        <p>9</p>
        <p>12</p>
        <p>W</p>
        <p>3</p>
        <p>1147</p>
        <p>S.N</p>
        <p>9. 9.73-. IIS nJ4- 9 9+ MS II 1143- UN -41 9 9+ 41 II 1147+ .M 21 nj3-4t</p>
        <p>MS</p>
        <p>9 9+  9 9</p>
        <p>41 U43-47 Ml M+-</p>
        <p>TxEInt n TxELT n UNrar USGvn VMar USMQmN: Comotn GoMn GrwHin Inconwn IncStk SnMtn TxEHY n TxEITn TxEShn</p>
        <p>IlN</p>
        <p>N</p>
        <p>S</p>
        <p>91N</p>
        <p>N47</p>
        <p>Ml</p>
        <p>9544</p>
        <p>54*</p>
        <p>* 18- UN US7- N.U N+  II 1147- 9MI UN+  N NS+  111 111- 91 9M4+  IS IS-</p>
        <p>9 9. 9+  112 Ml 105-</p>
        <p>7l!mi mi-</p>
        <p>M M U43- II II 1143-S</p>
        <p>ai  -1</p>
        <p>S  S-l</p>
        <p>ii'SI&amp;amp;S</p>
        <p>21.91 n 2143- .15 9.N 9 9.71-.17 UN 41 UI4- 47 4173 ai7 aiT- 2M* S.15 S43- 9 9 942+ MS IS 125+. 7 7 7+ W US UM+ 9.17 Ml 9.17+ 24 U 2143- 9 9 941+ 41 11 11 1147+  UM .UOl UN+ Ull UN UW+42 UN UN UN &amp;gt;. IlN IIS 118 941 9 949- 41 M7 MS I4-4I 9 9 9+  11 UN U03- II 11 1145- UN UN U43- UN U nji- 9.71 941 943-</p>
        <p>11 1111 11+is</p>
        <p>IlN 11 11N-.U UN lin UN- 1241 UN UI3-.U 9.M 9 943- IN IN 173-.11</p>
        <p>1131</p>
        <p>9.N</p>
        <p>II</p>
        <p>1141</p>
        <p>9</p>
        <p>U71</p>
        <p>12</p>
        <p>II</p>
        <p>UN 1107-N IN M7- UN U73-. UN 1141+ 47 9.U 9.- 1115 1115- UM Utt II ll+  M +</p>
        <p>IN Ml MS+ 9 9 9+ 7 7 7-.11 7 7. 7+41  UN U93- US UN UN- MS 145-a</p>
        <p>Ganarotn</p>
        <p>Gwttin</p>
        <p>Incon</p>
        <p>Indianan</p>
        <p>MuHn</p>
        <p>UMNdFMdi:</p>
        <p>AccumuHIv</p>
        <p>1 IS + </p>
        <p>17.N 1741 I74+-  US US-.tt M7 I M7+47 UN UN U73-</p>
        <p>U4I 17 I7.N- IMS an S43-  9 9.N 443+  N 0177 iS^</p>
        <p>in IN m- p 1JB rJM IMh-M un II 1143- ,n.</p>
        <p>Cent inconw GoMGvt GvISoc IntlGIh</p>
        <p>High Inoonw Hllncll</p>
        <p>MuNcpI</p>
        <p>MunHl</p>
        <p>NwCcpt</p>
        <p>SdEngy</p>
        <p>Vanguard</p>
        <p>Nauwlrlhn  11.11  UN  UN-</p>
        <p>PInaSIrn  11  1141  1143-</p>
        <p>WInGrr  9  9  f.l&amp;gt;-</p>
        <p>n-Ne Initial sNii load.+-Pml*iw's quiU r-RadHnpHon chargi iWm NW-ii^s dlvldand. CopyrlthtVTlia</p>
        <p>4 4</p>
        <p>175 141 Ml 145 U 41 1 IN</p>
        <p>U43-.2I U27- . 947+ .tt 1t+ .n 11+ MS UN+  U99-.M 11.91- .15 M9-.1*</p>
        <p>GBTn GNMAn GMShn Grawlh n Incon LoCanr NwPronr Praaprtnr RaSEotn</p>
        <p>US un un-.u</p>
        <p>9 9 9+ </p>
        <p>111 101 111+ 7 7 744-. 044 0. 0.74+  444 IM 114-.11 1 I 140- .  .73-  .n</p>
        <p>7.N 7.41-.M</p>
        <p>41</p>
        <p>Learn real estate investing from the ground up.</p>
        <p>Join us for a CENTURY 21</p>
        <p>Investor Workshop!</p>
        <p>Time: 7:00</p>
        <p>Date: December 1,1987 Piece: Sheraton-Greenville Admission Free.</p>
        <p>PutNumbcrl</p>
        <p>towi^ibryoii!.</p>
        <p>1007 Cntoy 21 MmIEumi Copgalaiwk olCMMy2IIWbHiC EAGHOmCEir</p>
        <p>ifKttlF*ai4</p>
        <p>Tiplon Ik Assodaiss 919-S55-7224</p>
        <p>MCGLADREY Hendrickson &amp;amp; Pullen</p>
        <p>ccnrinco nunuc accountant*</p>
        <p>LOTUS 1-2-3</p>
        <p>  UN</p>
        <p>17</p>
        <p>Eqta  IN</p>
        <p>GNMA  US</p>
        <p>GloM  S</p>
        <p>GaM  11</p>
        <p>HMYWd X UM Ilf Tin  1141</p>
        <p>OTCFd  M</p>
        <p>sss*  a</p>
        <p>Thna ToHW USM OuirCOunlSc</p>
        <p>0 M3-49</p>
        <p>II. 11.77- UN UI3- 7.N 7.13- n n+ MS 11. 1I.75- 1141 1143- UN IlM-.M 11 11.71+ 41 US US2- 747 740-. n 1143- Ull U12- US U73- UN UN- 0 041+ 41 UN UN-.24 M7 170-47 0 0</p>
        <p>US U22-</p>
        <p>By popular request, In cooperation with Craven Community College we are offering training on Lotus for the novice and experienced user.</p>
        <p>BASIC - PART 19-4pm, Nov. 24 PART II 9-4pm, Nov. 25 ADVANCED - 9^pm, Nov. 30</p>
        <p>Call Ann Herring (637-5154 or 1-800^-6894) for reservations, v The cost Is only $95.00 per day.  .</p>
        <p>iGi toNoiSKar</p>
        <p>CNTFrn</p>
        <p>11 11 NN  UN UN UN 0</p>
        <p>Ml IN</p>
        <p>UN UN U UM U </p>
        <p>7.N 7.N 7 7.71</p>
        <p>For most businesses, the only risk manager youll ever need is your Independent Agent..</p>
        <p>f 9</p>
        <p>RAYMOND BURR</p>
        <p>Htres why... You need Insurance for your premises, machinery and data processing equipment, workers c(Mnp, disability and employee benefits.</p>
        <p>We can be your risk manager-it wont add a cent to your payroll.  _</p>
        <p>TADLOCK WaUDANCE AGENa. WC.</p>
        <p>Doug Hill. Charlas Qaaklns. Frank Dali Agants</p>
        <p>758-1165</p>
        <p>FKro YMrt Of Senrlct...Joan May (Center), manager of Tlia Fual DOC on Memorial Drive la pro-aantad wHh a plaque In her honor for 5 yoara of dedication aa manager of her atoro. Pictured wHh Mra. May la Cheryl DuRant (left), supervisor of the stores and Keith Ballentlne (right). Vice President of Daughtridge Oil Company. The plaque wet preaenled at a luncheon in her honor.</p>
        <p>WhydidCoffyPro Choose s;?</p>
        <p>CopyProk Inc, Greenville, NC</p>
        <p>We have the system that made this dynamic building possible. Interior flexibility. Superior energy efficiency. A weathertight roof system. Attractive appearance: Low maintenance and life-cycle costs.</p>
        <p>Our high volume of repeat business from many satisfied customers is evidence that we provide top quality construaion at a very competitive price. Call us today. We'd like to build for you.</p>
        <p>HlgliwayMlEMt PO. Box 1863 QrMnvUlq,NC 27834</p>
        <p>ijm^jjcQNIWCRMi</p>
        <p>919-758-2138</p>
        <p>I</p>
        <p>{</p>
        <pb facs="00096780_0043" />
        <p>The Dally R&amp;lt;f&amp;gt;&amp;lt;ctor. Qrnvtti, N.C.  Sunday. Novembar 22,1987</p>
        <p>ByPETERCOY APBMiMMWHter NEW YORK (AP),-^ Investors shaken Washington wUl hold to its deficit I</p>
        <p>Don't Spell Another 1929</p>
        <p>iiWa</p>
        <p>fighter budgets wUl not lead to another depression like the one that foUowed fiiecnihofm</p>
        <p>jnhleipnifss</p>
        <p> But most investors and economists say 1967 is different, and there is plenty of roomlor cutting the budget now without driving the economy into a recession.  vr  5-</p>
        <p>In fct they say .Washington needs to agree on a deficit-slashing package to convince nervous U.S. and foreign investors that the United States is getting control of itichronic overconsumption.</p>
        <p>:: Friday's agreement, although inwerfect, staved off the chance of a finan-dal panic caused by a crisis of confidence in government leadership, said M. Katfi^ jgiCkfaofi, president of Eickhoff Economics in New Y^^^</p>
        <p>^ Iw^B^shur greater danger to this economy from a financial breakup than fiom tbi amount of recession that could possibly be triggered by a few billion XdoOaiO) in Spending cuts, said Ms. Eickhoff, who was associate director of jsconon^ poncw for the Office of Management until this past spring, r' Hie sMe of Colorado this past week froze the assets of 13 industrial banks, uddieh are liki savings and loans, saying it wanted to avoid a crisis.</p>
        <p>'This M another place where the financial system is very fragile, Ms. Eidiliotffsaid.</p>
        <p>r The danger is not over yet, said Mn Oliver Wilson, chief economit of Bank of America inSan Francisco.</p>
        <p>; "They (budget negotiators) do not want another Oct. 19th. Theyve got to end out strong enough signals to take care of the stock market and the iinan-^marfcet^Wilsoosaid</p>
        <p>Ciitti^ the budget slows down the economy by reducing the consumption of joods and services, llie process can occur either through a reduction in gov--emment spending or through higher taxes that squelch spending by IwsinesM or consumers.</p>
        <p> Some economists do believe that overly ambitious cutting of the budget def-could help push the economy into recession.</p>
        <p>' "Im a littte concerned about any contractionary policy right now. Were repeating histoiy (of 1929) pretty well so far, said Robert Shiller, an economics professor at Yale University.</p>
        <p>"Eventufdly weve got to have a big budget cut; maybe this isnt the best time to do it. The nnarket is a little vulnerable right now, after the crash, Shiller said.</p>
        <p>Shiller said a survey he did of nearly i,ooo investws showed ttiat half Of the professionals and a third of the individuals had thoiq^t about the crash of 1929 m the days befcre the 1987 crash.</p>
        <p>Based on that research, he said, the crash of 1967 is likely to be fresh in peoples minds for years to comeespecially next year, when the contractionary effects of the btmget cuts begin to kick in.</p>
        <p>Hie combinatim ai an economic slowdown and the memory of fiie crash, he said, cmild spell trouble.</p>
        <p>Robert HdHxtmer, an eccmomist at New Yorks New School for Social Research, said he believes cutting the deficit now could hurt the economy. But he suRK^ the cuts anyway because tl^ would restore the confidence of U.S. and f(M%ign investors.</p>
        <p>"1 diNit think deficits are wildly out of contrcd, Heilbroner said.</p>
        <p>But became of the need to amwer to Wall Street, he said, "I hope to God they will come out with some sort ai deficit sla^, which 1 think oUierwise w(wd be counter-indicated now.</p>
        <p>in other economic and business news this past week; ^</p>
        <p>U.S. industrial production shc^ up O.SpercCliit in OctMi, Qie best gain hi three months, the government said. A surge in auto production accounted for more than half the stit^th.</p>
        <p>-Business inventories rose a sharp 0.6 percent in September, the biggest gain in four months, while business sales rose 1 percent.</p>
        <p>-Farmers earned a record $52 billion in 1986, due mostly to declining expenses.</p>
        <p>-U.S. industry operated at 81.3 percent of capacity in October, the highest rate in more Uian three years.</p>
        <p>-Housing construction plunged 8.2 percent in October, the biggest decline in more than three yjears. Analysts blamed the setback on rising mortgage rates and fears over last months collapse (rf the stock market.</p>
        <p>-Consumer prices jumped 0.4 percent in October with increases across a wicte range of items more man offretting lower energy costs.</p>
        <p>-The Supreme Court upheld the criminal convictions of former Wall Street Journal reporter R. Foster Winans and two others wiw profited from stocks he was writing about. But the case did not establish a national precedent on whether laws against insider trading aiqily to such cases.</p>
        <p>-Commerce Secretary C. William Verity said Japans reluctance to raise export prices in keeping with its stronger currency is thwarting improvements in the U.S. traoe deficit and could provoke U.S. retaliatory duties.</p>
        <p>-Employees of large companies would be allowed to take unpaid, job-</p>
        <p>Wall Streeters See Washington's Budget Act As Cause For Doubt</p>
        <p>r  fiylHLLMENEZES</p>
        <p>t  APBviMuWriter</p>
        <p>I NEW YORK (AP)-Washingtons Ikng-funning song and dance about t afSuieteM budget deficit stiU hoUsWaD Streets attention, but the latest version of the act led to market frustratiooratlier than rave reviews.</p>
        <p>I Yes, file budget negotiators from tOmss and the White House ended Ineam a month of talks this past ^feek with a tentative two-ymuTr jpeement to trim about $76 biilion (WomthebuilgetdeficiL Yes,idooiBtic biMhtotctitsof$23 tbillian took effect Fray as sched-t oled. ^</p>
        <p>&amp;gt; And yes, the stock market rallied at file end of a quiel week following I theamMuneement that an agreement</p>
        <p>But to many Wall Streeters, the final stages of the "budget summit that produced the agreement were cause for doubt rather than relief that the government was making an itoaikess one of the biggest</p>
        <p>hadbeeBrenched.</p>
        <p>nagging the market.</p>
        <p>After a month of dkkering, any agreement was seen as more favorable than a total breakdown of the talks. Yet Wan Streetere said the in-abilitv of lawmakers to act more (gray on what some consider a relative^ simple problem - deficit spencfing - reflected a lack of government resolve and leadership that makes the markets nervous.</p>
        <p>^ "It was one time (kmgress should have acted and made a decision, said Susan Marker, of the investment firm Janney Montgomery Scott in</p>
        <p>4 European Burlington</p>
        <p>Fatilities Will Be Sold</p>
        <p>IT</p>
        <p>: (MIEESBORO (AP)  Four European Burlington Industries plants, grUfdi employ about 2,800 people and had $220 miUion in revenues in fiscal weaf 1967, are for sale as officials seek ways to pay off a $2.8 bUlion debt incur-^whenthec(miponythwar^aho8tilet^eover^. *  .</p>
        <p>Unite(jfsSda^l1i08e plants, iii Mexico andSmda, ma^aj^rel fabrtes and</p>
        <p>^iSreefabric plants in Ireland employs 1,200 workers, and one plant in Italy ^^(^l^WO. Burlington employs about 43,000 worldwide and had total sales</p>
        <p>"Our Eunpean operatiims are modern, well-run and profitable businesses it have enj(^ substantial growth, Frank Greenberg, Burlingtons lirman and chief executive officer, said in a statement Friday.</p>
        <p>"Over the years, we have benefited from excellent relationships with the less community, the government and loyal, well-trained work forces in Ireland and Italy, he said.</p>
        <p>A plant in Frosinone, Italy, and one in Tralee, Ireland, make up Burlingtons Klopman International S.p.A (fivision, which makes polyester-cotton faorics for manufacturers of uniforms, leisurewear and activewear.</p>
        <p>Plants in Longford and Tullamore, Ireland, constitute Burlington Sport</p>
        <p>swear Fabrics Limited, one of Europes leading denim producers.</p>
        <p>iinpendent&amp;lt;'</p>
        <p>tto, and its intrationd products are sold piwiarily in the areas in which</p>
        <p>r Burlin^s international operad^ are inpendent of its domestic opera-</p>
        <p>;they are produced, according to (xmpany documents.</p>
        <p>I Since Buriington thwarted the takeover attempt ^ going private six months ago, it has agreed to sell its two denim plants in Ervin for $206 million to Dominion Textile Inc. of Montreal. Dominion and New York financier Asher Eddman were behind the failed takeover bid.</p>
        <p>; Burlington also has offered to sell, but has not sold, a weaving plant in ;Ramseur and its industrial divisions, which make fabrics for electronics, aerospace, military and automotive uses. The divisions' annual sales are about $300 million.</p>
        <p>t More tales are expected because Burlington has said in documents filed with the federal Securities and Exchange Commission that it must sell about !$900 miBioo worth of assets over the next two years to meet debt-peymcnt *deadlinei.</p>
        <p>TRY OUR SUNDAY SERVia</p>
        <p>At Kilos, w offer complete comring services seven days a week. Ad w st^f has a frtendly, nrofessional attitude you wont find aqywliere else. Try KMos. We could be the answer to your prayers.</p>
        <p>kinliOT</p>
        <p>.1</p>
        <p>Great copies. Great people.</p>
        <p>Pittsburgh. "I think we needed it in this country and I think Europe wanted tosee it.</p>
        <p>The budget talks had held world fi-</p>
        <p>ril markets rapt all week as inched toward their Friday deadline.</p>
        <p>Togettwr with the United States mas^ trade imbalance, the bui^ deficit was considered a bey factor In the economic and financial nenimism that set the stage for the 19 stock market crash.</p>
        <p>With much fanfare following the crash. President Reagan had called for a budget summit to address the deficit above and beyond the automatic cuts called for by the Gramm-Rudman budget law.</p>
        <p>Up through the time the ffaial deal was announced, the president and congressional leaders were stressing the need to take action that would send "the right signal to financial inarkets that reinmned jittmy in Uie wake of the crash and reconf plunge in the dollar.</p>
        <p>But as the initial enthusiasm gave way to bickering and the talks 1^-ed down, the stock market became resi^ied to the notion that radical deficit action was unlikely. Nevertheless, a lack (d significant developments on other ^ts kept the budeet talks in the forefront of the manetsattention.</p>
        <p>At the end, market watchers had mixed reactions to the final proposal,</p>
        <p>' which many deemed a disappointment for all the waiting.</p>
        <p>"Based aa what weve seen over the last two weeks, it would seem to me our pditical leadors really have failed, because what theyve come up with it not much higher than the Gramm-Rudman number, said Mary Farrell, a market analyst for PaineWebberlnc.</p>
        <p>"It has dominated Wall Street this week, and essentially its been a non-event, she said.</p>
        <p>Trading quieted this week, as in-veston were reluctant to take major positions before getting final word on a bud^ plan that conceivably could have sent a shock through the markets.</p>
        <p>Volume on the New York Stock Exchanged averaged 163.43 million</p>
        <p>shares a day, against 174.81 million the week before.</p>
        <p>The Dow Jones average of 30 industrials closed Friday at 1,913.63, down 21.38 from a week earlier.</p>
        <p>The NYSE composite ihdex fell 2.04 to 135.56; the American Stock Exchange market value index fell 8.86 to2ttB.aiid the NASDAQ composite index for the over-the-counter market dropped l0.4BtoSll48.</p>
        <p>SrasrioKlnllraaboiaastlie market contimuidsiittling down from its historic crash last month.</p>
        <p>"lUs is the best process that could take place in the marketplace, no rallies, no drastic selloffs, everything running in a lateral course for a while, said Fredric W. Ritterreiser, president of Sherwood (^pital Inc.</p>
        <p>Whether the roughly lateral course continues will depeiKl largely on how the budget proposal is received by foreign t nvestors  a key source ai for the federal deficit -</p>
        <p>The package, which includes $23 billioo in new tax revenue over two years, already has received harsh criticism from some GOP lawmakers and could face a similar reception by investors.</p>
        <p>Pran Rastrictiont</p>
        <p>KUAU LUMPUR, Malayaia (AP) - Hie government, which last month bannecf three local newspapers, will amend its press contnil law next month to tipten restrictions on the media, sources said Saturday.</p>
        <p>J</p>
        <p>the ^________________</p>
        <p>tions Act would be amended, but he would not elaborate. He said details would be available only when Prime Minister Datuk Mahathir Mohamad presents the bill to the House of Representatives on Dec. 2.</p>
        <p>Other sources, spring with the condition of anonymity, said restrictions would be fij^tened.</p>
        <p>"Certain suggestions have been made recently concerning the press, so we have studied them and we are coming out with these amendments, MegatJunidsaid.</p>
        <p>General Electric mobile telephones and radios.</p>
        <p>For personal and busli</p>
        <p>Comgtete line of mobile (ximmunicatloig  |  /</p>
        <p>e Cellular mobile telephones.</p>
        <p> 800 MHz trunked radiotelephones.</p>
        <p> many models of mobile radios.</p>
        <p> porteble two-w^w radtos.</p>
        <p>System design.</p>
        <p>Complete tostaOatkm.</p>
        <p>Expert servicing.</p>
        <p>User-flnandng plans.</p>
        <p>We bring good (hings to life. 6INIRAL AeUCTIIIC</p>
        <p>Available Locally At</p>
        <p>TODD'S STEREO</p>
        <p>106 Trade 81.  Phone 786-2263</p>
        <p>DISTRIBUTED BY SAVIN A HILL CO. INC.. Ahoakie. N.C. (919) 332^4149</p>
        <p>protected family and medical leaves under a controversial bill aniroved by the House Education and Ubor Committee.</p>
        <p>American Tele{4ume &amp;amp; Telegraph Co. prqiosed lowering its interstate long-distance rates by an average of 3.6 percent to reflect rerluced expenses. -Federal Reserve Chairman Alan Greenspan called for repeal of the 54-year-old law that bars banks from the securities business, backing an ap-(Hoach that would give his agency broad oversight over the n-ocess. Bipartisan compromise legislation was introduced in the Senate.</p>
        <p>The Mexican peso plunged 30 percent in a single day on the free market after the government stopped using its foreign-currency reserves to siqiport it. The government continued to support the pesos value in the controlled market, which covers about three-quarters percent of dollar trading.</p>
        <p>-The government and Union Carbide Corp. failed to meet a deadline for settlement erf Indias $3 Inllion damage suit in the Bhopal gas leak, which MU-ed 2,660 people and injured more than 200,000.</p>
        <p>-T. Boone Pidiens Ivanhoe Partners withdrew its takeover bid for New-mont Mining Co. in the wake of a Delaware Supreme Court decision uphirfding a ruling that blocks the buyout.</p>
        <p>-Bank of New York Co. Inc. revised the terms of a hostile takeover bid for downtown rival Irvii^ Bank Corp., trimming the value of the cash-and-^ock offer by nearly $200 million from the original $1.4 billion.</p>
        <p>Inc. agre} to sell its records group to Sony C(n^. for ^ billion. With the sale it has nearly completed the restructuri^ that will leave it only with operations in tn'oadcasting, where it got its start in the late 1920s.</p>
        <p>Twelve states were named finalists fm* a $250 million-a-year soniconduc-tor manufacturing research operation. The 12 were Arizona, California, C(^ orado, Florida, Massachusetts, Missowi, New Mexico, New York, North Carolina, Oregon, Texas and Wisconsin.</p>
        <p>-Pennzoil Co. proposed that Texaco Inc. pay a non-refundable $1.5 billioo in exchange for Penraos acceptance of a $5 billion cap on any liability for Texaco in the two companies multibillion-doliar legal battle.</p>
        <p>Merger Impact</p>
        <p>WINSTON-SALEM (AP) - The jobs (rf Piedmont Aviations service level workers are safe, but there mav be reductions at the combined bead-quarters of USAir and Uie Winston-Salem-based airline, USAir chairman Edwin Colodny says.</p>
        <p>"We do not intend to ask for any salary cuts. We guarantee that the customer service personnel at the stations will have no layoffs due to the merger, (olodny said Friday during a speech to the annual banquet of the Greater Winston-Salem Chamber of Commerce. "And the merger will in fact not occur until all the labor issues are resolved.</p>
        <p>As for the effect of the merger of Piedmont and USAir on administrative employees, Colodny told reporters after his speech: There will be some reduction in the combined headqu^rs staff of the combined companies. Most of the redundancies are in the staff areas. And wre going to try to work those out aa hot we can.</p>
        <p>"Hie impact in Winstoo will be</p>
        <p>tteb people who are asked to tomre eiUier to Pittsburgh or Washington, he sakL referring toa USAir main bub ana its corporate</p>
        <p>headquarters. "On the other hand, there may be functioiw that are moved here from other places.</p>
        <p>Colodny, who was visiting Winston-Salem for the first tin since the Nov. 4 merger, said it is too early to say how many jobs will be shifted or eliminated as an offshoot of the merger.</p>
        <p>USAir, which formally acquired Piedmont this month, also plans to expand Piedmonts hubs in Charlotte, Dayton and Baltimore while retaining Piedmonts ndwork of service to smaller cities in the Southeast, Colodny said.</p>
        <p>"We intend to remain the No. 1</p>
        <p>airline in this i odny said, what Piedmont has worked so hard to</p>
        <p>develop."</p>
        <p>Colodny said the merger was forced by USAirs need to increoae Hs share of the U.S. market at a time of rapid consolidation. By acquiring Piedmont and Pacific SoimNfCSt Airlines earlier this year, USAir Group Inc. now ranks as the second largest airline on the basis of passeu gen boarded anmially, behina Texas Afr Corp., (Totodny said.</p>
        <p>lu iv ivaxicuu Ufc Awv. I</p>
        <p>5 part of the world, CM-rhere is no givtog up</p>
        <p>MONEY MANA(MENT SEMINAR</p>
        <p>Date: Tuesday, December 1,1987 Place: Holiday Inn-Greenvlile Time: 7:00 p.m. - 9:00 p.m.</p>
        <p>TOPICS WILL INCLUDE:</p>
        <p> Fundamentals Of Investing</p>
        <p> Mutual Funds</p>
        <p> Tax Advantaged Investments</p>
        <p> High Yielding Investments</p>
        <p> Financial Plannlng-How? When?</p>
        <p> Ten Most Common Financial Mistakes</p>
        <p>Guest Speaker:</p>
        <p>Alon A. Mann, CFP Certified Financial Planner</p>
        <p>Mr. Mann has 19 years experience In various financial service industries. He has given more than 75 public seminars and has taught financial planning courses at several colleges and universities.</p>
        <p>Mr. Mann is a frequent lecturer on a variety of financial topics. His presentations are always fun and informative</p>
        <p>RBERVE YOUR SEAn</p>
        <p>There is no cost or obligation for this lecture. HOWEVER, DUE TO LIMITED SEATING, RESERVATIONS SHOULD BE MADE IN ADVANCE Please return the attached coupon to reserve your seats or call 1-800-662-8842.</p>
        <p>Sponsored by: The Roblnson-Humphrey Co.</p>
        <p>6501 Six Forks Road, Suita 100 Raleigh, NC 27609 A omra or INMira UMMN moiimw  AN AMBUCAN IXPfWM OCNWANV</p>
        <p>I?attodyo" tocir?o Ma7aQ|^To8r</p>
        <p>MONEY</p>
        <p>iuuM iwutrvu.....................................</p>
        <pb facs="00096780_0044" />
        <p>"UNtt Thiflly^nttitotor.Qiittnviii.N.C. 8widr.Noimm&amp;gt;trag&amp;gt;Hiy</p>
        <p>I</p>
        <p>R^f^ii4&amp;gt;g8 &amp;gt;N&amp;lt;rtes'' '(</p>
        <p>m</p>
        <p>'*v</p>
        <p>(CMtacdbmB-IS)  Slock  PuKhOtt</p>
        <p>;Mf-</p>
        <p>Butbm Opuu</p>
        <p>SEB has amioaiiced the of Waynes Body Shop It Boule 8, Gfeenville, on Goimly Road 1415.</p>
        <p>The owner of the new business said that operating hours will be from 8 a Jn. until 5:30 p.m. Monday through Mhqr,(m2439).</p>
        <p>Bb, who has been associated with Brawn and Wood Inc. in Greenville for the post eight years, has 13 years of cnerience in automotive body and painting. He said he holds iSmtification.</p>
        <p>Weston Steor4iom V F*s Inc. ......ddbectors</p>
        <p> Ithatitsboardof</p>
        <p>recently authorised the repnichatt of its owh shares at market price, in thediscretiooofitsoffioers. ^ ,</p>
        <p>The compaqy siiid it asked its shareholdera at the 1087 annual meetiiw for approval to puRhase up to 200,01 shares during the cn^ 12 months. Hie directors, while nd authorixiiw the repurchase of a nedfic numher of shares, directed Satofficers purchase in their d^ tion at the market price, and without recourse to borrowing.</p>
        <p>Chang^i Announced</p>
        <p>Texasgulf Chemicals Co.^ an-nounrod the reoraamxation of its engineering ana maintenance departments to form a single engineering and maintenance group at its phosphate operations at Aurora.</p>
        <p>Tom Regan, vice president* production, said the move will pro* inote efficiency as well as utiBae the talents of supervisory persoond udm are abeady assigned to engineering</p>
        <p>andmainlioaiirotonctions.^ ^ ^ ed group wiD consist of six supe^ Regui named M.T. Mitch. Har- visors, including:  &amp;gt;</p>
        <p>ris as the new manager of the .y  of</p>
        <p>llSB&amp;amp;.etonViJS' SfcSuBSe</p>
        <p>ssVJ!S^</p>
        <p>atl^Crrok.  _  mahilenanro; O. SimoiB, simerin*</p>
        <p>Thespokenansaidtiier^rganix* tended of instrumentation anddec* mmmmmmmmmmmmmrnmmtmm maintenance; BA Johnson,</p>
        <p>guoorintendent of chemical plants StotoBanc^ and S.R. PhUUro. teehnicalsendcesuperintendent.</p>
        <p>thWquartt^^n^^"* percentfor^^'^ . ,4..</p>
        <p>iwmwageifndsalai I6peroenteqaledthe. . incnases reported in Maroh aid June 1987. Increases were largest fok ^ administrative support workers including clerical, professiooial and &amp;gt; technical workers,.lemiskifled laboren and worken in se^ cupations. Wages and saUm for ^ sales worken in finance, insurance and real estate were lower over the ^ year.</p>
        <p>Hoon Rotary Chib and a meniber of GhamherofOommeraa.</p>
        <p>navkiPmkh.1</p>
        <p>MITCH HARRIS</p>
        <p>Wages and salaries for Southern worken rose 2.6 percent for the year ondfatf in September, according to Donald M. Craro, regional commissioner for the Bureau of Labor Statistics, U.S. Department of Labor.</p>
        <p>Choe said that for the third quarter of 1987, the employment cost index for the South, involving wages and salaries only, increased 0.8 percent</p>
        <p>erase said compensation costs, involving wages, salaries and employer costs for employee benm were up the same for the</p>
        <p>Pianters National Bank has at nounrodthatT. OlinDavishas joined the bank in Greenville as vice pred-dent and cmnmercial loan administrator.</p>
        <p>Davis previously worked in a similar position lor another North Cuolirabank,PNBsaid.</p>
        <p>A native of Garner, Davis graduated from the University of North Carolina at Chapel Hill in 1977 with a bachelors degree in business administration.</p>
        <p>He is treasurer of the Greenville</p>
        <p>Davis and his wife, the for^DoB sy Mires of Roanoke Rapids, haWI twochildren.</p>
        <p>WAYNE ELKS</p>
        <p>Record fgaros</p>
        <p>Roses Stores Inc. reported record sales of $310,680,000 for the quarter ended Oct. 29, an increase of $33,245,000 or 12 percent over the same period a year ago. Net earnings for the quarter were $6,112,000, down $9^000 or 1.5 percent.</p>
        <p>For the six months ended Oct 29, Roses sakl both sales and earnings set new records. Sales increased 15 J percent to $839,859,000, while net ear-ningi were $16,877,000, an increase of 2.3 percent Roses, headquartered in Henderson, said it operates 237 discount stores in 12 southeastern states. Dur-faig the fir^ nine months, 23 new stores were opened, 15 stores were remodeled, and eight facilities were closed.</p>
        <p>Diet pm Sweeping</p>
        <p>Doctors Invent lazy Wayto ILose Weight</p>
        <p>I New fW MagntCDief PNf I CkiaranlwM ftsf WaigM Loss</p>
        <p>f BEVERUr HILLS. CA (Spccial)-</p>
        <p>An amazing new weight loss ^1 called fat-magnct has recently been ^developed and perfected by two prOT-'inert doctors ata world femous hospital ,in Los Angeles that reportedly ^guaraMees that you will easily lose At by simply takii^ their tested and ibraven new pill.</p>
        <p>^ NoOMtg-^eatHonnalty Best of all, you can continue to eat all of your finite foods and you dont have to change your normal eating habits. You will start losing fot from Wie very first day, until you achieve the ikleal weight and figure you desire." ^ There has never been anything like W before. It is a totally new major WUcal breakthrough for weight loss {worldwide patent pending).</p>
        <p>! Hushes M Out Of BoOf . The new pill is appropriately called m fet-magnet" pill because it breaks infeo thousands of particles, each act-ir^likeatiny inagnet.Attracting" and prappiiw many times its size in fot parti-eles. TlKn, all that trapped fot is wmuilly flushed" right out of your body because it cannot be digested.</p>
        <p>; Widiin 2 days you will notice a i?higc in the color of your stool as $he fot particles are being eliminated.</p>
        <p>TmOoASthsmrk-j According to the docttHS, the fol-nagnet pills do all the work while you luickly lose fot with no starvation diet nus to follow, no cahMrie counting, exercising, and no hunger panga, is 100% safe. You simply take die wiihaglassof wMer before meals. The fot-magnet pills have just been '  tothe American public and are</p>
        <p> sweeping the country with sales and reports of dranuttic weight loss, its the lazy w^" to lose Wight for people who enjoy eating.</p>
        <p>Now JWaisbIs to PubSe Ifyouneed|olo6e2Q,50;lOOpounds Jr mote, you can order your stqmly % these new highly successftil nt-msgnet pills (now available from the doctors exclusive manufoctuier by mail or phone order only) by sending $20 for a 90 pUI supply (+$2 han^ ling), or $39 for a lmi|^ supply (+$3 hndling), cash, checker money order to: M-Magnet. 90fo WUshire Blvd., Dept. W634.BeveriyHUlt.CA90211. (Vecsetkmskmn-bsekmtamh m if eotm%  Visa.</p>
        <p>MaatoiCafd and American Express OK. (Send card number, expire date, and signarme.) Ifor fostest service for cieditcaid orders ONLY call anytime ^ hours, toU free 1(800)527^ .W634.</p>
        <pb facs="00096780_0045" />
        <p>ed In Chin</p>
        <p>Two Greenville ministers have recently returned from an evangelical trip to China, Korea and Hong Kong.</p>
        <p>Ruth Peterson and Barbara Delano were part of an evangelical team which toured Canton, Guilin, Beijing, Nanjing, ^Shanghai, Hangzhou, niina, plus Seoul, South Korea, and</p>
        <p>__ purpose of our trip was to share the GosmI, Ruth Peterson said. We took Bibles and gave them away, visited several seminaries.</p>
        <p>B^ wimien said that the practice of reli^on has become more free in China m the past two to five years. Seminaries are flourishing, as are churches, in c(mtrast to the China of a few years past, they said. There are now about 4,000 churches and about 10,000 home churches, Ms. Peterson said she was told.</p>
        <p>We had the experience, Mrs. Delano said, of being practically overcome by the crowds when we were passing out Bible tracts. They were so eager to read what we had to share. There was no restriction at all on our ministering in the streets, as long as we didnt out-and-out hold a meeting.</p>
        <p>Ms. Peterson is pastor of The An-nointed Ones Church in Ayden. Mrs. Delano is pastor of Gateway Christian Center in Winterville.</p>
        <p>Ms. Peterson went to the USSR in 1985 and to Israel until 1984. Mrs. Delano has been to Israel, Jordan and Russia twice, as wellas the Dominican Republic and Jamaica on evai^elisticnussions.</p>
        <p>The people of China were a lot friendlier, a lot happier and freer-seeming than the people of Russia,</p>
        <p>Ms. Peterson said. The people in Russia didnt smile a lot. I saw a lot of smiling people in China.</p>
        <p>In Russia, she said, the group widi which the two were traveling were allowed to bring in only one Bible and they had to make sure that that one went out with us. In China, we were free to give out Bibles and let the people keep them, she said.</p>
        <p>In China, the meup saw people of all ages worshiping. In Russia, they said, only a very dedicated few people 00 or older were seen in the one OrtlKxlox church they visited.</p>
        <p>In Hangzhou, China, they visited a church with a woman minister which had over 1,000 people attending. We couldnt understand the words during the service, Ms. Peterson said, But we knew that the same Spirit prevailed there that wed experienced many times. It was very calm, very relaxed, very open. We had a wonderful time worshiping.</p>
        <p>Ms. Peterson said she attracted a lot of attention in China because she is black. Most of the people there have seen very few, it any, black people in their whole lives, shesaid. They were fascinated with me. Im also much larger than most of the people there, so my size made people notice me, too. Thieyd come up and ask permission to touch my skin or my hair. I enjoyed sharing with them that way.</p>
        <p>Prior to coming to Greenville, Ms. Peterson was a traveling minister touring througlKHit the United States and Canada. A Florida native, she has been a minister since shortly after she was converted in early 1972.</p>
        <p>A Pitt County native, Mrs. Delano</p>
        <p>has been a Christian for 11 years and the pastor of a church for about six years. Before becoming a minister, she conducted twice-a-week prayer services in her home and attended another church. She is the wife of a local businessman. Art Delano, and is the mother of four daughters. The support of her husband, her children, and her in-laws allow her to take mission trips when she feels led. Lately this has been about twice yearly, she said.</p>
        <p>Both ministers say their congregations are supportive of their mission work to omm* countries. Both ixv they are joined by their church members in conducting evangelistic work in this mrea.</p>
        <p>Ms. Peterson said she definitely woulid like to visit China again and is also eager to go back to Israel. Shes not sure, however, that she wants to return to Russia, though she has an unerring concern for the people there.</p>
        <p>Mrs. Delano says shell go wherever she is led. She had not planned to make the trip to China, but received on Sunday a cupelling direction to go, just the day before the groiq;) was to leave (m Mimday. Her plans were quickly made and she joined the evangelisnc team with which Ms. Peterson was traveling. Tlie only difference in her trip and that of the other team members was that they came back the way they went - out of New York and into New York. She circled the globe, arriving back in the United States through San Francisco. That was all right, too, she said, Tlie Lord is with me wherever I go, so I wasnt really traveling alone.</p>
        <p>Text By Carol Tyer</p>
        <p>VISITED WALL  Tlie evangelistic grawp wtth which Mrs. Delano and Miss Peterson traveled in China visited the Great Wall of China as weU as many churches, seminaries and other sites in six cities. Miss Peterson is sixth from left; Mrs. Delano, seventh from left.</p>
        <p>TEA IN CHINAMiss Peterson poses in a terraced field where tea is grown.</p>
        <p>A CONVERT  Miss Peterson poses with Mr. Chon, the groups international guide. He was converted to Christianity while the tour was under way.Acadians Feel French, Speak Archaic French Dialect</p>
        <p>By JEFF BRADLEY AMociated Press Writer</p>
        <p>GRAND PRE, Nova Scotia (API ~ One of the sorriest houn in British colooial history, as Longfellow recounted in Eveline, took place in the church of Grand Pro at S oclock on the afternoon of Friday, 5,1755.</p>
        <p>For 40 years, the British had been attempting to exact oaths of alkidance the French-sp^ Aca^ans of the Nova Scotia pei^ sula, who had chosen to remain neutral in hostilities between England and France.</p>
        <p>At the fateful gathering, the (Ustnistftd British announced I the inunediate deportation of all Aca* dians to the American colonies, con-fiscated their property and burned their houses.</p>
        <p>Within eight years, some 14,000 Acadians had been rdistribiited from Boston to Geor|^, separating loved ones like Longf^s fictional Evangeline, fairest of all the iui;'aDilherGal)rid,thebM-siniths son who was noblest of aU theyouths.  r</p>
        <p>Today, all that remains nf that thriving setUement on the salt nuu^ shes ofthe Minas Basin is Grand Pre NaUonal Park and the hish pasture still protected by dikes the Acadians toiledtocoostruct</p>
        <p>A stat^ of Evangelins and a roe-</p>
        <p>  -</p>
        <p>mortal church have become a national shrine for Acadians, whose colorful holiday pageants always include &amp;gt; honorary Bvangelines and Gabriels.</p>
        <p>UnUke Longfellows sorrowful poem, which fids with the heroine My locating Gabriel on his death bed hi PWadM. the real Acadian story hasa haiw ending.</p>
        <p>Many of therefiigees settled in Louisiana where thrir descendants are known as Cajuns, but the majori-to found their way back to Nova &amp;amp;tia after the British and French made peace in 170.</p>
        <p>lands around Grand Pre were given to 8,000 English settlers from New England, so they ventured to other parts of maritime Canada where t^ descendants number 300,000 including one-third of New Brunswick, the only officially bilingual province in the nation.</p>
        <p>Acadians feel closer to France than to their French-speaking coun-trynien in Quebec Province, and proudly work to preserve their quaint omure with its (Hd French language, white Nbrmandy bonnets and hooked and ui^ cuisim, </p>
        <p>DOtaibi  -</p>
        <p>Ncafiyi</p>
        <p>My ancestor said he would rather swallow a dogfish tail than swear allegianoe to &amp;amp; (English) quepn, safcTMaiteGerinjjne (TEiitreinoot,</p>
        <p>run, ana unique cinsme, belgnets a la rapure, tl potato and poultry pancak* locally as nqipie pie.</p>
        <p>director of the Acadian Federation of Nova Scotia (Federation Acadienne delaNouvelle-Ecosse).</p>
        <p>She referred to Baron Sieur Philippe dEntremont, who in 1663 founded the fishing village of West Pubnico on the southwest coast of Nova Scotia, the oldest town in Canada still inhabited by descen-dantoofitsfirstsettlers.</p>
        <p>I never even dated an English person, Ms. dEntremont added with a firmness not usually seen hy the American tourists warmly received here each summer.</p>
        <p>With its colonial-style homes and high-stemiled Roman Catholic Church, We&amp;amp;i Pubnico resembles a New England village. But its 1,900 residents are a self-contained bastion of Acadian tradition.</p>
        <p>Most speak English because of schooling, but among themselves th^ use a dialect that was in vogue bcdm the French Revolution in 1789.</p>
        <p>This archaic tongue translates 70 years as sept ans, Instead of the modern soixante-dix.</p>
        <p>The e in coeur (heart) is pronounced like ch, and clothed becomes li0M a hardes instead of the conteinporary corde a Unge. The oidFrencn word haroia means bundled up old clothes.</p>
        <p>When my daughter went away to^ Ottawa to university, her toaw said her French was so bad it was lihnA violinist trying te play on one</p>
        <p>string, said Celeste LeBlanc, who was born in West Pubnico, feU in love with a local boy and has been with him ever since.</p>
        <p>Our trouble was that we were afraid of the English  but not any more, shesaid.</p>
        <p>Our radio, TV, newspapers ~ everything is Ewhsh, complained her husband, ^Jules LeBlanc, a retired fishery inspector whose family came from France 10 generations</p>
        <p>LeBlancs rankle if local gas station attendants switch to EngKah when an Enghsh-speaker pulls up. The few native English-speokers in town are barred from a societe formed to insist on state-funded, French-language instruction in grammar schools.</p>
        <p>The battle for more French schoob, teKtboob and participation on school boards is being waged across the landmark</p>
        <p>educational rightsofi</p>
        <p>Nova Scotia still has only one provincial court judge who spe^ French, while m New Brunswick, twotoirds of the mostly English vWags of SaUshury recenUy staged protests whn the post office named a nenchepeaking postmistress.</p>
        <p>Despite these tensions. West Pub-</p>
        <p>fishing boats, harvesting lobsters and scallops for the U.S. market and herring roe for Japan, LeBlanc sakL MillioiHiollar trawlers are docked in the harbor and five processing plants add more vahie to each catch, while to the north lucrative mink farms raise 10,000 to 15,000 animals ata time.</p>
        <p>In addition to the nine-hole West Puhnico Golf Course, the town has a baseball diamond, health club, pisae-ria and credit union.</p>
        <p>We play a lot of bridge during the winter and hold two dances a month, said Mrs. L^lanc.</p>
        <p>Its when the inevitable shortage of opportunity sends young peopfe to the cities that Acadian culture is threatened.</p>
        <p>Doann  oemg wageo e province, following a 1981 law recognizing the drightsofAcalamL</p>
        <p>Mneration is using more  English, said AnleCyr kcadian Federation, whose</p>
        <p>nico is thriving Hqto school dropouts can earn 50,000 Canadian dollars</p>
        <p>if -V'</p>
        <p>(838,000) in their first year.on the</p>
        <p>Each and more of the Aoidian ancestors were deported in 786 but returned.</p>
        <p>Latest studies indicate that 17 percent of Acadian diikben ve being UMiimitetiid into an Emiifailijiioakino environment throi^ hiSrm^ riage.</p>
        <p>Cyr drew the contrast with Quebec, which is 82-percent Frenra and where many youngsters grow up without any Engliah. In Nova Scotia, the 4.7-percent Acadbn population is |irroiinded by the rival language.</p>
        <pb facs="00096780_0046" />
        <p>--.  ,.f.</p>
        <p>;.r.V^--l^' /. - '.</p>
        <p>02 The Dally Rtifltctor. Greenville. N.C.  Suwday. Novembr 22.1987</p>
        <p>y   1 wveHeMaMv eeee^. ve*</p>
        <p>David Crisp, both of Greenville, were united in marriage Saturday in a 5 p.m. ceremony in St. James United Methodist Church.</p>
        <p>The Rev. Ed Miles, uncle of the bride, officiated during the doublering ceremimy. Music was provided by Lynn Chappelear, pianist, Judy J(Hies and Mott Bachelor, soloists, and Phil Hansley, trumpeter.</p>
        <p>Parents of the bridal couple are Mr. and Mrs. Richard H. Jennings of Greenville and Mr. and Mrs. Charles W. Crisp of Rockingham.</p>
        <p>Givoi in marriage by her parents, the Ivide wore a formal-length gown of white bridal satin over peau de sole designed with a modified portrait neckline defined with scalloped scAiRli lace in a formal motif. The Elizabetiian sleeves featured poufe fashioned with cutwwk inlaid with the schiffli lace. The fitted ifflderskeeves were accented with fl(H^ motifs 0 lace and extended to form calla pomts on the hand. The fitted bodice was embellished with the schiffli lace and accented with seed pearls and extended over the torso to the modified basque waistline. The full circular skirt and attached ca-thedral-length train were trimmed with the schiffli lace and had cutwork that was embellished with pearls and embroidered work. Her veil was a cathe^l-length beaded headband which laid on the forehead. It was accented with silk carnations and pearl sfsrays. The bride carried a fmrmal</p>
        <p>alstromeria lihes, freesia, miniature</p>
        <p>Terri Jennings of Greenville, S.C., served as her sisters maid of honor.</p>
        <p>Bridesmaids were Jennifer Hardee of Farmville, Beth Hines of Fountain, Deim Lewis of Farmville, Tama May of Farmville, Rene Adams of Greenville, and Tracy Brady of Farmville. Christy Crisp of Hamlet, niece of the bridegroom, served as flower girl.</p>
        <p>The maid of honor and bridesmaids wore tea-length gowns of daphne rose satin design^ with sabrina necklines and fitted bodices.</p>
        <p>The maid of honors gown had three-quarter-length poiu sleeves which came down to form three points which were accented with pearls. The scooped back bodice was enhanced with a very large satin bow and a ruffle which hung to the bottom of the dress. She carried a flower arrangement similar to that of the bridte.</p>
        <p>The bridesmaids gowns had deeply scooped back bodices enhanced with two self-closure bows. A satin tie sash encircled the modified waistline from which fell the s(^tly pleated skirt. They carried nos^ys of babys breath tied with mauve and ivcnry satin ribbons. The flower ^1 carried a minature fireside baet with ribbons and assorted flowers.</p>
        <p>Charles Crisp served as his sons best man. Ushers were Troy Hardee of Farmville, Jerry Goff of Bell Arthur, Mike Coltrain of Hamlet, brother-in-law of the bridegroom, and Sam Jennings of Greaaville, brother of the bride. Michael Crisp of Hamlet, nefdiew of the bridegroom, was the ring bearer.</p>
        <p>The mother of the bride wim a straight midnight blue silk outfit. The mother of fin gnwm wore a tea-length dress of periwinkle blue. The</p>
        <p>MRS. CRISP</p>
        <p>mothers of the bride and bride^m wore idmitical oxrsages of mimature ivory dendrobium orchids. The grandmothers were honored with rose corsages.</p>
        <p>. The wedding was directed hy Paula Mills of Winterville. Vicify Coltrain of Hamlet, sister of the bridegroom, attended the register.</p>
        <p>Several , showers and a luncheon were given for the couple prior to the wedding ceremony.</p>
        <p>The bride is a travel consultant at ftavel Express of Greenville. The bridegroom works with Heilig Meyers as a sales associate.</p>
        <p>After a wedding trip to Asheville, the cmiide will reside in Greenville.</p>
        <p>Mrs.</p>
        <p>To Unroll Carpet</p>
        <p>By BETTY CUMIBERTI LA. Tlmes-Washington News Newsservice</p>
        <p>WASHINGTON - The White House and the State Department are scrambling to put together just the ri^t si^tseeirg Umit for Soviet first lady Raisa Gorbachev, who may visit the National Gallmy of Art, the Air and Space Museum and the Library of Congress between official functions during next mmiths superpower sununit.</p>
        <p>First lady Nancy Reagan wrote Mrs. Gorbachev a letter Wednesday inviting her to a private tea and tour d the ^te House, which would include a rare ^pse of the living, quarters as w^ as the public nxHns with their art and presidential memorabilia.</p>
        <p>Mrs. Reagans letter was in response to Mrs. Gorbachevs special request for a White House tour that had been relayed through U.S. Ambassador Jack Matlock, a spokesman for Mrs. Reagan said.</p>
        <p>Althou^ current p^ indicate that we wUl particip jointly in various official functions over the course (rf the visit, I am hqinng we can schedule some private time togeto as well, Mrs. Reagans let-tersaid.</p>
        <p>Because of your interest in art and histmic restiration and your special request to tour the White House, I would like to extend my personal invitatimi to have you jom me for a private tour and tea (m Wednesday afternoon, the ninth of December.</p>
        <p>The two women met in Geneva in 1985 when their husbands held their first summit. They talked to each other for several hours at two teas and have exchanged a few letters since then. Mrs. Gorbachev sent Mrs. Reagan flowers after the U.S. first lady underwent a mastectomy fmr breast cancer Oct. 17.</p>
        <p>Sources close to Mrs. Rea^ have indicated that she is keenly interested in seeing the two superpowers reach an arms control agreement, an accomplishment that she feels would end the Rea^ presidency on a (rand note and help dull the damag-effects d the Iran-Contra scan-</p>
        <p>The prospects that President Reagan and i^viet leader Mikhail S. Gorbachev will sign an agreement to ban intermediate-range nuclear missiles have brightened Mrs. Reagans spirits since her surgery and the death of her mother a few weeks later.</p>
        <p>Its very, very special to her, tlm other side of the visit, the men getting together and coming to an agreement of some sort, said Elaine C^pen, the first ladys press secretary.</p>
        <p>nie Gmrbachevs are scheduled to arrive late in the day Dec. 7 and will be (^dally received at the White House the next day. Tentative plans call for a state dimier in their honmr at the White House that evening, and' a dinner in the Reagans honor the following ni^t at the Soviet Embassy. The Gorbachevs will also attend a State Department luncheon at which the Reagans will not be present</p>
        <p>An advance team of 14 Soviets has scoured Washington for the last few days in search of spots Mrs. Gw-bachev might like to visit during ho*</p>
        <p>few free hours. The team visited several of the capitals prime attractions, including the Lincoln and Jefferson memorials, the Washington Monument, Mount Vernon and the Childrens Hospital National Medical Center.</p>
        <p>A source said the teams favinrite stops were the National Gallery of Art, the Air and Space Museum and the Library of Congress, which would satisfy Mrs. Gorbachevs interests as a teacher and art enthusiast.</p>
        <p>State Departmmit {danners also discussed having Mrs. Gorbachev visit Hillwood Mansion, which contains a large assortment of prerevolutionary Soviet art ana a Faberge collection.</p>
        <p>Another prcnosal was for her to visit an uppo'-middleKdass black school, but the Soviet team did not tour a school ovm* the wediend, nor did they see the Vietnam Memorial.</p>
        <p>In preparation for the visit, Mrs. Re^n has discussed the Soviet Union with her son, Ron, who recently spent time in Moscow working on an ABC television project.</p>
        <p>\</p>
        <p>Silver Trove Found</p>
        <p>By CONNOISSEUR AHearstMagaxiM</p>
        <p>One of Americas great silver manufacturers has uncovered a treasure trove of nearly-forgotten Victorian silver, including a halfmillion dollar semce that is one of the most important in the country.</p>
        <p>The company, according to an article in toe current issue of Connoisseur, hopes to organize a traveling exhibition of the complete set, one Of the supreme achievements of American decorative art.</p>
        <p>The treasure was uncovered last year when Gorham Manufacturing Co. moved its plant, which had been a landmark in Providence, R.I., since 1880.</p>
        <p>.During the move to modem more than 50 trunks of ~ much of it iong hidden from the public eye in Gorhams vaults  was Drought to light.</p>
        <p>the treasures are pieces owned te the companys founder, Jabez Gisrham; numerous hand-wrou^t examples (rf its art nouveau Martele ware, and a collection of reproductions of High Victorian works  and such low ones as Mrs. Lincolns chkken-leg coffee service.</p>
        <p>The reproductions were made in the slack 1930s aiid 1940s when the firm apparently put its artisans to work rather than lay them off.</p>
        <p>Jeanne Sloane, the American silver apprais-</p>
        <p>it during Gorhams move last year.</p>
        <p>Only Tiffanys famous Mackey service is on the same level.</p>
        <p>Mil</p>
        <p>TIJC TPOplcal zone</p>
        <p>for The Ultimate Ian M</p>
        <p>2408 So. Charles Blvd. ~ Suite 3</p>
        <p>Ph. 355-5120</p>
        <p>Col tor HB AppoMnwnt</p>
        <p>m Greenville's hottest new concept In tanning </p>
        <p>Feoturtno Stol* of the Alt Stoir Solarium Tannkig Syitomt wHh butt-in MglMpaed Facial Toman</p>
        <p>Best Deals in Town</p>
        <p>fHMII </p>
        <p>Quilt Show Has Old And New</p>
        <p>NEW YORK (AP) - An^exhibition titled Homage to the Quilt offers an opportunify to see winning quilts from a contemporary competition side by side with some treasured antique examples of the same craft.</p>
        <p>The exhibition, at the American Craft Museum here through Jan. 10, 1968, has been organized by that museum in collaboration with the Museum of American Folk Art.</p>
        <p>It features 35 selections from the Quilt National 87 competition run by the Dairy Bam Southeastern Ohio Cultural Arts Center, Athens, Ohio, and 15 traditional wcurks that are some of the finest quilts from the Museum of Folk Arts permanent collection.</p>
        <p>After the exhibition closes in New Yoik, the Quilt National 87 component will be shown at selected sites m Ja^, including Tokyo, from February through June 1988.</p>
        <p>The term crecy means either made of or garnished with carrots.</p>
        <p>Open House Today 1-5 p.m.</p>
        <p>at</p>
        <p>Any thing Ptoper</p>
        <p>Bells Fork Square</p>
        <p>Christmas Decorations, Wrap, Bags, Ribbons, Party Suppiies</p>
        <p>10%</p>
        <p>All I V /U Off</p>
        <p>Today Only</p>
        <p>You'll truly shine in one of our lovely soivns, selected especially for the hoiday season. Exquisite styBng, beautiful detaiBng and lustrous fabrics make these gowns stand out In any crowd. Come in and select one today! New styks arriving daily, all at reasonable prices. Use our convenient layaway plan!</p>
        <p>A Complete Wedding Service.</p>
        <p>Bridal and Bridesmaids Gowns Tuxedo Rentals Prom and Special Occasion Gowns</p>
        <p>Invitations and Accessories Florist and Decorating Service</p>
        <p>Catering Service and Wedding Cakes</p>
        <p>Minister_</p>
        <p> and Video Service</p>
        <p>Limo</p>
        <p>WeddingXndc and Musicians</p>
        <p>Located One Mile Sonth Of The Plaxa At Bells Fork ^uare Greenvdle. N.C. 27858</p>
        <p>Open Mon.-Frl.</p>
        <p>1:00 a.i</p>
        <p>10:00 a.n.-7:00 p.n Sat. 10:00 a.m. til 5:00 p. 355-7186  &amp;gt;</p>
        <p>COLLECTI</p>
        <p>Sweater Collectibles troM Saswl Jmm and arady't II</p>
        <p>Sweaters to top you with brilliant color and vibrant styling...to take you on a ioumey from crisp autumn mornings to doxxling evenings with o feeling of confidence. Irreslstoble looks at outstanding savings...</p>
        <p>25 r</p>
        <p>O Off</p>
        <p>fxnusivf fA ,MIONS (01^ inr run IP fi. ,i)pi</p>
        <p>:, .V, 1- .</p>
        <pb facs="00096780_0047" />
        <p>'j^iiady' First Sang</p>
        <p>r any help</p>
        <p>us^io</p>
        <p>: T ABBY: Where did the line,</p>
        <p>^ not over until the fat lady sinffi orig&amp;lt;-</p>
        <p>- inate? Who said it, and under what I circumstances? And wasnt the fat : lady referred to in the expression the ^late Kate Smith? Thanks for an;</p>
        <p>- you can give me. WOULD -KNOW</p>
        <p>: DEAR WOULD LIKE: The quote ! was attributed to Dick Motta, who at : the time was coaching the : Washington Bullets basketball team,</p>
        <p>- and now coaches the Dallas Maver-</p>
        <p>- icks. He was rep&amp;lt;Nrted to have said it I during the 1977-7g basketball r playoffs, and he meant: We may be</p>
        <p>behind, but we havent lost the siries : until all the games have been  played.</p>
        <p>- On further investigatton, I learned :: that Mr. Motta did not originate the : saying. Dan Cook, a San Antonio : sportcaster, did. Cook said it goes</p>
        <p>Meeting Place</p>
        <p>MONDAY</p>
        <p>9:30 a.tn.  Overeaters Anonymous meets at South Greenville Recreation " Center</p>
        <p>  12  Noon    Alcoholics Anonymous meets</p>
        <p>- at St. Pauls Episcopal Churcn</p>
        <p>12 Noon  Greenville noon Rotary Chib meets at Rotary Building 12:30 p.m.  Kiwanis of Greenville-Z University Club meets at Holiday Inn 5:30 p.m. Greenville TOPS Club meets &amp;gt; at Planters Bank</p>
        <p> r 6:15 p.m.  Greenville Chapter Profes-</p>
        <p>sional ^retarles International meet at .* Western Sizzlin</p>
        <p>6:30 p.m.Rotary Club meets 6:30 p.m.  Host Lion Gub meets at Holiday Inn ^  6:30  p.m.  Optimist Gub meets at</p>
        <p>- Three Steers</p>
        <p>6:30 p.m.  Pilot Gub meets at River-&amp;gt; side Steak Bar</p>
        <p>7:00 p.m.  Eastern Pines Volunteer ; Fire Dept, meets at fire department</p>
        <p>7:00 p.m.  Sweet Adelines, Eastern I Carolina Chapter, meets at The Memorial ' Baptist Church.</p>
        <p>;  7:30  p.m.  Gamblers Anonymous</p>
        <p>I meets at St. Peters Catholic Church.</p>
        <p>;*  7:30 p.m.  Greenville Barber Shop</p>
        <p>Chorus meets at Jaycee Park Ao-, ministrative Building ; -  8:00  p.m.  The Adult Children of Alco-</p>
        <p> ' holies Support Group meets at Saint ; - J ames Methodist Church, Sixth Street.</p>
        <p>.*  8:00  p.m. Overeaters AiM^mous step</p>
        <p>meeting at First Presbyterian Church, Harvey-Webb room, Elm Street :  8:00  p.m.  Lodge No. 885 Loyal Order</p>
        <p>of the Moose 8:00 p.m.  Alcoholics Anonymous closed discussion, AA Building, FarmvUle Highway</p>
        <p>,  8:00  p.m.  Narcotics Anonymous open</p>
        <p>discussion meeting, St. Pauls Episcopal Church, 401E. Fourth St.</p>
        <p>TUESDAY 7:00 a.m.  Gremville Breakfast Lion Club meets at Three Steers 10:00 a.m.  Kiwanis Golden K Club meets at Masonic Hall 6:30 p.m.  Greenville Kiwanis Gub meets at Golden Corral 8:00 p.m.  Withla Council^Degree of Pocahontas, meets at Rotary r </p>
        <p>8:00 p.m.  Pitt Co. Alcoholi mous meets at AA Building, Farmv Highway</p>
        <p>8:00 p.m.  Pitt County Al-Anon family grow meets at St. James United Methodist Church. Call 758-1491 or 825-1982 8:00 p.m.  Narcotics Anonymous open discussion meeting at St. Paul Elpisci^ Church</p>
        <p>WEDNESDAY 9:30 a.m.  Duplicate bridge meets at Senior Center '</p>
        <p>9:30 a.m.  Joy of Living, an interdenominational womens Bible study, meets in Greenville Bible Church.</p>
        <p>10:00 a.m.Pitt Golden K Kiwanis Club ; meets at Greenville Country Gub</p>
        <p>12 Noon  Overeaters Ammymous meets at Walter B. Jones RehabUitation Center</p>
        <p>"  1:30  p.m.  Duplicate bridge meets at</p>
        <p>Senior umter</p>
        <p>6:30 p.m.  REAL Crisis Intervention Center meets 7:00 p.m.  Greenville/Pitt County  Youth UNincil meets at the Greenville Recreation and Parks Department, Cedar</p>
        <p>- Lane.</p>
        <p>7:00 p.m.  Greenville Toastmasters meet at Western Sizzlin. Dinner at 6 p.m.</p>
        <p>7:30 p.m.  Winterville Jaycees meet at Jaycee Hut 8:00 p.m.  John Ivey Smith Council No. 6600, Knights of Columbus, meets at St. Peters Catholic Church 8:00 p.m.  Narcotics Anony discussion meeting at St. Pai'</p>
        <p>Church</p>
        <p>8:00 p.m.  New Beginning Womens Alcoholic Anonymous meets at Saint Pauls Episcopal Church.</p>
        <p>Our books 2ure filling fast for makeover appointments. To help with your wish list for the holiday season, the staff at Merle Norman is happy, to assist you with that special .party look, a professional daytime look, or more casual makeup needs. Make it easy on your Santa - come to Merle Norman to complete your makeup and skin care wish list.</p>
        <p>TiERLE noRmm</p>
        <p>Carolina East Mall 756-8404</p>
        <p>!. Dcdf^Abby</p>
        <p>AUgkil Van Burn</p>
        <p> '-'i .</p>
        <p>this way: The opora aint over til the fat lady sings. And the fat lady was not Kate Smith. Cook said his line was a takeoff on Yogi Berras line, The game isnt over til its ova*. Furtiier, Mr. Cook said this stray is recra'ded in the Library of Congress, and he (Cook) is bored to death with this topic already.</p>
        <p>DEAR ABBY: Inquisitive asked: Why do some people go to funerals of people they harmy know? I am referring to people thqy dont</p>
        <p>even have a speaking acquaintance</p>
        <p>With.</p>
        <p>Your reply: They could be lonely, hungry, nosy or curious. Qr all of the above. </p>
        <p>Come now, Abby, could it be that they go out of gratitude and respe^ to hraKur the bus driver, fw his courtesy, the woman whose cheerful smile made their days brighter, the person who accepted them as they were, regardless of their level of education, their clothing, looks, race, color or creed?</p>
        <p>Inquisitive should inquire. She may be delighted with the answers she receives. At my mothers funeral, when I asked folks who appeared to the family to be strangers</p>
        <p>if they had known my mother, I heard some of the moat surprising tales of her life. Of course, there are Harold and Maude behave-alikes who do attend funerals for the reasons you gave.</p>
        <p>Or could it be a mitzvah to be at with those ^ who mourn? the only, and certainly our most, precious, gHt is our ffesence.CATHERINE B.</p>
        <p>DEAR CATHERINE: Thank you. Your answer was better  aiM far more compassionatethan mine.</p>
        <p>DEAR ABBY: I am a grandmother who has just read your booklet, What Ev^ Terai-Ager Ought to Know. I think its wonderful, and I</p>
        <p>want all my grandchildren to have a copy. However, one glaring ranission disbirbs me. You make no mentkm of AH)S. 1 realize that our knowledge of this terrible disease is rhanging every day, but surely something should be done to infram and warn our^</p>
        <p>innocent people can and will be exposed to AIL6 without r^ard to age or sex, it seems to me that teenagers are particularly vulnerable. Irresponsible sex today can be a death sentence.</p>
        <p>I hope you revise your teen booklet</p>
        <p>soon to include what they should know about AIDS. - CLAUDIA K. CARSWELL, THOMASON, GA. DEAR CLAUDIA: I have afaready</p>
        <p>revised my teen booidet to inclnde the most current informatirai on sexually transmitted diseases, pins a section about AIDS. The portion on drugs has also been updated and expand.</p>
        <p>To obtain the new What Every TeM Should Know, send your name and address, clearly printed, pins a check or money order fra- $3.51 (postage is included) to: Abby, Teen Booklet, P.O. Box 447, Mount Morris, I1I.S1054.</p>
        <p>(Problems? Write to Abby. For a personal, unpublished reply, sd a self-addressed, stamped envelope to Abby, P.O. Box 69440, Los Angeles, Calif. 90069. All corresponde!^ Is eonfidential.)</p>
        <p>u^LlSan</p>
        <p>NOW THROUGH</p>
        <p>Carolina East Mall&amp;amp;*Thf Plaza.</p>
        <p>Shop lOarn until every (lay except 1 pm until Sunday,</p>
        <p>Crowds will gather before the d(xms open. Professionals will Ukedaysoff. Moms:arrange for bahysitfcrs in advance. Men;[X)sttX)ne golf</p>
        <p>Buy your entift fall wardrobe in hours.</p>
        <pb facs="00096780_0048" />
        <p>The DaUy Reflector. Grnvllle, N.C.</p>
        <p>SuiwWy. Nowmber 22.1967</p>
        <p>Couple Marries</p>
        <p>MRS. WALL</p>
        <p>Sharon Lynn Robinson and Tony Howard Wall, both of Aydoi, were married Satinrlay in a 2 p.m. ceremony in Rose HiU Free Will Baptist Cburch.</p>
        <p>The Rev. Leon Harris performed the double-ring ceremony. Music was provided by organist Cora Bob Tur-nage and soloist Hagar Blanchard.</p>
        <p>The wedding was directed by Shirley Dennis of Ayden. Annette Mannh^ oi Greenville jn^ided at the guest register.</p>
        <p>Parents of the bridal couple are Mr. and Mrs. M.C. RobinsM Jr. and Mr. and Mrs. Tcnnmy H. Wall, all of Ayden.</p>
        <p>Given in marriage by her parents and escorted by her fauer, the bride wore a flow-length gown with a cathedral train of bridal satin with beaded re^mbroidei^ alencon lace. The fitted re-embrmdoed alencon lace bodice and sleeves were beaded with seed pearls and sequins. The bodice featured a scoq[) neckline, long tapered sleeves and torso waistline. Alencon lace cutouts adorned the front of the skirt and train. Garlands of scalloped alencon lace IxHdered the hem &amp;lt;x the gown. She wore a layered waltz-lengtb</p>
        <p>scalloped veil of illusion edged with garlands of seed pearls and accented with scattered alencon lace motiCs flowing from  bandeau of alencon lace petals etched with seed pearls and sequins. The bride carried a white cascade bouquet;with sonya sweetheart roses, tearoses, freesia and babys t^th with p^l beads.</p>
        <p>Toni Robinson of Ayden served as maid of honor for her sister. Bridesmaids were Sherry Wall, sister of the bridegroom, of Ayden; Bfae Greene, aunt of the bridegroom, of Ayden, Jackie Garris of Ayden, Cindy Corey of Greenville and Caddy Aveiy of Parmville. Kristina Harrison of Lynchburg, Va., was fhwrer girl.</p>
        <p>t </p>
        <p>All the attendants wore fifle cerise tea-le^gth dresses. The fitted bodice featured a yoke ndckline, puff sleeves and natural waistline accented with a cummertiod and back bow. The maid of honor carried a bouquet of carnations, babys breath and greenery with' streamers. Bridesmaids carried bouquets shni-lar to that of the honor attoKibnt. The flower girl wore a white taffeta tea dress accented with h fiUe cerise sash. She carried a white wicker</p>
        <p>' I</p>
        <p>basket of miniature carnations and ba^s breath with streamers.</p>
        <p>The father of the bridegroom was best man. Ushers were Phillip Wall, cousin of the bridegroom, and Wayne Hardee, both of Ayden, Brian Haddock of Grimesland, Johnny Pate of Vancehoro, and Eric Jones of Emul, cousin the bridegroom. Rusty Page of Greenville, cousin of the bride, was ring bearer.</p>
        <p>The mother of the bride wore a perwinkle tea-length georgette dress with a V neckline. The bridegrooms mother wore a rosensolored tea-length dress accented with lace. Both mottiersworecorsagesoforchids.</p>
        <p>The parents of the bride entertained at a reception in the church</p>
        <p>HOLIDAY SPECIAL SIGN UP - SLIM DOWN Lose Up To 60 Pounds!</p>
        <p>Enjoy Our HOLIDAY SPECIAL And Enter The NEW YEAR With ONE LESS RESOLUTION</p>
        <p>Patny Spain, howenwliat and ttandnMthar. haa loat SS lachea and loot fimn a alaa 20 to alaa 10  In lOwcehal</p>
        <p>The bnde is employed by the East Carolina University School (rf Medicine and tte bride^Dom is employed 1^ T.H. Wall Construction of Ayden.</p>
        <p>The parents of the bridegroom entertained at a rehearsal dinner Friday ni^ in the church fellowship</p>
        <p>night</p>
        <p>The coiqrie was hcmored with several miscmlaneous showers. After a wedding trip to the mountains, the couple will live in Ayden.</p>
        <p>II</p>
        <p>i</p>
        <p> Sheila Lynn Everette of Greenville bnd Michael Lee Reynolds of Tar-twro were united in marriage Saturday in a 5 p.m. candlelight ceremony at the Belvoir Free Will Baptist Church.</p>
        <p>Pastor Jerry Johnson officiated dining the double-ring ceremony. Music was provided by Robbie Windham, organist, Cathy Thomas, [lianist, along with Pam and Dick ifartin, soloists. ^</p>
        <p>Parents of the bridal coimie are Mr. and Mrs. Otis Everette mChtMm-ville and Mr. and Mrs. Raymond Reynolds of TarbiHt).</p>
        <p> Given in marriage by her parents, the bride wore a formal gown of</p>
        <p>MRS. REYNOLDS</p>
        <p>white bridal taffeta designed with a fitted bodice and shirred cap sleeves. The open neckline extendea to a low V back. Silk venise lace motifs beaded with pearls and sequins enhanced the bodice and sleeves. The full skirt featured tio^ of fluted ruffles caught at the sides with taffeta bows centered with a silk rose ami pearl peps. The chapel-lei^ train was bordered with tiers of fluted ruffles and featured a large tafetta bow at the back waistline. ^ w(ue a satin hat accented with lace beaded with peu Is and sequins and carried a bridal Bible on which was a cascade of white daisies, yellow butUms with white silk stephanotis, springerii fern and babys iH^th.'</p>
        <p>Sherri Dunn of Greenville served as maid of honor. Bridesmaids were Bobbie Jo Everette of Greenville, sister of the bride, Vickie Re^lds of Tarboro, sister of the bridegroom, and Kelly Dunn of Fountain. Jessica Warren of Grimesland served as junimr bridesmaid. Kami Tugwell oS Farmville was the flower gfrl.</p>
        <p>The maid of honor and bridesmaids wore gowns in emerald green and white satin designed with a sweetheart bodice and imffed cap sleeves. The fell skirt was of emerald green satin caui^t with tiny white bows fmmiig an a{Mt effect ovm- a full t flounced skirt tl white satin. 9ie wore a headpiece (d white flowers beaded with [^rls and carried a fan (A white daisies with yellow freesia cascading and babys breath. The junior bndesmaid and flower girl wore dresses similar in design to those of the maid of honor and bridesmaids in white satin with emerald green ribbon.</p>
        <p>Raymmd Reynolds served as his sons best man. Ushers were Edward Everette (rf Gremiville, fetither (rfthe bride. Art Reynold ai Tarboro, brother of the brid^room, and Jacky Everette of Greenville, uncle of the bride. Daniel Everette of Greoiville, brother of the bride, served as junior ushm* and Blake Martin &amp;lt;rf Winter-ville was ring bearer.</p>
        <p>A reception was held in the Belvoir F.W.B. Church FeUowship HaU.</p>
        <p>Yvonne Garris, aunt of the bride,  is a graduate  of Trinity Christian</p>
        <p>nresided at the Dunch fountain. Cake  School.</p>
        <p>The Inride is mnployed by East Carolina Plastic Surgery Associates, P.A. The bridegroom is employed by Gardners Barbecue of Washinj^n.</p>
        <p>After a wedding trip to Raleigh, the couple will reside in Greenville.</p>
        <p>89</p>
        <p>00</p>
        <p>Lose up to 60 lbs.</p>
        <p>(Medical Fee Not Included)</p>
        <p>Come To Our</p>
        <p>OPEN HOUSE</p>
        <p>SUNDAY. NOVEMBER 22 2*5 pm</p>
        <p>FREE CONSULTATIONS CHOLESTEROL ANALYSIS GIFT CERTIFICATES</p>
        <p>J</p>
        <p>BUI Court. WRQR-FM, hu loot SO lucho* and 25lb*.l</p>
        <p>Call For FREE Consultation</p>
        <p>756-2611</p>
        <p>lOArUngtonBlvd.</p>
        <p>(Across From Dawsons)</p>
        <p>packets wmre handed iout by Brad little and Jacqueline Everette, cousin of the bride. Tempie Fuller, aunt of the bridegroom, directed the wedding.</p>
        <p>The bride was hcakured at sevmal miscellaneous showers prior to the wedding. A rehearsal dinner was given by the parents of the brid^room at Western Sizzlin Steak House.</p>
        <p>The bride is a graduate of Trinity Christian SdKxri and attended Pitt Cmnmunity College. The feidegromn</p>
        <p>HOMES REMAIN ROOMY DESPITE FAMILY SIZE</p>
        <p>EBOIAUS, Pa. (AP)-Though the average family is getting sihaller, their new hoines are not shrinkiog to follow that trend, reports Practical Homeowner magaziiie.</p>
        <p>The floorplans of new homes have not been compressed, according to the National Association of Home Builders, although the average family size was 2.67 people in 1986, compared with 2.76 in 1980, the publication iKRes. Instead, extra bedroom space is being converted into baths and family rooms.</p>
        <p>W ELLNESS is the KEY to LIEE</p>
        <p>I</p>
        <p>Tium, Wreatli, Roping ft Stands</p>
        <p>Frasiar ft Canadian Firs, Red Cedars, Virginia ft Whtte Pines</p>
        <p>StaiHonaburg Road</p>
        <p>WaralKMiM ^</p>
        <p>Main St. Famwllla</p>
        <p>Nw* 264</p>
        <p>264A</p>
        <p>WHaon</p>
        <p>CHRISTMAS TREES</p>
        <p>opening November 27,1987 at a New Location Worthington Warehouse #B N. Main St., Farmviiie</p>
        <p>753-5643</p>
        <p>Hours: Mon.-Sat. 10-8 Sunday 1-6</p>
        <p>Snow Hill</p>
        <p>HOUDAVI</p>
        <p>Carotina sssf maU gnamUla</p>
        <p>REGENCY</p>
        <p>ROOM</p>
        <p>Fdll Sdio</p>
        <p>Ladies</p>
        <p>Ladies</p>
        <p>Swealers With Lace Coiiars</p>
        <p>Regular 40.00</p>
        <p>Sftlft</p>
        <p>2999</p>
        <p>55% Ramie/45% cotton In a spaced cable pattern. Colors are navy, cream, cocoa, brick. Sizes S-M-L.</p>
        <p>Fall Sportswear Coordinates</p>
        <p>Select Group</p>
        <p>30%</p>
        <p>OH</p>
        <p>Regular Price</p>
        <p>Brands are Ellen Tracy, Christian Dior, Carole Little, Fenn Wright and Manson</p>
        <p>^Ladies</p>
        <p>Fall Sweaters</p>
        <p>Seleet Group</p>
        <p>OH</p>
        <p>coats puHt dresses furs sportswear accessories</p>
        <p>HmEW 8PRINQ MERCHANDfeE NotScLUDED WE WELCOME YOUR CHARQE ACCOUNT</p>
        <p>Carollns East Mall Opsn 10-9 Mondays Saturday Sunday 1:3(^:30</p>
        <p>Regular Price Were 64.00 to 04.00</p>
        <p>Ladies</p>
        <p>Fall Dresses</p>
        <p>Select Group</p>
        <p>30%</p>
        <p>OH</p>
        <p>Regular Price</p>
        <p>Were $150 to $32^). Includes some long party dreSses.</p>
        <p>Shop CmoUn Soat Mall, Qreanma, Monday Through Saturday 10 a.m. QntllOp.m., Sunday 1:30 p.m. W 5:30 p.m. - Phone 75&amp;amp;B 4. K(7562355)</p>
        <pb facs="00096780_0049" />
        <p>Cox-Skelton Vows Sqid</p>
        <p>L  ill'  ftVi.  fi    '  JA.  ._</p>
        <p>Uniforms Could Replace Dressing</p>
        <p>^GREENVILLE, S.C. - Amy ERubeth Skelton and Phillip Ray Cox, both of Greenville, were married Saturday in a 1 p.m. ceremony at the Greenville Associate Reform-\ ed Presbyterian Church in Green-iville.</p>
        <p> Dr. Earl Crumpler officiated at the r ceremony. Music was provided by  Sybil Thomas, organist, and Jay Seither, soloist.</p>
        <p>Parents of the couple are Mr. and Mrs. Bennett Ray Skelton of Greenville, S.C., and Mr. and Mrs. Grover Glenn Cox of Greenville, N.C.</p>
        <p>Given in marriage by her father, the bride wore a long gown (rf candlelight chiffon and schiffle embroidery.</p>
        <p>A lace-trimmed wedding band neckline enhanced the long bishop sleeves of chiffon banded in matching schiffle. A natural waistline, complemented by a ^ satin sash flowered into a softly gathered skirt. She wore a candleli^t veil of im-</p>
        <p>rid illusion and tiny silk flowers, carried an arm bouquet of sterl</p>
        <p>ing silver roses and Italian ruskes.</p>
        <p> Kimberly Black of Anderson, S.C. served as her sisters matron of honor. Bridesmaids were Cecilia Pitts of Greenville and Kimberly Newlen of Charlottesville, Va.</p>
        <p>The bridesmaids wore tea-length [owns of mauve m(He taffeta vdth Topped waists. Puffed sleeves enhanced the gowns highlighted by a deep-V of English lace.</p>
        <p>James Casim of Greer, S.C. served as best man. Ushers were Bradley Skelton of Anderson, S.C., and Craig Skelton of Washington, D.C., brothers of the bride.</p>
        <p>A reception was held at Seven Oaks in Greenville.</p>
        <p>The bride</p>
        <p>The bride is a prograi mer/analyst at Metropohtan Life! surance Company in Greenville. T</p>
        <p>(ram-iln-</p>
        <p>9mpany in Greenville. The bridegroom is a ^ta processing consultant with Leland, Inc.. of Atlanta.</p>
        <p>After a wedding trip to Sea Island, Ga., the couple will reside in Greenville.</p>
        <p>ByPAULGElTNER Associated Press Writer NEW YORK (AP) - Tlie executive who found that his power suit wasnt enough protection for autumns stock maitet freefall will have new ground rules this sinring.</p>
        <p>More than a decade after the bo&amp;lt;A Dress for Success put real or aspring executives into dark, conservative suits, author John T. MoUoy is changing his mind.</p>
        <p>In The New Dress For Success, due in January from Warner Publishii^, MoUoy argues that the future uniform for successful American executives may be just that: a uniform.</p>
        <p>Now heres the man who wrote</p>
        <p>Dress for Success, who tried to put everyone in suits, tryii^ to talk them out, Malloy, 50, said in a recent interview.</p>
        <p>The reason: Ive done research with blue-collar workers indicating something that almost everybody knows - they hate the (autnralty figures who wear) suits.</p>
        <p>Since the 1975 publication of Dress For Success, which sold more than 2 million copies, MoUoy has built a lucrative consulting business, working on improving the way businessmen and women, mainly salespeople, communicate.</p>
        <p>We started with what clothing they wear and we went to the body language that made them pleasing.</p>
        <p>the verbal part that made than pleasing,he said.</p>
        <p>To factory workers, he says, the non-verbal message expressed by executives in suits is: Im a superior being.</p>
        <p>It bec(nes part (rf the us vs. them attitude that exists in blue-coUar America and which is one of the essential reasons for our downfaU,hesaid.</p>
        <p>Japanese companies, he said, (rften put rank-and-file woriiers and their bosses in uniforms, and the men on that team wUl puU ti^ether. That is exactly the attitude that is needed in ... corporate America.</p>
        <p>But first, he said, the American concept of the uniform must change.</p>
        <p>MRS. COX</p>
        <p>Fruitcake Has Social Life</p>
        <p>You are all familiar with my theory on fruitcakes. Everyone gets choked up about them, exchanges recipes, bakes them and inters them in Uttle tin boxes... but no one eats them. A few years ago, I had a nagging suspicion that there were only four or five fruitcakes making the rounds like a chain letter. If you didnt give away your fruitcake before the year was up, something terrible would happen to you.</p>
        <p>Well, I think Im close to a breakthrough. I read a story last year about a fruitcake baked by Fridelia Ford. When she died, she left behind the last fruitcake she ever made. She baked it in November, 1878, in Berkey, Ohio. According to tradition, she let the fruitcake set for a year and cut it the next Thanksgiving. Fridelia died before she could cut it, so the cake was kicked around in flie family until 1952, when it found a permanent home with her ^at-grandson, Morgan Ford, of Tecumseh, Mich.</p>
        <p>The cake is like a respected member of the family. Every year at this time it is trotted out from its spot in the dining room where it reclines under glass, and the family pays homage to it. Sometimes it goes with the Ford family to reunions where the youngsters have a chance to get to know me family legend.</p>
        <p>Is it still good? Who knows? Fruit-cake is like buttermilk and plain y&amp;lt;^urt ... how do you know when theyve gone bad? When I talked recently with Morgan Ford, he did say that in 1966, Uncle Amos Ford took a nibble off it and he lived for two years more, so it couldnt have been too badr</p>
        <p>It occurs to me if the Ford fruitcake can still have a social life at age 109, there must be other fruitcakes out there outliving their owners. Ive . got one in my freezer that is 8 years old that Im giving away this year, but not before I outfit it with a beeper</p>
        <p>At Wits End</p>
        <p>Erma Bombeck</p>
        <p>collar. I want to monitor where that little sucker is going and where it has been.</p>
        <p>Its my hope that one day we may have a Fruitcake Walk of Fame where old fruitcakes that have turned into the consistemy of patio bricks are laid end to end so that people can see the end of an era.</p>
        <p>Mr. Ford hinted that in the 1800s cooks often buried a gold piece in fruitcakes and the person who bit into it was destined for good luck, but he has no intention of disturbing the cake for exploitation. (Eat your heart out, Geraldo Rivera.)</p>
        <p>According to Mr. Ford, he also has no intention of taking the fruitcake with him when he goes. His son, James, will fall heir to a piece of the rock.</p>
        <p>Imagine ... 109 years ... and it never occurred to anyone to eat it. I rest my case.</p>
        <p>THIS EXQUISITE RING</p>
        <p>\ONE CARAT</p>
        <p>\\  OF  DIAMONDS</p>
        <p>^ At The Ridiculous Low Price</p>
        <p>. ^^799!'</p>
        <p>GRAB IT! ORUSEOURLAYAWAYPLAN</p>
        <p>VALUf AT</p>
        <p>Only 2.6 percent of all American families are persistently poor, remaining on public assistance for eight years or more, according to a University of Michigan study. .</p>
        <p>FLOYD G. ROBINSON JlWELERS. INC.</p>
        <p>OVER 53 YRS. COMBINED EXPERIENCE"</p>
        <p>^ a  Your  liMtopMdMrt Dtomend JMMlar</p>
        <p>758-2452</p>
        <p>incur store.</p>
        <p>Ybull Always Find</p>
        <p>Eastern lectrolysis</p>
        <p>20s COMMERCE ST. GREENVILLE. NC PHONE 756-4034 PERMANENT HAIR REMOVAL</p>
        <p>CERTIFIED THERMOLOGIST</p>
        <p>Fast &amp;amp; Present</p>
        <p>Consignment Shop</p>
        <p>108 E. 2nd St.</p>
        <p>Ayden, N.C.</p>
        <p>Antiques, Glassware, Used Furniture, Household Items And Quality Seasonal Clothing. Accepting Consignments vyed.-Sat. Or By Appointment.</p>
        <p>Hours:</p>
        <p>Wed.-Sat.</p>
        <p>10-5:30 Sun. 1-5:30</p>
        <p>Shop Eze</p>
        <p>i^OODLAND</p>
        <p>Buyers Market</p>
        <p>Our Flower Shop Is Full</p>
        <p>Youve seen the rest, now come buy from the best. We have something for everyone on your shopping list. Our prices are low on... corsages  unique Christmas wreaths &amp;amp; bows  decorated Norfolk Pines  Christmas arrangements for every occasion  fresh cut flowers  beautifully wrapped</p>
        <pb facs="00096780_0050" />
        <p>The Dally Reflector. Greenville. N.C.</p>
        <p>Sunday, November 22,1987</p>
        <p>Special</p>
        <p>aff</p>
        <p>&amp;lt;Siationtty</p>
        <p>10% dicouni on otiUx of $$0.00 ox moxe Jlax^t ^eUeiion to akoou. ftom ask akoui aditionai discount</p>
        <p>Jimmy Smith Printing Co, Inc. 511 Cotanche St. Greenville, NC 27834 752-2878 ,</p>
        <p>Viking Sewing</p>
        <p>Trade-in Special</p>
        <p>If youVe decided that it's time to trade-in your old Sewing Machine, bring it ini Christine Hagersten, a Viking Factory Representative from Huskvama, Sweden will be in our store to help you select the best machine for your needs. ^</p>
        <p>New Viking machines wiil be speciaiiy priced for this special event Come in and see our full line of Viking Sewing Machines ranging from the basic models to the Viking 990 computerized machine.</p>
        <p>One Day Only!</p>
        <p>November 25 10 AM-6 PM</p>
        <p>GREENVILLE SEWING CENTER</p>
        <p>GREENVILLE SQUARE GREENVILLE, N.C. 27834</p>
        <p>Swedish Pays</p>
        <p>Take a trip to ^eden without ieoving the country!</p>
        <p>Join us and Christine Hagersten from the Sewing Academy at Huskvama Sweden os she demonstrates sewing fashions arxi techniques on our complete line of Swedish I quality Viking Sewing Machines.</p>
        <p>Dotes: November 25 Times; 10 AM-6 PM</p>
        <p>Enjoy Swedish desserts and learn some thing about Scandinavian culture at this special "discovery" event. Don't miss tnefestlvltiesl</p>
        <p>GREENVILLE SEWING ttNTER</p>
        <p>GREENVILLE SQUARE GREENVILLE, NC 27834</p>
        <p>C1987</p>
        <p>HOWaFOD WOLF</p>
        <p>DANCE TIL DAWN HowjutI Wolfs flir^ triple-tkred Rajion (xepe cocktail dress begs to go dancing. Details to watch; V-back, deepset sleeves and jet buttons at the cuff. Youll love it in Red, Black</p>
        <p>Open House Sunday, November 22 2:00 p.m.-5:00 p.m.</p>
        <p>C.</p>
        <p>600 Arlington BK/d. Arlington Village</p>
        <p>Open 10:00 a.m.-6:00 p.m. 756-82-10</p>
        <p>Vows</p>
        <p>MRS.FULLAM</p>
        <p>Eng^am^eiits Announced</p>
        <p>PAMELA RIDDLE - is the dangb-ter af Mr. and Mrs. Fred H. Riddle of Roale 13, Goldsboro, who aimoaiice her eagageneat to Jesse Riggs, sod 0 Mr. and Mrs. Howard Riggs of Ronte 1, Wiatervflle, aid the late Frances Briley Riggs. Hie wedding win tahe place Dec. If.</p>
        <p>KENLYN MARIA RIGGS - is the dau^to* of Dr. and Mrs. Stanley R. Riggs of Greenville, who annomce her engagement to John Aleiander Yonng, son of Mr. and Mrs. WUUam Young of Yardley, Pa. A Dec. 20 wedding is being planned.</p>
        <p>Makeup Artist Breaks Women's Color Taboos</p>
        <p>By KILEY ARMSTRONG Associated Press Writer</p>
        <p>NEW YORK (AP) - Orange can make redheads ravisl^; green can be glamorous on oriental women. Sud) color customs just beg to be broken, says makeup artist Dana Harkavi.</p>
        <p>What do you say when designers work with oranges, yellows and greens  1 cant wear it, Ill see you next year? says Ms. Harkavi, who teaches women to change their skin tones and even their hair color to con^ment their clothing.</p>
        <p>(kme are the days of wearing the same color (makeup) for 10 years. Now, you match the colors to what you wear, she claims.</p>
        <p>In her new bock, Ill Make You Beautiful, (New American Library, $24.96), Ms. Harkavi recalls how she turned actress Martbe Keller from a fair-skinned blonde into a dark Blid-dle Easterner for the movie Black Sunday.</p>
        <p>If Marthe Keller could break aU of the expe^ color rules, so can you, she writes.</p>
        <p>At her D-Bfakiage salon in Manhattan, women who never dreamed of wearing green tearn to use makei^ with ab of violet to change their sallow skm. That group inakeiq) is selling well in Japan, sne says.</p>
        <p>Lavendo* is a fine shade fw blondes, she says. And makeup can make even redheads look great in a</p>
        <p>pink by hi</p>
        <p>rtigbt,|Hnk rouge.</p>
        <p>Ms. Harkavi thinks people who have their ideal clothing colors charted are limiting their optkms. Theyre beginners: people who really have no clue on how to put themselves together.</p>
        <p>Then again, people who choose K D-Makiage route may be limiting ttieir storage ^ce. Ehreryone who comes here tells me, *I have a whole room of inakeup from you, she concedes.</p>
        <p>Dance Arts Theatre Presents</p>
        <p>NUTCRACKER BALLET</p>
        <p>Wrtght Auditorium. East Carolina University Eastern Synphony Orchestra / Conducted by Robert Hause ^ Saturday. December 12 and Sunday. December 13 Students/chHdren $7.00 ' Adults $9.00 / Shows at 3.00 and 7:30</p>
        <p>For tkkef infortnaiion call 756-0440</p>
        <p>TWICE IS NICE!</p>
        <p>iTasaiw.Mief 7M-im ^ Mofc-ffW.  104</p>
        <p>Chttd ThamlugMat Dmv Only</p>
        <p>Look for onr npectnciilar 2*day salo In Thurednyn paper</p>
        <p>The wedding ceremony of Kara Ann Thnnnson and James Arthur FuUam took place Saturday at 2 p.m. The douUe-nng ceremony was con-by the Rev. Curtis Haislip at the Greenville Church God.</p>
        <p>Music was provided by Christy Emory.  ^</p>
        <p>Parents of the couple are Mr. and Mrs. Joseph T. Thompson of Green-viUe and Mr. and Mrs. William FuUam of Brodtsfield, Blass.</p>
        <p>The bride was givmi in marriage by her father. She wore a floor-len^ gown of silk peau de soie with alen-con lace motifs etched with seed pearls appliqued on the gown. She wore a layered veil of illusitm.</p>
        <p>The matron of honor was Patricia Stox. Saralyn Thompson, sister of the bride, was maid of honor. Each wore a floor-length gown of mauve taffeta.</p>
        <p>A reception was held at the home of the brides parents after the ceremony.</p>
        <p>The bridegroom is serving in the U.S. Marine Corp.</p>
        <p>The couple live in Jackscm-viUe.</p>
        <p>-Nwriy New" dUim't AW AMtt OolMiit.</p>
        <p>i</p>
        <p>Christmas Is Almost HemI</p>
        <p>If Youre Baking For Christmas Tins from Potpourri Pross Christmas Paper Napkins and Platts Towois, Napkins, Placo Mats Baking Papers Cookie Cuttars Bakeware Gift Bags Muga Call In Your Order For Thanksgiving Baked Goods Early! Crolsaanta^fuflina-Cookios</p>
        <p>Remember, we also make gift baskBtsI</p>
        <p>'hchenOgjboanLLd.</p>
        <p>Arlington Vlllagt</p>
        <p>654 Arlington BI^.QrotnvHlt  -----</p>
        <p>MBTC</p>
        <p>Verticol Sale</p>
        <p>Save 40% on</p>
        <p>LouveiDiapegl BHnds I</p>
        <p>Now Thru Dec. 31st!</p>
        <p>The Blind Design</p>
        <p>Open Houscc Sunday, Nov. 22 (2-5) GRAND OPENING: Dec. 4 5 5 (10-5)</p>
        <p>Now Open Mon.-Fri. (10-5:30KSaL (10-5)</p>
        <p>694 Arlington Village - Groonville</p>
        <p>355-6140</p>
        <p> OPEN HOUSE</p>
        <p>Qudaij, dimmb&amp;amp;t 22nd, 1987 at u4*Ciagtoa ^udCage 2:00 p.m.-6:00 p.m.</p>
        <p>Cieate 0 gioMous smomC amkeitce ioh odieis end youise^.</p>
        <p>the pei^ ho^idog gi^t ^ amongst the mgriad beosuies (n ouA ufoAm suAAoundlngs.</p>
        <p>9iyhen unique is not enough...</p>
        <p>Jnd li you see0(fr0(o, oua goAiiCa. please teCC come home.. .no questions asked.</p>
        <p>to</p>
        <p>614 Arlington llwd. at Arlington Villogo Greenville NC a7Sa IVIV17S6-0771</p>
        <pb facs="00096780_0051" />
        <p>.'vTf</p>
        <p>Hijilss Settle On Sand</p>
        <p>The Dally Reflector, Qretnville, N.C.</p>
        <p>8wwlw. Noywnber22.1967 07</p>
        <p>. ,   SHARON L. JONES 5* Associated Press Writer &amp;gt; phing : SAN DIEGO (AP) ^ Among the ^^winter? jiwimmers, surfers and tourists dotting the nations beaches are a tattered kind of sun-seeker; the homeless who have pushed out from ihe inner city until their road deadends at the sea. '</p>
        <p>sure its getting crummy, Im hit-to the (Florida) Keys for the.</p>
        <p>But, officials say, a growi^ per-' centage are the so-called situa-^ tional homeless, who end up on the street after losing jobs or through other bad luck. Hiey drift to the beaches, from Florida to Hawaii, to escape the violence near shelters in</p>
        <p>are learning to survive al^ the beach as urban campers,. city streets, said Frank Landerville, director of the San Diego County Regional Task  They dont stop until they Force on the Homeless. To the ocean, said Nike Arden, chagrin of local authorities, they camp on the beaches, in parking lots, camping areas.</p>
        <p>Often I</p>
        <p>their cars makeshift arrangements. Theyll stay there until someiHie tells - them to move on, he said.</p>
        <p>Many are chronic, admitted beach bums like Dave Woodriff, a Navy veteran. Im a snowbird. I follow the weather, said Woodriff, 33, as he sat with several homeless friends at a concrete table near Mission Beach. In a couple weeks, as soon as Im</p>
        <p>hit the</p>
        <p>ocean, said Nike Arden, former director of Ocean Beach Community Services who now works for its umbrella agency, San Diego Youth and Community Services.</p>
        <p>Bridal</p>
        <p>Policy</p>
        <p>A black and white glossy five by seven photograph is requested for engagement announcements in The Daily Reflector. For publication in a Sunday edition, the information must be submitted by 12 noon on the preceding Wednesday. Engagement pictures must be released at least three weeks prior to the wedding date. After three weeks, only an announcement will be printed.</p>
        <p>Wedding write-ups will be printed through the first week with a one column picture. During the second week, a one coliunn picture will be used with a write-up giving less description and after the second week, just as an announcement.</p>
        <p>Wedding forms and pictures should be returned to The Daily Reflector one week prior to the date of the wedding. All information should be typed or written neatly.</p>
        <p>Theres something that feels free . about the sea, Ms. Arden added. It sort of ties in with when were young and on vacation by the seaside. It brings back thoughts of better times.</p>
        <p>It represents another chance at freedom.</p>
        <p>Police say perhaps a dozen homeless people live in Ocean Beach.</p>
        <p>Officer Jim Arthur, spokesman in the areas police community relations office, said the homeless werent a problem.</p>
        <p>But officials at Ocean Beach Community Services say they serve 600 homeless p^ple annually with emergency services, and 500 more are in counseling programs.</p>
        <p>They contend their clients arent beach bums, but the nations unemployed, who land on their doorstep after reaching the end of the road to a new life. Interstate 8 meets the Pacific at Ocean Beach.</p>
        <p>At the beach, the homeless survive on odd jobs and food collected from neighboring merchants or trash cans. 1110 fortunate Uve out of cars, while others sleep under bushes, in pubUc restrooms, in alleys.</p>
        <p>In most beach cities, laws prohibit sleeping at ni^t on beaches or parking overnight in nearby public parking lots. Those caught by poUce can face fines of up to a $150, or even jail.</p>
        <p>But enforcement varies.</p>
        <p>We see people sleeping on the beach, under palm trees, said Kathy Woodman, spokeswoman for the Key West, Fla., poUce. What we do is just kind of move them around. </p>
        <p>In Venice, CaUf., near Los Angeles, some 100 homeless people have regularly camped around what amounts to a pup tent colony. But under pressure from residents, police conducted sweeps of the encampment</p>
        <p>that cut the population in half.</p>
        <p>Homeless Hawauans can aroly for permits that enable them to legaUy park in such areas as the MaUi Beach Park, on the western side of Oahus Waiana Coast, although a break camp rule there forces people to leave two nights a week.</p>
        <p>An estimated 15 percent of the island chains homeless people make the beaches their home; thats about 633 people.</p>
        <p>But in San Diego the laws are strictly enforced.</p>
        <p>The police cause a mass fear, said 42-year-old Robert, who has been living out of his 65 Vokswagen van around Mission Bay for a year and a half. He declined to give his full name. , ^</p>
        <p>You say the wrong thing to the wrong people and youd be jailed fw whatever they want to cluMe you with, especially if you have kids, the self-employed painter said.</p>
        <p>He said many homeless people therefore keep low profiles, especially parents who run the risk of losing their children to foster homes. These families are usually missed in police estimates of the vagrant population.</p>
        <p>A few miles away, Michael Lynch, 35, sits among a dozen homeless men on a wall near Ocean Beach.</p>
        <p>He said hes only been on the street a week, since his car was stolen the night before he was to move to Washin^n state for a new job. He lost all his possessions and cash, tot said he had one paycheck coming to him.</p>
        <p>Im going to get my check, get clean clothes, shower, hm a train ticket and laugh my way all the way to Seattle, he said. Ill do anything not to have to do this.</p>
        <p>Add That Special, Personal Touch To Your Christinas Gifts.</p>
        <p>LocMad off Hwy. 11 Soutti of GiMCMtN*. Turn fUghlJMt Pm CtroNM EM IM nd Oe BoMnd Pm Conmunlty Cottoo*. Tkon Turn mgM M Our Slg^Appm. 1 MHo On TTw Pl0h1.</p>
        <p>YES</p>
        <p>ITG</p>
        <p>ITG Travel Center can reserve and ticket your American Airlines/Winn Dixie coupons. You must purchase your ticket before December 31. Call</p>
        <p>us</p>
        <p>now.</p>
        <p>355-5075</p>
        <p>THE PLAZA Greenville</p>
        <p>OLD CARP INTO MON</p>
        <p>ALL PATTERNS 'o PRICE EVERYDAY</p>
        <p>L NO LIMIT</p>
        <p>- ^ '  - ......- </p>
        <p>ENTIRE STOCK</p>
        <p>PILLOW PANELS &amp;amp; CUT-OUTS</p>
        <p>80U0C010R </p>
        <p>Corduroy</p>
        <p>60 OESIQNet LENGTHS</p>
        <p>Silk Leek ^ Jacquards</p>
        <p>45-POLYESTER</p>
        <p>iBI</p>
        <p>Tartan  Wtaol Plaids</p>
        <p>60" WOOL BLEND</p>
        <p>^ H</p>
        <p>Flannelette * Prints</p>
        <p>45" Aa COTTON &amp;amp; POLY</p>
        <p>Plush * Rebe Velour</p>
        <p>er DEEP PILE POLY</p>
        <p>" Wii</p>
        <p>For each yard of your old carpet get *3 off a yard of Du Pont "Stainmaster"' carpet!</p>
        <p>Replace your worn-out wall-to-wall with '"Stainmaster" carpet and we'll pay you for iti A revolutionary new breakthrough from DuPont, "Stainmaster" carpet keeps resisting stains long after the best-known stain guard fails. And right now, this durable, beautiful carpet is so easy to buy, you can't afford to walk away from it!</p>
        <p>DUPONTSTAINMASiTR</p>
        <p>tar...,. CARPET</p>
        <p>Luxurious saxony Stainmaster* carpet In 46 decorator hues</p>
        <p>A dense, plush texture with unsurpassed soil resistance made of oualltv nylon.</p>
        <p>Regulariy21.M</p>
        <p>Elegant Trackless Stainmaster carpet in 29 lovely shades</p>
        <p>For the formal look you love. In a posh texture with e full 5 year warranty.</p>
        <p>Regularly 2SJ9</p>
        <p>Plush cut and loop StaHimaster carpet in 18 stunning colors</p>
        <p>An Intriguing pattern In quality nylon with a lifetime antl-atatic warranty.</p>
        <p>Regularly 21.99</p>
        <p>M</p>
        <p>14Alluring posh pile Stainmaster carpet in 33 striking shades</p>
        <p>Deep, dense and comforting underfoot with a carefree stein resletanoe.</p>
        <p>Regularly 36.99</p>
        <p>SGSeliISSe^S26^</p>
        <p>3010 E. Tenth Street, Greenville, N.C.758-2300</p>
        <p>-it!,   V-</p>
        <p>Ask Atnut Our 90 Day Same As Cash Program</p>
        <pb facs="00096780_0052" />
        <p>0$ Th Dally Reflector. Qrpnvllle. N.C. Sundiy. November 22.1987</p>
        <p>A MISTY SCENEOn a recent foggy morning, two tobacco bams, trees in ing chill stimnlates the appearance of groond fog. The scene here is near the middlegronnd and a forest in the backgromid all took on the vestiages of a Winterville along the Old Tar River Road. (Reflector Photograph by Tommy typical misty vision often encountered in eastern North Carolina when mom- Forrest)</p>
        <p>Study Of Ancient Egyptian Writing Is Gaining Popularity In France</p>
        <p>By JEFFREY ULBRICH Associated Press Writer PARIS (AP) - Jean-Francois Champollioo would have been pleased. A century and a half after the French archaeolo^t discovered the k^ to ancient Egyptian writing while dedpht^ the Rosetta Stone, the study of hieroglyphics has become a popular pastime in his homeland.</p>
        <p>The new students are not scholarly E^ptoloeists toiling away in musty corners of old museums, but doctors, gardeners, lawyers, housewives, secretaries and even some unern-* ph^ people, all with a passion for history and a curiosity about Egypt, its art and culture.</p>
        <p>**We were astonished at the interest, said Christine Gallois, director of the newly formed organization called Kheops (French for Cheops), which has created a three-year course in hieroglyphics for the general public.</p>
        <p>tt began in 1964 when Bfkhel Sidhom, a Frenchman of Egyptian</p>
        <p>Top Tn</p>
        <p>1. Mony Mony, Billy Idol</p>
        <p>2. (rve Had) the Time of.My Ufe, Bill Medley and Jendifer Wames</p>
        <p>8. I TTiink Were Alone Now, Tif-fkny</p>
        <p>4. Heaven is a Place on Earth, Belinda Carlisle</p>
        <p>5. Brilliant Disguise, Bruce Spr-</p>
        <p>6. Breakout, Swing Out Sister</p>
        <p>7. Shouldve Known Better, RkhaidMarx</p>
        <p>8.Bad,BlichaelJackson</p>
        <p>9. Causing a Commotion, Madonna</p>
        <p>^ 10. Uttle Ues, Fleetwood Mac</p>
        <p>Co^c origin, decided to publish a new edition of ChampoUions General Principles of Sacred Egyptian Writing, which first appeared in 1841, nine years after the ar-chaeolo^sdeath.</p>
        <p>The Rosetta Stone, which gave Champolhon the key to the ancient writing, was found in 1799 by the troops of Napoleon I in northern Egypt. It is a basalt slab and bears the writings of priests of Ptolemy V, the ^fptian ruler who died in 116 B.C. The stone now is in the British Museum in London.</p>
        <p>Only about 700 copies of Cham-poUions original book exist in the wwld, Miss Gallois said, most not easily accessible.</p>
        <p>The first printing of 5,000 copies of the new edition were immediately snapped up. In no time at all, an asto&amp;amp;hiM 16,000 copies had been sold in France and abroad, and another printing of 6,000 is just coming off the presses.</p>
        <p>In November 1986, Sidhom and Ifiss Gallois, who had spent two years working on the new edition, invited purchasers of the book to a meeting over mint tea to discuss the idea of starting classes in Egyptian hit)glyidiics.</p>
        <p>EmKting about 50 people, Sidhom and Miss Gallois were flabbergasted when 250 turned up. Of them, 160 immediately signed up for the first year, paying 1,500 francs (about $265) per semester and 1,300 francs ($230) for subsequent semesters.</p>
        <p>Hioroglyphics courses are available at ptoces like the Sorbonne, the Louvre School and the Catholic Institute, but they are geared for university students rather than the general public.</p>
        <p>Kheops expects to have about 200 students for its 1987-68 sessions.</p>
        <p>-  .  Flotilla  Event</p>
        <p>Top Counhy swand^m</p>
        <p> 1. Somebody Lied, Ricky Van Shelton</p>
        <p>. 2. I Wont Need You Anymore, Kandy Travis 3. Only When I Love, HoUy Dunn i Lynda, Steve Wariner i S. 1m Last One to Know, Reba McEntire 6. One For the Money, T.G.</p>
        <p>, I^ybe Your Babys Got the</p>
        <p>Judds</p>
        <p>rTDoYa,K.T.Oslin</p>
        <p>9. She. Couldnt Love Me Anymore, T. Graham Brown</p>
        <p>10. Ihoee Memories of You, Dol-^Partoo, Linda Roostadt, Enunylou</p>
        <p>SWANSBORO - The Clwistmas Flotilla in Swansboro will be held Saturday. The event, sponsored by the Swansboro Merchants Association, win get underway at 5:30 p.m. with a lineup of sailboats at the B. Cameron Langston Bridge.</p>
        <p>Anyone can enter the sailboat parade.</p>
        <p>Activities on the waterfront at Port OSwansborough will include a childrmis choir and community chmus. Santa Claus wiU dock at ap^ proximately8p.m.</p>
        <p>Public viewum can be made along the Intercoastal Waterway or from the towns waterfront. For more details, can 326-3128. _</p>
        <p>FIMLIIi</p>
        <p>Mistake-Proof Gift, ,at Sews. 1</p>
        <p>I</p>
        <p>imlna 11301</p>
        <p>The new Bemlna 1130 is a mistake-proof gift for anyone who sews... or wants to learn.</p>
        <p>Test the 1130 to(iay and you'll see. The 1130 Is smart. Yet easy to use. easy to understand. It tells you what presser fool to use, what stitch length and width is best. Its Impossible to make a mistake! Master it quickly sew for a lifetime.</p>
        <p>Dont make the mistake of waiting until the last minute to boy.</p>
        <p>BERNINAB^em</p>
        <p>Jhmajun</p>
        <p>wmtheQuamyettheNstc</p>
        <p>I do it entirely for the personal satisfaction, sai(l Roland Mouzy, 42, a pilot for Air France with a wide interest in history and art.</p>
        <p>Mouzy, who audited a course in at the Louvre five years ago, saiahe stumbled uto an ap-pUcation for the Kheops course for chance and I leapt at it. Its a real pleasure, particularly to be able to' write hieroglyphics.</p>
        <p>For Nicole Serpette, a 57-year-oW Paris housewife, studying ancient E^ptian writing is an interesting pastime and a good way to keep her mind active.</p>
        <p>Its very, very difficult and you must work a lot to make progress, said Mrs. Serpette, whose interest was sparked 15 years ago during the first Of three triu to Eg^.</p>
        <p>Dr. Monique Larmoyer, a 71-year-old retired ^yskdan, also had made several trips to Egypt and was very annoyed at not be^ able to read the inscriptions.</p>
        <p>The dvilizaticm fascinates me, I was very taken 1^ it.</p>
        <p>There are younger students too  the organization is starting a course this year for youths aged 11 to 15  but Kheops explains to them that there is little future in Egyptology.</p>
        <p>The National cienter for Scientific Research has about one opening a year for Egyptologists. Places in acadonia are few. And many existing Egypt experts are forced to earn their living in other ways.</p>
        <p>All the students agree that the</p>
        <p>study of taken</p>
        <p>is not to be that one must be hours work-_ at home after each weeks two-hourclass. ,</p>
        <p>At the end of the three-year course, a successful student will be able to decipher any middle Egyptian text, but not Ptolemaic Egyptian of the later period which evolved under Greek mfluence. A fourth year eventually may be added for those wishing to specialize in Ptolemaic, Miss Gallois sakt tfutwheredoesitalllead?</p>
        <p>Evelyne Pinol, 46, an engineer for General Motors who took up hieroglyphics during a long bout with cancer and needed something to occupy her mind, wonders too.</p>
        <p>^It isnt useful, she said. It</p>
        <p>no purpose. It just makes my mind work, and thats always good.^</p>
        <p>Museum Award To Ray Elmore</p>
        <p>Greenville artist Ray Elmore, a faculty member of the School of Art, East Carolina University, is the recipient of a publications award.</p>
        <p>The invitation designed by Elmore for the 1987 Fine Arts Ball of the Greenville Musuem of Art has been awarded a Publications Award by the North Carolina Museums Cbun-cU. Awards by the council were announced last week at the councils fU meeting.</p>
        <p>Fridty and Saturday 11-6  and Sunday 2-6 ^ Novambar 27,26, 29</p>
        <p>H  Spiced Tea &amp;amp;</p>
        <p>  Cookies Served</p>
        <p>Shop For Unlqua Gifts Of Quality And Raa-sonabla Plicas.</p>
        <p>Many New QHt Idaas. Gift Wrapping 1$ Free!</p>
        <p>I</p>
        <p>rr wrapping im rrami ^</p>
        <p>Jackie*s Ole House 753-3944</p>
        <p>11 HUM WmI I OtMMUte. M Mil* Off SMA Om Hwv. IS (8mw HIH-OolMoto R4.)</p>
        <p>Begin Your Education At Pitt Community College For An Allied Health Career</p>
        <p>Local Jobs AvaUaUe For:</p>
        <p>1</p>
        <p>Nursing Assistants</p>
        <p>(New Class Starting Winter Quarter)</p>
        <p>Nurses Respiratory Care Therapists Radiologic Technologists Medical Secretaries</p>
        <p>Learn More Aboitit Training For These Careers At</p>
        <p>Pitt Community College</p>
        <p>Alhed Health Testing Monday, November 231:00 P.M. Everett BIdg. Room 145</p>
        <p>756*3130, Ext 245</p>
        <p>Call</p>
        <p>Now</p>
        <p>752-2332</p>
        <p>Place your order for beautiful Thanksgiving shell oysters (South River), Crabmeat, Scallops, Shrimp (am., Ig., Jumbo) and shucked oysters.</p>
        <p>Thank you for shopping...</p>
        <p>EVANS SEAFOOD MARKET</p>
        <p>Coriwr 9th 0 Washington Stroots</p>
        <p>Betsy Drake Lewis</p>
        <p>DECORATING TIPS</p>
        <p>I A successful wall arrangement is easy to accomplish if you follow a few basic rules:</p>
        <p>1. Hang most accessories at eye level or below, tf the '  object is most often viewed from a seated position,</p>
        <p>hang the accessory at your seated eye level.</p>
        <p>2. Exercise judgement in spacing accessories. When things are aowded together, nothing stands out, so add space between large objects.</p>
        <p>3. Have one outstanding wall arrangement as your focal point.</p>
        <p>4. DecPrate every room in the house including the often-neglected hall, foyer, stairway and bathroom.</p>
        <p>5. For added interest, place some accessories in unexpected places.</p>
        <p>6. Dont go overboard. Create a lived-in look without making the room appear aowded and confusing.</p>
        <p>7. When using small objects, either on a wall or a table, arrange them in groups or clusters, and not in a row.</p>
        <p>8. Use three-dimensional objects for variety and depth. Clocks, mirrors, plants, plaques, and shelves give needed height or length to a room.</p>
        <p>Betsy Drake Interiors always has a great selection of accessories, pictures, minors and objects dart. You are cordially invited to visit our showroom and discover for yourself the excitement that is sweeping eastern North Carolina.</p>
        <p>fietsy 9rake Interiors</p>
        <p>425 Greenville Boulevard  (919) 756-9111</p>
        <p>SOMETHING BEAUTIFUL IS ABOUT TO HAPPEN</p>
        <p>(W22)</p>
        <p>TODAY 1-5 P.M.</p>
        <p>The Village Green Shops</p>
        <p>HWY. 70 East-Goldsboro, N.C.</p>
        <p>Register For A Fabulous Mink Jacket!</p>
        <p>Drawing To Be Held December 22,1987</p>
        <p>No purchase necessary. You need not be present to win.</p>
        <p>REGISTER AT ANYOFTHE FOLLOWING SHOPS:</p>
        <p> Crawfords Antiques</p>
        <p> The Country Shop</p>
        <p> Creations by Billie</p>
        <p> The Village Tea House</p>
        <p> Joshuas</p>
        <p> The Village Toggery</p>
        <p> The Cottage</p>
        <p> Lee Kemp</p>
        <p> Custom Wood Signs</p>
        <pb facs="00096780_0053" />
        <p>BySYDKRONISH u &amp;gt; &amp;gt;-APNewfetBr</p>
        <p>There are many mUestones in the history of flight ~ and atamos issued</p>
        <p>I stamps nut tiM</p>
        <p>by countries throughout t poignantly Illustrated</p>
        <p>such</p>
        <p>have</p>
        <p>achievements.</p>
        <p>Uganda has issued a new set of nine stamps dedicated to a variety of worldwide aerial milestones with ap-pr^te illustrations, a .</p>
        <p>Tiie 2-shilling stamp depicts the Eagle, ^a .man-powerra ultraligbt airplane flown bv a pilot who utilizes a pedal much like a bicycle. A1^ distance flight record of 37.3 miles, was made by this plane in January</p>
        <p>m.</p>
        <p>The Schilling shows the Junkers W-33L plane named Bremra. It made the first non-stop Europe-to-America flight on April 12,1928.</p>
        <p>The 5-shilling features the Lockheed aircraft Winne Mae flown by WUey Post in the first flight around the world. The plane is now in the Smithsonian Air and Space Museum in Washington, D.C.</p>
        <p>. The 10-shilling illustrates the Voyager, ar special aircraft flown on Dec. 14,1986, by Jeana Yeager and Dick Rutan. It was the first flight around the world without landing or refueling.</p>
        <p>The 15-shilling depicts the first flight of the Chanute Biplane Glider over the sand dunes near Chicago in 1896.</p>
        <p>The 25^hilling pictures the first transpolar flight of an aircraft on May 11, 1936. Passengers on the Norge were Italian Umberto Nobile, Norwegian explorer Roland Amundsen and American explorer Lincoln Ellsworth.</p>
        <p>The 35-shilling shows the 50-</p>
        <p>I</p>
        <p>Issues</p>
        <p>horsepower Oirmjbiplane making the first takeoff anfkiadingM at sea. American Eugene B. landed oo the cmiser USS Penn- , sylvania on Jan. U, 1911.  ^</p>
        <p>Hie.454hilling features Alan B; Shepard Jr., the first American to, travel in outet space, on Mays, &amp;gt;961.</p>
        <p>Hie lOO^hUlhig stamp bears a photo of the first flight of the super- ; , sonic Coocordepassengerplaned ^ Paris to Dakar, Sen^, on the inir v 1 tial leg of a tr^ to ffio de Janeiro, Brazil, on Jan. 21,1976.</p>
        <p>This set of stamps was designed by</p>
        <p>William R. Hans(m, a f(Hmer U.S. Air F(hx pilot with oimbat experience in Vietnam.</p>
        <p>&amp;gt; The U.S. Postal Service reports that it will issue a stamp in 1989 to honor philanthropist Johns Hopkins. The stamp will be part of the Great Americans Series.</p>
        <p>^ Hopkins, a successful 19th-century merchant, banker and investor, best ronembered for his |7 million gift to fund a hospital and a university in Baltimore, Md., that now bear ms name.</p>
        <p>The Quiz</p>
        <p>See Answers Poge C-10</p>
        <p>TNi OUI MIIT W HMMMMNrS</p>
        <p>M lOUCATKM MIOONMi</p>
        <p>ZtTo E. 10th St OHIc: 75^73S5  Hoim: 783-6970</p>
        <p>Formal</p>
        <p>Rentals</p>
        <p>ChooM from over 40/tuxedo styles and colors including the New Miami Vice and Dynasty OC^Ion.. ^*3^4,</p>
        <p>I</p>
        <p>Steinbecks</p>
        <p>MIN'S SHOP</p>
        <p>S42 Artlngton BM  38M926 Carolina East MaH  7564206</p>
        <p>(igpdlnlsloraaeli</p>
        <p>f..</p>
        <p>- '</p>
        <p>' '' v/-</p>
        <p>1 In WaiMnflon recently, Nkaragnaa Preiident Daniel Oilesa asked NkaraguanCardinal MiguelObandoV Iravo to presenta cease-fire proposal to the contras. Mr. Ortega also met wHh Speaker of the House Jim Wright, who was acting (CHOOSE ONE: on orders from, against the wishes of) the President).</p>
        <p>2 Twenty-six people died In a recent plane crash at the Denver airport The DC-9 plane flipped over and broke apart on takeoff. At the time, visibMty was reduced because of (CHOOSE ONE: fog, snow). I</p>
        <p>3 At the recent Arab summit, several nations decided to resume diplomatic ties with This Arab nation was spurned by others for ks 1979 peace treaty wi6i Israel.</p>
        <p>4 President RergaiVslliird nomination to the Supreme Court this year is Anthony Kennedy, a man who h considered (CHOOSE ONE: more, less) conservative than the previous two nominees.</p>
        <p>5 The Food and Drug Administration recently approved a new drug caMed TPA. The drug could prevent tissue damage in patients suHering from (CHOOSE ONE: heart attacks, tumors).</p>
        <p>iMNsmiiie</p>
        <p>(16 polnis H you can MsnWy IMs pwson In 6w news)</p>
        <p>The European gov-emment I lead recently announced that average consumer prices wMrise by 49 percent In 19|g.Whoamland what nation do I lead!</p>
        <p>Urntsiliiatihaialm</p>
        <p>IHalCllllUrllD</p>
        <p>(2 pehns lor Mch cerrsct malch)</p>
        <p>1-overcome a-inundate</p>
        <p>2-overflow b-inspect</p>
        <p>3-ovcrrun ^ c-exaggerate</p>
        <p>4-oversee d-conquer</p>
        <p>5-overstate e-occupy</p>
        <p>peopi6watcb/spomigiii</p>
        <p>(8 pemis lor each coTTMt answw)</p>
        <p>1 Publisher WMBam Caines and the rest of Ms xany staff recently celebrated the 35th birthday of - the nation's oldest humor magaxine.</p>
        <p>2 Critics are, praising "Timebends, the autobiography of playwright Arthur Miller. MMIer is perhaps best known for his Pulitxer Prlxe-winning play (CHOOSE ONE: nhe Class Menagerie. Death Of A Salesman).</p>
        <p>3 Moat pre-season poRs ranked last year's NCAA tourney runner-up (CHOOSE ONE: Syracuse, Ccorgetown) number</p>
        <p>V onebicoNegebaefbalthbyoar.</p>
        <p>4 Last week, Martina NavratHova began her quest forafifth consecutive Virginia SIbns title in Chicago. TRUE OR FALSti NavratRova is currently ranked second in the world.</p>
        <p>5 Two weeks into the NRA season, the Roston Celtics and LA. Lakers were stRI undefeated. The record for most wins at the start of a season is ..f~.</p>
        <p>a-9 b-15 c-21</p>
        <p>YOUR iCORE: 61 to 160 polnis-TOP 6C0RE:</p>
        <p>6110 60 polnis - Eiecisni 71 to 66 pdms - Good. 61-70 poWt - Fair.</p>
        <p> iCiiMiadM UnHmNsd. Inc. 1123-07</p>
        <p>The Plaza  Greenville  Open  Sunday  1  til  6</p>
        <p>SUNDAY ONLY SALE</p>
        <p>ENTIRE STOCK</p>
        <p>MISSES  URGE SIZE  PETITE</p>
        <p>a</p>
        <p>BLAKE COORDINATES</p>
        <p>^  BY DEVON,</p>
        <p>PANTS,^SKIRTS, BLOUSES &amp;amp; SWEATERS  4  Q90</p>
        <p>Values to $48...........................................  I  %/</p>
        <p>BLAZERS</p>
        <p>Values to $86.</p>
        <p>  -'u-</p>
        <p>I,  r    '</p>
        <p>.......---------,^..o............</p>
        <p>2990</p>
        <p>AND DONT FORGET YOUR BALDWIN BEAR, ONLY $8 WITH A $25 PURCHASE</p>
        <p>Tar Road Antiques &amp;amp; Fireside Shop</p>
        <p>fireplace Accessories  Chirnnev Sweeping  Furniture Stripping &amp;amp; Refmishiny On The Old Tar Road i Mile South Of Sunshine Garden Center P 0 3o&amp;gt; 91; WmtervJie NC 28590 Hours 8-3 Saturday. 10-6 Mon. Fri  In-Home Evening Appointments Available</p>
        <p>(919)355-6003 Night 756-1007</p>
        <p>TlTeQ)smetici^313ecil ()f</p>
        <p>Deimal Pigmentcitk )ii</p>
        <p>Permanent Cosmetics, Inc. now oilers a way to permanently improve your cosmetic aR^eal. It isa pnx:ess called dernuil pigmentation, which actually implants color pigments into the skin for a natural, attractive ai^rarice.</p>
        <p>Dermal pigmentation has many applications. It is often used as a replacement or supplement for miikeiip. It can elimiryite your dependence upon lip liners, eyebmw pencils, and cover sticks. It is abo a wav to camouflage scare caiused by surgerx' or injure'.</p>
        <p>At fcrmanent Cosmetics, Inc. we are concerned with vTUir a&amp;gt;smetic appeal. For mon* in/ormuiion and ci five hrxKhuiv ahoiit dvrmalpigmcnUition, call 756-S417.</p>
        <p>miviANi^Nr</p>
        <p>aHvnrncs. lx-.</p>
        <p>P.O. Box 7003 f 205 Commerce Sta*el  Suite A  (ia*enville. NC 27H5H  (919) 756-H417 '</p>
        <p>r</p>
        <pb facs="00096780_0054" />
        <p>brothers Are Diggers Of Well, Graves</p>
        <p>ACE COUPON</p>
        <p>^ By BILL EDWARDS - ' Hie Anniston Star ASHVILLE/Ala. (AP) - If you live and die in rural St. Gair County near AshvUle, chances are fair that you and the Mostella brothers might crosspaths.</p>
        <p>Cleaners of wells and diggers of graves, the brothers - Ernest, 79, and Walter, 73  know what its like to wwk below earthworm-level, doing whats necessary to ensure the maintenance of life or the permanence of death.</p>
        <p>Its a dirty job, down in the hole. Draped across a tree stump outsi^ the frt door of Ernests house trailer at the end of a dusty road is a pile ^ clodi which, at second glance, is actually his work clothes. Encrusted with beige mud from a 22-foot well at the lower end of Beaver Valley, Ernests dark blue pants and shirt resemble a primitive sculpture more than something to wear.</p>
        <p>The Beaver Valley job was their most recent well cleaning, but the procedure for any well is the same, explains Ernest.</p>
        <p>First theyve got to take the top off the weD, not an easy task considering bow heavy most cement tops are. Well owners, accustomed to corawing water out with a pump and a pipe.</p>
        <p>dont usually think anyone will ever need to get back down in the hole some years aWay and they seal it up tight, he says.</p>
        <p>Next, the men lower a weight at the end of a rope to see how much water is in the bottom. More than four feet, says Ernest, and they pump it out.</p>
        <p>Then they check for gas in the well by lowering a light into it; only occasionally do they fmd but if its there and so are they, the result could be tragic.</p>
        <p>'If ymi dont hold your breath, ^ wont last five minutes/he says.</p>
        <p>After checking with  pole to learn exactly how much mud Uieyre looking at, the brothers begin teamwork practiced for many years. Its simple. Ernest goes down the hole, Imac-utf himself in the handholds on the side of the shaft, scoops the bottom mud into a plastic pickle bucket with a trusty old shovel, and Walter puUs it up.</p>
        <p>It sounds like hard work, and it is.</p>
        <p>It took us 3M: hours the other day and Im sore now, says Walter, twitching his shoulder in demonstraton.</p>
        <p>Despite feeling sore muscles, the broths have mostly escaped injury in thw occupation. No weU has caved in on them, and the worst incident</p>
        <p>was when someone Ernest was working with (not Walter), dropp^ a bucket onto his head, ving nim a nasty cut. -Eniest also has found snakes'a couple of times. Once it was a pair of rattlesnakes, which he shot and then had taken up to the surface. The reason for getting rid of them above 1, he explained, was so snake</p>
        <p>Adopt-A-Pet</p>
        <p>The Pitt CounW Humane Society Pet of ie Week is this l-year-old spayed female black and brown shepherd-bound named Duchess. She has heartworm treatment started and has shots. Humane Society, 756-1268.</p>
        <p>Also being sought homes are the following;</p>
        <p>Five kittensone orange, one gray, one gray tabby, two black and white; a spayed female black and white cat; a neutered male orange and white cat. All have shots started. Humane Society, 756-1268.</p>
        <p>A 6-week-old male mixed boxer; four 7-week-old mixed shepherds; a 7-week-old mixed Doberman pinscher; a 9-week-old male mixed pointer; a 3-month-old female mixed Lab; a 3-month-old male mixed beagle; a 3-month-old female nxed walker hound; a spayed female mixed fox terrier; a female long-haired dachshund; two 5-montb-old mixed Labsone yellow, one black; a 5-montb-old female terrier; two 6-month-old black mixed Labs  one male, &amp;lt;me spayed female; a l-year-old spayed female white mixed Lab; a 6-m(mth-old male small shepherd-collie; a l-year-old male Lab-buskey ; a 6-month-old male mixed Afghan; a spayed female beagle-terrier. All have shots started and are on heartworm prevention. 756-1268.</p>
        <p>A spayed female gray tabby cat and an orange and white male cat. Both have shots and are litter-trained. 756-2027. Leave message.</p>
        <p>Four 8-we(^-old part black Lab puppies - three niales, (me female. 752-2366.</p>
        <p>An 8-month-old female black small mixed breed d(^. 758-7046.</p>
        <p>A female black and white kitten. 756-4048.</p>
        <p>Lost in Doctors Park areaa female solid gray cat. 758-9822.</p>
        <p>Lost in Westhavai areaa female Irish setter. 756-3939.</p>
        <p>Lost on Dicldnson Ave. - a female Dalmatian. 355-5200 or 756-6101.</p>
        <p>Lost in Simpson-Grimesland area  two huskeys  one male, one female. 758-3335.</p>
        <p>Lost in Langston Park - a young adult male orange tabby cat. 752-4267.</p>
        <p>Foimd in Red Oak areaa yellow tabby male cat. 756-7279 or 830-2812.</p>
        <p>This colmnn is published free of charge each Sunday. Call Elizabeth Savage, 756-4867; Bobbie Parsons, 756-1268; or Carol Tyer, 752-6166. Humane Society hours are 2 to 5 p.m. Saturday, Sunday and Monday and the remainder of we, by appointment, 756-1268. To request a Humane Society investigation, call BarhEura Haddock, 752-9922. To request assistance for v^d animals and birds, call Grifton, 524-4330. To become a member, call 756-1268. Donations to the Humane Society may be sent to P.O. Box 8121, Greenville, N.C. 27835.</p>
        <p>Editors note: The deadline for entries in each Sundays column is Thursday at 4 p.m.</p>
        <p>Cordially Invites You To Attend</p>
        <p>Our Open House Celebrating the Christmas Season</p>
        <p>Sunday, November 22 Two Until Five</p>
        <p>Refreshments Will Be Served. Selected Items Specially Priced.</p>
        <p>Hours Nou.-Sat. 10 a.m.-6 p.m. (919) 355-7929</p>
        <p>923 Red Banks Road Arlington VUlage</p>
        <p>tbrl.4&amp;gt;vc that has passed the Test  Time</p>
        <p>The circle is the symbol of unending love. Like the circle, your love traces and reinforces its own pattern, growing stronger with time.</p>
        <p>The Eternity Ring is a circlet of diamonds, emeralds, sapphires or other precious gems. It's the perfect gift for the woman you've loved for many years... and will continue to love for many more.</p>
        <p>lAUTADES</p>
        <p>Projttond Jewden</p>
        <p>ESTABUSHED 1912 640 Arlinfpon BlvdJCrvrnvilir, N.C.</p>
        <p>Phone 756-0083</p>
        <p>vi* DEDICATED TO</p>
        <p>KNOWLEDGE, ETHICS AND CONSUMER PROTECTION,</p>
        <p>ilood wiNildnt contaminate the well water.</p>
        <p>Ernest estimates they work on 35 to 40 wells in a year, and their fee for enduring these rigors and risks is $150 ~^if it aint a bad well, says Walter. They charge $250 if the well is particularly deep (their record is about 65 feet) or has an especially large amount of mud in it.</p>
        <p>Nevertheless, Walter notes, at least a well is already dug, and their job is simply to get a relatively small amount oteiarth out.</p>
        <p>Digging a grave, on the ofher hand, can be a more troublesome proposition if the ground is frozen or dHed-out hard. In such cases, Walter says, Id rather clean out two wells than digone grave.</p>
        <p>Hie brothers have been diggii^ graves for a couple of cemetries in the area for about 20 years, says, Walter. Its a job thev do separately, thoi^; each Mostefia has a friend whohelps him with the grave work.</p>
        <p>St John's Show</p>
        <p>;WILMINGTON  Two shows are "ourrently on view at St. Johns Museum of Art, 114 Orange Street, Wilmington. Both will be up through Jan. 16,1988.</p>
        <p>Christine Baukus is showing glass art created in a format of hancl-blown laid out in geometric designs, this surface, she lays a graidiic line of cut glass and leacted channels.</p>
        <p>The second show is the third annual exhibition of WilmingUm artists. A total of 25 artists are exhibiting work which cover the media of oils, water-colors, graphics, prints and ceramics.</p>
        <p>Gallery hours at St. Johnss are from 10 a.m. to 5 p.m. Tuesdays through Saturdays. Admission is free.</p>
        <p>Children's</p>
        <p>Celebration</p>
        <p>The Pitt-Greenville Arts Council is ^nsoring A Childrens Holiday (^lebration on Dec. 5 from 2 to 5 pm. at the Jaycee Parte Auditorium, 2000 Cedar Lane.</p>
        <p>There win be holiday stories, movies, snacks, button nuuting, card decorating and music to entertain children ages five to 10.</p>
        <p>Parents wanting their children to attend are to caU the arts council at 757-1785 to register between the hours of 9a.m. and4p.m. Mondays through Fridays. Admiki(is$3perchild.</p>
        <p>The Answers</p>
        <p>WORLDSCOPE: 1-against the wishes (tf; 2-snow; 3-Egrpt; 4-less; Shart attacks.</p>
        <p>NEWSNAMES: Wojciech^ Jaruzelski, Poland.</p>
        <p>BiATCHRORDS: 1-d; 2-a; 3^s; 44); Sc.</p>
        <p>PEOPLEWATCH/SPORTLIGHT: 1- Mad; 2-Death of A Salesman; 3^yracuse; 4-TRUE; 5-b.</p>
        <p>A grave, by law, is supposed to be four feet deep (used to be six), says ^ Ernest, but he adds that doesnt stop , him from sometimes fudging a litle ' and digging it Vk feet cjeep.</p>
        <p>The undertaker gripes when you get em too deep, he says. Besides, he adds, he trusts God to keep&amp;gt; evenrthing in order.</p>
        <p>We say there aint no God, but there is, Ernest declares. He fixes it (the grave) where there aidt no odor or nothing comes out.  &amp;gt;  -</p>
        <p>ACE ONE-HR. DRY CLEANING AND LAUNDROMAT*</p>
        <p>OPEN 7;()()-l 1:00 DAILY</p>
        <p>Shirts. . 50</p>
        <p>Dells i ()i k Sqiiii 11</p>
        <p>7)6-97S2</p>
        <p>I tesh ( eiilei  Sl.mloii  S(|ii</p>
        <p>7.")i)-9010</p>
        <p>Jumpsuits</p>
        <p>25%</p>
        <p>O off</p>
        <p>IfjXTuii</p>
        <p>V *  17  *  lh  SMt</p>
        <p>For todays most exciting and exotic iadies fashion apparei iand accessories, eiegant 14K goid and siiver jeweiry</p>
        <p>and</p>
        <p>Enchanting gifts for your loved ones from all over the world</p>
        <p>Tke</p>
        <p>ea</p>
        <p>Coming Soon To Carmino Bast Mall</p>
        <p>Watch This Newspaper for the Announcement</p>
        <p>FREE MEMBERSHIPS! *</p>
        <p>Workout for FREE until December 31,1987</p>
        <p>rij-</p>
        <p>You are under no obligation to join</p>
        <p>You must be 18 years of age or older</p>
        <p>Only the first 50 women will be eligible</p>
        <p>Register at our Open House Sunday, November 22,1987 1;00 until 5:00 p.m.</p>
        <p>Call 756-1592 Today</p>
        <p>for an appointment, to see all we have to offer!</p>
        <p>Hourly Classes Low Impact Aerobics, Regular Aerobics and Floor Exercise Private Showers and Dress ing Rooms Relaxing Whirlpool &amp;amp; Sauna Certified Instructors Most Modern Equipment And Much, Much More Personalized instruction Soothing Sauna</p>
        <p>oastal Fitn</p>
        <p>Jacksonville</p>
        <p>347-2262</p>
        <p>For Women Only</p>
        <p>Featuring the Ultimate" Aerobic Floor</p>
        <p>301 Plaza Drive, Greenville 756-1592</p>
        <p>Wilmington</p>
        <p>791-1910</p>
        <pb facs="00096780_0055" />
        <p>"ISl We have the largest selection of Smoked and Country</p>
        <p>I Hams, Butterball and Grade A Turkeys at prices as low or lower than other food chain specials including those with special purchase requirements.</p>
        <p>Th&amp;lt; &amp;gt;litictor. Qfeenvllte. N.C. Sunday, November 22,1987 C-lt</p>
        <p>November, 28, 1987 Quantity Rights Reserved</p>
        <p>Guarantee,</p>
        <p>Be Undersold!</p>
        <p>These coupons good with an additional $50.00 or more purchase! Limit 1 per family. Alcoholic beverage, cigarette and turkey purchases excluded.</p>
        <p>Felt's or Joyner s</p>
        <p>Country Hams</p>
        <p>$159</p>
        <p>lb.</p>
        <p>Southern</p>
        <p>Style</p>
        <p>Potato</p>
        <p>Mr</p>
        <p>Ocean Spray</p>
        <p>Cranberry Sauce</p>
        <p>jellied or whole</p>
        <p>58</p>
        <p>M Monte</p>
        <p>Vegefables</p>
        <p>cMt or frtMfc MM boom, moof poM, oooM or odlolo komol coro</p>
        <p>Crisp Green</p>
        <p>Celeiy</p>
        <p>sldli</p>
        <p>Fancy</p>
        <p>Sweet</p>
        <p>Potatoes</p>
        <p>w</p>
        <p>lb.</p>
        <p>In Our Bakery</p>
        <p>Dinner</p>
        <p>Rolls</p>
        <p>dozen</p>
        <p>79*^</p>
        <p>Kraft Philadelphia</p>
        <p>Cream Cheese</p>
        <p>78'=</p>
        <p>Birds Eye</p>
        <p>Cool Whip</p>
        <p>r rtgukir or . craainy</p>
        <p>c</p>
        <p>Opn H|WI</p>
        <p>DedhM</p>
        <pb facs="00096780_0056" />
        <p>it</p>
        <p>i</p>
        <p> T.</p>
        <p>(</p>
        <p>HOLLY FARMS</p>
        <p>Sunday Best, Roaster</p>
        <p>Easy Fixings For Fast Hoiiday Meais</p>
        <p>..'i-.V-r</p>
        <p>'A</p>
        <p>'Ji .t' t ^Vn</p>
        <p>' Elit'</p>
        <p>24-OZ.</p>
        <p>Old Italian Brand Pizza</p>
        <p>"  ERBE</p>
        <p>GET ONE</p>
        <p>. tssssr</p>
        <p>fCrS,"'e-y - p </p>
        <p>'  '^r'^S,53',**onm9</p>
        <p>^Pr*nr&amp;gt;VfcJr/rr *'^**^cepan Ariw   ^</p>
        <p>OLDE ITALIAN BRAND DELUXE OR</p>
        <p>PEPPERONI OR DELUXE CHEESE OLD ITALIAN BRAND</p>
        <p>Pepperoni</p>
        <p>Copyrlflrt 1M7 Kraflcr tiw&amp;gt;On</p>
        <p>OuMllty RlfhU RMr4 tfTDa</p>
        <p>Nmm tM f Dcator*</p>
        <p>Snack Pack Pizza</p>
        <p>MvmnM* im *uv</p>
        <p>laak d MH  Nw    (WM    k* fWv</p>
        <p>dtatta Im tm m &amp;lt;Mk llnw IdtT. mm*! m ! H mi &amp;lt; N M  (M &amp;lt; d * KM</p>
        <p>w M  I ftm Kd dkimmidlilliMi^i</p>
        <p>I i"-rT. &amp;gt;dlMlit M HM mkiii d  idmlmt mill  mull di djyidiM mt  t Hid d</p>
        <p>MW dnijti* ** tab M iitr mt mMm WWW tiMM mmmM  Nm.</p>
        <p>ia*'</p>
        <p>tJ tlS"</p>
        <p>MONEY</p>
        <p>ORDERS</p>
        <p>25&amp;lt;OPEN 24 HOURS EVERYDAY</p>
        <p>600 Greenville Blvd.  Greenville 756-7031</p>
        <p>/</p>
        <pb facs="00096780_0057" />
        <p>The Daily Reflector, GreenvHle, N.C. Sunday, November22,1987  C--|3</p>
        <p>#ai</p>
        <p>THE DAILY</p>
        <p>REFLECTOR752-616^</p>
        <p>The</p>
        <p>DaOy</p>
        <p>Reflector</p>
        <p>752-6166</p>
        <p>rates</p>
        <p>Line Ads</p>
        <p>3 Line Minimum</p>
        <p>lOay...........85'per line per day</p>
        <p>2-3 Days.........65'per line pef day</p>
        <p>4&amp;lt;Days  .58'per line pet day</p>
        <p>7-14 Days........53'per line per day</p>
        <p>Classified Display</p>
        <p>$3.75 Per Col. Inch Contract Rates Available</p>
        <p>office hours;</p>
        <p>Monday thru Friday</p>
        <p>8:30 a.m.-5:00 o.m.</p>
        <p>THE DAILY REFLECTOR rstsrvss Mm right to mW or rs-loci any advorlitoinsnl tubmll-lad.</p>
        <p>errors</p>
        <p>Ploaso read your ad carelully the first lliTM It appears In the paper. If It needs a correction as a result of our error, please call us before 9:30 am. and we will correct it for you. The Dally Reflector cannot make allowances for errors after the 1st dayof publicallon.</p>
        <p>concellofiont</p>
        <p>If you wish to cancel an ad, please call before 9:30 am. on Ihe day that is is scheduled 10 run and we will remove II We cannot cancel ads after 9:30 a.m.</p>
        <p>deodlines</p>
        <p>Mon... Tues.. Wed... Thurs.. FrI.... Sun...</p>
        <p>Classiliad Display Deadlines</p>
        <p> .Fri. Noon</p>
        <p> Fri. 4 p.m.</p>
        <p> Mon 4 p.m.</p>
        <p> Tues. 4 p.m.</p>
        <p> Wed. 2 p.m</p>
        <p> Wed. 5 p.m.</p>
        <p>Public Notices</p>
        <p>INVITATION FOR AIDS</p>
        <p>Sealed bids, in single copy, for the work described herein will be received until 3 p.m., local Hme at the place of bid opening, December 9, 1987, in the third floor conference room of the Pitt County ONIce Building, located at 1717 West Fifth Street, Graenvllle, North Carolina, and at that time publicly opened. Malllria address: 1717 Wrst Fifth Areet, Greenville, North Carolina 27834, telephone 919-</p>
        <p>respective bidders may assemble at the front entrance ot H.B. Sugg Grammar School located on the comer of George and Hines Streets, Farmville, North Carolina, on Monday, November 30, 1987, for a group showing of the work site. The group will assemble at II a.m. on November 30. If you are unable to attend the group show-bM, arrangements to Inspect the Sim may be made with Mr. John McKnight, Alternate Con tracting Officer for the Pitt County Board ot Education, 1717 West Fifth Street, Greenville, North Carolina 37834, telephone 919-830-4203.</p>
        <p>BM security In an amount of not leu lhan five percent (5%) of the total bid price must be submitted with each bid exceeding 8S8A00. Security may be In the form of a bid bond, cashier's or certified check, postal money order, or cash. If a bid bond Is used. It nuy be executed on Form SCS-As-158. If a check or money order Is used, it must be made payable to the Pitt County Board of Education. Bid security other than bid bonds submitted by unsucceuful bidders will be returned as soon as prac tlcable after award of contract. The succeuful bidder will be required to execute a contract. Form SCS AS 41. It the bid exceeds 830,000 the bidder will be reared to furnish to the Con tracting Local Organliatlon a performance bond and a payment bond, each in a penal sum of not leu than one hundred percent (100%) of the original contract amount. Form SCS 141, Performance Bond, and Form SCS-AS 140, Payment Bond, may be used for this purpou id will be supplied to tfw succeuful bidder.</p>
        <p>Corporations executing the bonds as sureties must be amoiM thou appearing on the U.S. Treasury (Japartnnent's list of approved suretlu. DESCRIPTION OF WORK: Flood prevention and Land Dralnago at H.B. Sugg Gram mar school Involving the estimated quantities shown on the attached bid Khedule. The work shall be commenced within ten (10) calendar days and be completed within uventy (70) calendar days after the date of receipt of the Notice to Proceed.</p>
        <p>NOTICE; The Bid Schedule, (foneral Provisions, Special Provisions, Equal Opportunity Clause, Certification of Nonsogragated Facilities, Speclftcatione, and Drawings listed under contents will be In corpuated In and become a part ot the resultant contract.</p>
        <p>NOTE: Proapactlbe bidders are hereby notified that they must have prop licanu under Ihe State Laws governing their trade, (vsiwral contractors are notified that Chapter 87, Article I. (tefwral Statutes ot North Carolina will bo observed In receiving and awarding thl&amp;lt;</p>
        <p>Ihaw^ raauves the right to reject any and all bldSj^and to award the contract In the bost iRteireatoflhaowiMr. N0mbor19,a,1987.</p>
        <p>urna -</p>
        <p>I Having qualified as Ad-t mbllstratrlx ot Iho utate of rritt Seymour late y. North Carolina,</p>
        <p>tracKirs</p>
        <p>saw dacaiuodta present thorn to the undersigned J^lnlstratrlx on or bofore May 8, 1988 or this neflceor same will be pleaded In</p>
        <p>b of their</p>
        <p>Mwovjry</p>
        <p>All per</p>
        <p>sons indebted to uld estate pleau make Immediate pay ment.</p>
        <p>This 4th day of November, 1987.</p>
        <p>Mary Ann Seymour Routes, Box202-A-2 Greenville, NC 27858 Administratrix of Ihe estate of Margaret Merritt Seymour, deceased. November 8, 15,32,29,1987.</p>
        <p>NOTICE TO CREDITORS AND DEBTORS OF</p>
        <p>MARYBWHELESS</p>
        <p>All persons, firms and corporations having claims against MaryB Wholeu, deceased, are notified to exhibit them to Herbert W. Wheless and Bobble W. Jones, as Co-Executors ot the decedent's estate on or before May 9, 1988, at the Post Office Box 8188, Greenville, North Carolina 27835 8188 or be barred from their recovery. Debtors of the decedent are asked to make Immediate payment to the above-named Co Executors. Herbert W. Wheleu and Bobbie W. Jones Co-Exocutorsot the Estate of MaryB Wheleu OF COUNSEL:</p>
        <p>Chartes L. McLawhorn, Jr.' Chartes L. AAcLawhorn, Jr., PJk.</p>
        <p>Pott Office Box 8188 Greenville, North Carolina 37835 November 8,15,23 and 29, 1987.</p>
        <p>NOflCE TO CREDITORS AND DEBTORS OF</p>
        <p>VICTORIA VINCENT HART</p>
        <p>All persons, firms and cor porations having claims against Victoria Vincent Hart, deceased, are notified to exhibit them to Chartes M. Vincent, as Exec utor of the decedent's utate on or before AAay 14. 1988, at Put Office Box 1411, Greenville, North Carolina 27835, or be bar rod from their recovery. Debtors of the decedent e uked to make imnwdlate payment to the above named Executor Chartes M. Vincent Executor of tlw Estate of Victoria Vincent Hart OFCOUNSEL:</p>
        <p>Chartes L. AAcLawhorn, Jr. Chartes L. AAcLawhorn. Jr.. P.A.</p>
        <p>Put Office Box 8188 (keenvllte. North Carolina 37835 November 15, 23, 39, December 4,1987.</p>
        <p>People</p>
        <p>NEED</p>
        <p>classified</p>
        <p>002 PgrsofiBls</p>
        <p>VSn^SISrA^^rs?</p>
        <p>storage -1 block from telephone office. Call 355-5049. H^er Road Self Storage.</p>
        <p>^XITRArNiiLiNo:</p>
        <p>AAarltal, Family, Individual. OonaM T. Bradihaw, 35SS194. Confktenttel.</p>
        <p>romrTrBmmzTRs:</p>
        <p>mont Defimbar 3,, leaves Kinston 4:40a.m. {arrives LaOuardIa 9:44p.m. December 4, teevee LelSuardia 12 noon, er-rlvw l^ton 2:34p.m. 3 Nchets. 890oech. 754-8332 after 4p.m.</p>
        <p>FrmrrrarTrewm:</p>
        <p>Chrlstmu Open House. Sunday, November 29, SiOO^iOO or 7;00-9:00. "Come and SH lust how pretty Christmas san bel" Tour of home and Itoro, prIzM. refreshments and more. Call 7984)190 for tiwre Intormatlon.</p>
        <p>002</p>
        <p>ptrsoMis</p>
        <p>fllANKitMYtStOMERi Especially your patience. Judy, East Carolina Lincoln AAercury.</p>
        <p>TIME TO OOCORATE your Chrlstmu tru? Let Us tMpI Friendly, creative, dependable service. Call Plantation Flowers at 7580191, ask tor Rhonda.</p>
        <p>007 Special Notices</p>
        <p>SX^fSlR^ecSMto</p>
        <p>eff-road cars and trucks, 1/tO and 1/13. Falkland Spelway and Spaed Shop. 752-4331.</p>
        <p>ELECTROLVsiS by arbara Venters. 19 years experience.</p>
        <p>Call 8300942 for fru consultation.</p>
        <p>ORDER YOUR PUMPKIN ICE CREAM PIE for your Thanks giving Day celebration today at Hanks Homemade Ice Cream, 321 E 10th Street (next to dy's) 758-0000.</p>
        <p>WE PAY CASH for diamonds. Floyd G. Robinson Jewelers, 407 Evans AAall, Downtown Greenville.</p>
        <p>Oil Autos For Sale</p>
        <p>"A GOOD PLACE TO BUY!'' EASTGATEAAOTORSJNC</p>
        <p>130 East Greenville Blvd. Greenville, 355-3193</p>
        <p>INSURANCE It you have 5 to 12 points, we can save you lots of money. Call Leon Fornu In surance, 2408 South Charlu Boulevard, 355 7557 or 355-7373.</p>
        <p>YOU CAN SAVE money by shopping for bargains In the CImlftedAds.</p>
        <p>013</p>
        <p>Buick</p>
        <p>1979 BUICK REGAL Limited power steering, tilt, cruiu, air, AAA/FM stereo casutte, nice car. Call after 5,830-0242.</p>
        <p>1981 REGAL, power windows, tilt, cruiu, 55,000 actual mllu. Showroom condition. Priced to ull. 830-1142.</p>
        <p>014</p>
        <p>Cadillac</p>
        <p>1977 CADILLAC, loaded, .uns great, looks good. 754-8449.</p>
        <p>1982 SEDAN DEVILLE, loeded, alt new tiru, very good condl tion. S5250 or but offer. Call 752-1037 after 5:00 p.m.</p>
        <p>1984 CADILLAC SEVILLE sunroof, excellent condition. 754-4005.</p>
        <p>1984 FLEETWOOD Brougham, Commodore blue, blue velour. $15,990. Call Leew Pro 355 2788.</p>
        <p>015</p>
        <p>Chevrolet</p>
        <p>1949 CAMARO blue with white tiamu, 327, automatic, power steering. 830 0884.</p>
        <p>1981 CHEVETTE Good condl tion. $800 752-4541.</p>
        <p>1981 MONTE CARLO. $47,000 mites, V-8, tilt wheel. $2,500 or but offer . 355-3174.</p>
        <p>1983 CAVILIER 4 door, loaded, new tiru, one owner. Pay equity and auume $147 payments. Call AAary, days 754-4511, nights 754</p>
        <p>1997.</p>
        <p>ou</p>
        <p>Chrysler</p>
        <p>1984 HRYSLER 5th Avenue, excellent condition,,.J7,ODO actual mites. Call 744-2509.</p>
        <p>017</p>
        <p>Dodge</p>
        <p>1980 DODGE MIRADA $1500 ne gotlabte, good condition. 104,000 mllu. 754-2041.</p>
        <p>018</p>
        <p>Ford</p>
        <p>FORD ESCORT, 1901, asking $1395. Call 758-9527 or 792-4934. 1983 FORD ESCORT, 4 door 5 speed, AM/FM tape deck. But offer. 754-2749.</p>
        <p>1984 ESCORT 15,000 mllu, nothing down, assume loan. 754-9472.</p>
        <p>1987 ESCORT GL 4 door, hat chback, automatic, power stwr-Ing, air, AAA/FM stereo, white. 84950. Extended warranty. Call Leau Pro 355 2788.</p>
        <p>SELL YOUR USED TELEVISION the Claultled way. Call 753-4144.</p>
        <p>020 Mercury</p>
        <p>imMiCUR?^%ANDNE^ ulling becauu of terminal III-neu. Fully equipped, call 754-9457. Low interuf</p>
        <p>021</p>
        <p>Oldsmobile</p>
        <p>1979 OLDS CUTLASS, new tiru, power steering and brakn, good condition, reasonable price, $1200 or but offer. Call 7M 5422 after 5 p.m.</p>
        <p>1979 OLDS CUTLASS power steering, power braku, air con ditioning, new tiru, excellent condition. $3900.754 1339.</p>
        <p>1980 CUTLASS Spromete3,000 mites, good condition. Call 753-9457 after 4 p.m.</p>
        <p>Do it the easy way advertise in classified.</p>
        <p>Idhehi ChisWel NH8TS741N</p>
        <p>^*5ALAN^f^^o5tlc!</p>
        <p>4SJ)00 mites. Excellent condition. $2100. Call 1-728-7258.</p>
        <p>023 Pontiac</p>
        <p>19^TST^SKS^r9^f</p>
        <p>senger, would make a nice second car. (food condtlon. Call 8254)785.</p>
        <p>1978 BONNEVILLE leu than</p>
        <p>15,000 mllu on new motor, $1500.00.754-9142.</p>
        <p>1978 PONTIAC PHOENIX, 4-door. Call 754-2441.</p>
        <p>1979 TRANSAAi new paint, new tim. good shape inside and out. Call 752 3891 after 5:30 p.m.</p>
        <p>1981 GRAND PRIX LJ, $1700, 355^4490.</p>
        <p>1981 PONTIAC Bonneville top</p>
        <p>condition. $3500. Cell 355-7744.</p>
        <p>1983 PONTIAC Bonneville sta tionwagon-fully equipped, new tires, excellent condition. Retails for $5800, will ull for $4995.754^9371; 754 7887 nights.</p>
        <p>1984 FIERO, red, sunroof, AAA/ FM casutte, air, low mileage, excellent condition. $5,200. Call 752 8477.</p>
        <p>1984 GRAND PRIX, V8, loaded, 4OOO mites, new Michclin radiate, white/blue padded top, ^^t shape. 754-5875, ask tor</p>
        <p>1985 GRAND AM automatic, power windows, power door locks, cruise, tilt wheel, cassette/stereo, burdundy. $7750. Call Leau Pro 355 2788.</p>
        <p>1984 PONTIAC Parlsienne, $7,500. Call 355 2539.</p>
        <p>024 Foreign Cars</p>
        <p>VOL^</p>
        <p>10, 1985, sunroof, power windows, AAA/FM tape player, leather interior. 754-7174.</p>
        <p>1972 MERCEDES 230D, power steering and brakes, air, automatic, AAA/FM radio, $3400 negotiable. Call 758 1274.</p>
        <p>1974 .SUPER BEETLE, great condition, Plonur stereo In eluded, price negotiable. Call 754 2033.</p>
        <p>1978 TOYOTA Corolla sedan. Automatic, air, casutte, very low mileage. Excellent condition. $2000 752 4719.</p>
        <p>1979 BMW 738. Sunroot, automatic, air, 4 door, front and rear spoiler, low milage. Ex cellent condition. Negotiable, $7,400.792 2342 or 758-7540.</p>
        <p>1979 244DL White, volvo. New paint job, body and interior excellent condition. Needs some engine work. Take up payments. 975 4740 after 4pm.</p>
        <p>1980 PORSCHE 924 Turbo Red, air, excellent condition. $7,200. Call 754-7300 after 4.</p>
        <p>1988 VOLVO OLE. Excellent condition. Will ull whoteule $4400.753 4275.</p>
        <p>1983 BMW 528E gray, air, sun roof, casutte, 80,000 mllu, new tiru, excellent condition. $14,900 negotiable. 752-0598.</p>
        <p>1983 DATSUN 280ZX 2-f2, ex cellent condition. $4499. Call 747 8594 or 778-9313 after 7:00 and wukends.</p>
        <p>1985 BLACK NISAN 300ZX Tur bo 5 speed, digital dash, T tops, air, cruiu, AAA/FM Casufte, leather uats. 757 1234 work or 754-4535 home.</p>
        <p>1985 NISSAN AAAXIMA Wagon. Sand beige and brown metallic. Sunroof, automatic transmission. Extended warranty. $12,500. Call Leau Pro 355 2781.</p>
        <p>1985 NISSAN AAaxima wagon, fully loaded, low mileage, ex cellent condition, $il,50o. Call 7549247.</p>
        <p>1984 HONDA CIVIC Si. Red Hot Tamale! /(pllne stereo, low, low price. PiNU buy me. Senior. Call now 758-9693 or 752-8024.</p>
        <p>1904 NiSAN 300ZX T tops, AM/ FM cuutte, air conditioning and full power. Call 355 3573.</p>
        <p>1904 TERCEL TOYOTO, air. Stereo, like new, $5300. Call 355 7884,758 5544, William.</p>
        <p>1904 308ZX, loaded, must ull. AAake offer. Call 754 1417 after 5:00 p.m. _</p>
        <p>025 Classic &amp;amp; Special</p>
        <p>1940 DODGE, excellent condl tion. Slant 4.3-speed. $1399. Call 754 3879 after 4:00p.m.</p>
        <p>029</p>
        <p>Auto Parts A Service</p>
        <p>^RA</p>
        <p>!AZY JOE'S now has a thru year warranty on starters, alternators, water pumps, and etc. Call 752-1123.</p>
        <p>030 Bicycles For Sale</p>
        <p>BOY'S BMX BIKE, small mini bike and go-cart. Call 754-3821.</p>
        <p>HARO MASTER Freutyleblke Newly painted blue. Skyway mags, rur pegs. $115. 753 2060, ask tor Glenn.</p>
        <p>LATOR 10 Speed Schwinn blcy-cte. $200. Call Judy at 758 23M after 8pm.</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>032 Boats A Motors ABI^^f$lL^^S0</p>
        <p>trawlers and motor yachts. CAROLINA WIND, NC'S authorized dealer at AAcCotter's AAarlna, Washington. 944-4453. AVON, INFLATABLE dinghy, 2VI HP outboard. 25 pound CQR anchor. 754-2037, nights. EVINRUOE, OAAC, AAARINER and AAerCruiser service center; PLUS 1987 Evlnrude and AAarl ner motors and Cox trailers at clearancepricul B &amp;amp; K AAarine, 1205 Dickinson Avenue, Greenville. 752-3883.</p>
        <p>GhEENVILLE AAARINE ANDSPORTS Pitt County's oldut marine dMiership. We ull evuything at whoteule pricn year round. 244 Bypau N.E., Greenville 758 5938</p>
        <p>INSIDE WINTER Storage for boats, cars, campers, etc. AAonthly teasu available.</p>
        <p>Cannon's Warehouu.</p>
        <p>Call Ray (Cannon, 754-4125.</p>
        <p>JUST ARRIVED hunting and fishing canou. Pricu starting at 299. Carolina AAarinu, Hwy 244 Wut, Washington, 975-3494.</p>
        <p>ROSS fiberglass speclaliz ing in all typu of fiberglass and boat repair, 744-4433.</p>
        <p>SERVICE TO ALL Outboard Motors. O.'MC Authorized Dealer, long galvanized trailers. Billy's AAarine and Repair, 355 2793.</p>
        <p>15' THUNOERBIRO 85</p>
        <p>Evlnrude, Cox trailer. All in ex cellent condition Good fish or ski boat. 752 7407.</p>
        <p>31' VENTURE with 4.5 AAercury outboard and trailer. Swing kul, 3 uils, cuddy cabin. $4000. Call 754-4721 afterop.m._</p>
        <p>034Camping Equipment</p>
        <p>MUST SELL THIS WEEKEND Spartan 19H, 3T Travel trailer. Fully ulf-contained, sleeps six. full bath, private rear bedroom, front kitcnen, factory air, roll out awning, TV antenna, glass patio door, washer/dryer. Never used. Cut over $18,600 must sacrafice, $13,500 or but offer Call 7541115 Ext 111.</p>
        <p>PROWLER (O', full bath, sleeps six, air conditioning, awning, 40 gallon holding tank. 744-4433.</p>
        <p>1984 JAYCO DOVE, pop up, steeps 4. Asking $3400 firm Call Ibeforel:!</p>
        <p>74441481</p>
        <p>:00 p.m.</p>
        <p>036 Cycles For Sale</p>
        <p>1984 125 ATC HONDA, very clean, good condition, $500 Call</p>
        <p>795 4834 nights.</p>
        <p>040 Jeeps A Vans</p>
        <p>1974 JEEP CJ7, V 8 automatic. New paint, tiru, top and many extras. Rare find tor $3900. (il</p>
        <p>757-3040._</p>
        <p>1982 GMC customized van, V8, automatic, air, power steer ing/braku, AAA/FM cassette, towing package, built in cooler, excellent condition. $7400. Call 758 1274.</p>
        <p>1983 JEEP CJ7. Very good con ditlon, 3 tops, fully loaded, limited addition. K800.744-3310.</p>
        <p>1984 JEEP Cheroku Chief, 4 whul drive, power steering and braku, tilt, air conditioning, automatic transmission, AAA/ FM stereo, good AApg, excellent condition interior and exterior. Priced to ull. Call 524 5207 or 524 4935.</p>
        <p>Ml</p>
        <p>Trucks</p>
        <p>FORD. 1983 with camper shell, can be seen at 710 Hooker Road. $2,900 negotiable. Call 754-5247.</p>
        <p>1944 FORD SNORTBED truck, needs work, price $450. Phone 355 5235 or 753 5784.</p>
        <p>1978 CHcVROLET pickup truck, 350 motor, excellent condition, $3,000.753-2315.</p>
        <p>1979 FORD RANGER pick up Extra dun, $2500.752-4541.</p>
        <p>198) CHEVROLET CUSTM Deluxe. 43,000 mites, good condition. $3,800.355 5358 after 4p.m.</p>
        <p>1983 K5 BLAZER Silverado $8,100.758 4215.</p>
        <p>1984 ISUZU LS long bed, air conditioning, power steering, power braku, camper shell, loaded. $3995 758 7458 or 758 2591.</p>
        <p>1985 GMC JIAAMY 4x4, Red/</p>
        <p>silver, new tiru, AAA/FM stereo casutte, power braku, power steering, tilt whul, air, cruiu control, tinted glass, 34,500 mllu. Excellent condition. $9500 or take over payments. Call Rhonda at 7584)191.</p>
        <p>1985 TOYOTA 4 whul drive, 39,000 miles, air, AM/FM casutte. Call Chris 355 2058 or 944-9141.</p>
        <p>1984 CHEVY BLAZER S 10, 4x4, Tahu package, loaded. Call 754 2441.</p>
        <p>1987 FORD Ranger excellent condition. 5 speed overdrive transmission, power steering/ braku, cruiu, air, AAA/FM cassette, sliding rur window. Take over payments of $233 per month. Call anytime 758 5507, nights 758 5430</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>CAN I SOLVE MY CREDIT PROBLEMS?</p>
        <p>WITHOUT</p>
        <p>INVESTIGATION OR CREDIT CHECK?!</p>
        <p>YES! Even if you have declared bankruptcy, just moved, are divorced, have poor credit, or no credit at all! Now there IS an easy solution to your problems. No tricks or gimmicks. Simple and 100% legal. You can have your credit repaired in weeks! Also you can obtain a VISA or MASTER-CARO...regardless of your current income. I 100% GUARANTEE ITil For more information call Credit Repair Service.</p>
        <p>758-9965</p>
        <p>STAFF DEVELOPMENT COORDINATOR</p>
        <p>Heritage Hospital has a full-time position available for a Registered Nurse to coordinate staff devlop-ment programs. BSN preferred Responsibilities include nursing orientation and continuing education. Some knowledge of Infection control helpful.</p>
        <p>Applicant must be self-motivated, creative Individual who enjoys working with people In a teaching atmosphere. Candidate must possess above average communication and organizational skills and must be able to plan, organize and carry out various staff development projects.</p>
        <p>I^rltage Hospital Is an employeeKiwned taclllty which offers Its employees superior company-paid retlremant benefits plus competttWf wages, den|al, medical, and Ufa Insurance, educelion tuition retm-burseihent and much morel</p>
        <p>SutiinH rGBumG to: PtrtoniMl DtpartniGnt HGrttagt HotpittI 111 Hospital DrIvG Tarboro, N.C. 27886 EEO/AF Employer M/F</p>
        <p>WANfio!"Honest, pteasaift! and dspendabte Individual to care tor newborn Infant In our home beginning February 1. Full-time position with opportunity for long term omptoyment. Cafl355^atter4p.m.</p>
        <p>WE HAVE A WONORFL lady keeping our 1) month old in our home, Camelot, Cherry Oaks area. Seeking Christian family to provide companion chiid and share child care expenses. Call 754-3053.</p>
        <p>wbLD ukE kli? Childran In my honw duriiM the day. Lots of references ano^roa-sonabte rates. Call anytime ttO-0483.</p>
        <p>WOULD LIKE TO kOM children In my hoihe near Galloway's Crossroads. Cali 754-479). WOULD LIKE TO babysit in irw home on Hook Road. Call 3U-2340.</p>
        <p>WHY STOkE THINGS you never use? Sell them for cash with a Classified Ad.</p>
        <p>050</p>
        <p>Pets</p>
        <p>AKC BLACK CHOW, mate, 19 months old. $300. Call Griffon, 1 534 3315.</p>
        <p>AKC CHCOLATE labs for sate. Ready now. Call 754^9041 AKC GERMAN SHEPHAIRD</p>
        <p>Puppies, Direct (&amp;gt;erman line. $300.244-28)3, Vanceboro.</p>
        <p>AKC GOLDEN Retreiver pup^ pics. Excellent bloodline, own sire and dam. Prices ranging from $100 to $150. Ready to go. Call 758 5018 after 4 pm.</p>
        <p>AKC REOISTEAED red</p>
        <p>miniature dachshund puppies. AAate/femate. 744^7 after 7</p>
        <p>p.m.</p>
        <p>CFA PERSIAN-HYBRID kittens. Will hold for Christmas. Call 754-4374.</p>
        <p>CHRISTMAS PUPFiS AKC</p>
        <p>Labrador, 355-3934. Ait three colors available.</p>
        <p>CHRISTMAS PUPPIES AKC Golden Retrievers, ready Dec. 1. Call 758 0784.</p>
        <p>DACHSHUND AND CHIHUAHUA piqiptes mixed. $25.754^5403.</p>
        <p>FREE KITTEN to a gray and white</p>
        <p>with litter box, toys. 7567350</p>
        <p>home.</p>
        <p>Comes</p>
        <p>LOIS'S Tampered pets.</p>
        <p>Small dog grooming, $13.00. Call 355 5754.</p>
        <p>TWO LABRADOR Retreivers</p>
        <p>black, AKC, shots. $35 Call after 4,752 3584.</p>
        <p>2 YOUNG FERRETS and large outdoor cage, $75. Call Dave, 8304)781 before 3pm.</p>
        <p>058</p>
        <p>Help Wanted Clerical</p>
        <p>BOOKK E E PE R/Accountant wanted for temporary postlon, full or part-time . Send resume to Bookkoep 17142, PO Box 1947, Greenville, NC 27835.</p>
        <p>CLERK IN GRIFTON. $5.00 p hour. Atlantic Personnel, 3-7931.</p>
        <p>Full chaOge Okkep</p>
        <p>ER needed. Excellent working conditions. $13,500-$14,000. Fee negotiable. Call Esther 758-0541 Snelllngand Snelling Personnel.</p>
        <p>LEGAL SECRETARY:</p>
        <p>Motivated, hardworking Individual. Send resume and waao requirements to: Attorney, PO Box 8523, Greenville, NC 27835.</p>
        <p>SECRETARY OR Paralegal needed for established law firm. Must be ambitious, hard working individual. Some light book keeping. Legal or Rpal Estate experience a plus. Forward resume and salary requirements to: Attorney, PO Drawer 445, Greenville, N&amp;lt;: 27834.</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>51 Help Wanted Clerical</p>
        <p>In Eastern NC more people team up with</p>
        <p>ANNE'S</p>
        <p>TEMPORARIES</p>
        <p>Thafs rlght...more businesses and Industry across Eastern NC depend on Anne's Temporaries for dependable personnel. Thafs why we need you. We have Immediate openings tor a wide range of clerical positions Must have typing and secretar! al skills. You'll earn top benefits as part of the Anne's team.</p>
        <p>Vacation A Holiday Pay</p>
        <p>Health A Life Insurance word Processing Training Variety of Jobs</p>
        <p>Beapartofthe Anne's team Call Anne's today I</p>
        <p>ANNE'S</p>
        <p>TEMPORARIES</p>
        <p>7.Mra</p>
        <p>Flowers Office Complex 1410 S. Evans Street (Use Evans Street Entrance)</p>
        <p>EOE M/F/H</p>
        <p>8CREtARY General office duNes plus word processing he^l. Excellent benefits. $il 8)3,000. Call Esther 7580541 Snelltng and Snelling Psonnel</p>
        <p>a DESK CLERK positions avail able, one for 5 days a week, 5-10 p.m. One for 3 days a week, 1)</p>
        <p>p.m.-7 a.m shift. Call 754 1115, ask for Pete.</p>
        <p>PUT EXECUTIVE secretarial skills to work. Learn (3reervilte market and earn bonuses Call Manpower, 757-3900</p>
        <p>RECEPTIONIST, Typing, light bookkaaping with a goM tele phone voice could land you in this position. One half fee paid. Call Esther, 7580541 Snelling A Snelling Personnel Service.</p>
        <p>Secretaries</p>
        <p>Earn tw pay working for tha leader in temporary help.</p>
        <p>FREE Word Processing Training</p>
        <p>Our temporary employees are confident because we test them and match auignments to their skills</p>
        <p>CALL TODAY</p>
        <p>KELLY</p>
        <p>SERVICES</p>
        <p>The Kelly Girl People</p>
        <p>204 E Arlington Boulevard Arlington Centre Greenville, NC 27834</p>
        <p>355-7850</p>
        <p>Not an agency Never a fee EOE M/F/H</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>MOVINGII MUST SELLli</p>
        <p>ALMOST-NEW FURNITURE AND APPLIANCES AT LOW-LOW PRICES!!</p>
        <p>WASHER/DRYER. LIVING ROOM SET. DINETTE, DOUBLE BED WITH FRAME AND DECORS...</p>
        <p>CALL: 355-5829</p>
        <p>NICHOLS LIVESTOCK MARKET. INC.</p>
        <p>Robert 0. Martin, Jr., Ownar-Optrator</p>
        <p>Bondad Livastock Daalar</p>
        <p>Buying sows, boars, and barbecue pigs. Top prices for quality hogs. No commission charges.</p>
        <p>Locatad:</p>
        <p>Highway 903,</p>
        <p>Snow Hill</p>
        <p>Opan Wadnasday Only 7:00 a.m.-1:00 p.m.</p>
        <p>Sphrays Gomar Hog Market Opan Monday-Friday 7:00 a.m. &amp;lt;12:00 Noon Call 567-2586</p>
        <p>HEAD NURSEIR</p>
        <p>Lanior Memorial Hospital is currantly sasking a Haad Nurst for tho Einorgoncy Oopartmont Must ba lioonaad to practico as an RN In tha stato of N.C. and must hava at laaat 2 ysara axparianca as a staff nuraa. Should poastss a BSN or bo acthto-ly working towards BSN. Succassful applicant should havo compatanca In laadarahip, affacthro communication, problom-aolvino, doclsion-maklng and counsaling. Wa offar a compatithfo salary and comprahonsiva banafits packaga.</p>
        <p>Contact:</p>
        <p>Lynn Wallaca Employmant Coordinator Lonoir Momorlal Hospital P.O. Drawar 1678 Kinston, NC 28501 or call 919-522-7385</p>
        <p>OUR RESUMES MAKE A DIFFERENCE</p>
        <p>Get a competitive edge In today's tough job market by having a clean profeBslonal-looking resume by AccuCopy. Our resume packages let you choose between photo typesetting, laser printing or basic typewriter originals.</p>
        <p>In addition, we offer the widest range of paper and envelope choices in the area.</p>
        <p>FAST copies FOR FAST THSeS</p>
        <p>24-hour santica availabla Opan early, open late Open six days a weak</p>
        <p>ACCU-^</p>
        <p>fflcgpv</p>
        <p>rm AC8UMC FffOFlf</p>
        <p>758-2400</p>
        <p>Next to Chicos In the Qeorgatown Shops</p>
        <p>059</p>
        <p>Help Wanted Medical</p>
        <p>wanted to-practice. Energetic, friendly person who ifoys working witn people. Be a pnn of our c.aring dental team, Mfxt resume in eluding references to P.O Box 4184. Greenville, NC 37834</p>
        <p>ATTENTION ftlh S LFffo EiT citing benefifs package, day houn, no hothfoys or weekends. Bright, enthuilestlc, caring, conipetant nurses needed. Send resume or tetter ot interest to PWLC, Aftentton Ms. Rushton, 40M Brft Drive. Suite 101, Raleigh, NC 27409.</p>
        <p> 21TSX-</p>
        <p>Exceltent opportnWy tor glanced CiTiA. In JCAHae-credlted community hoepltat locatad Ite hours from Atlanttc Ocean. Abundant fisl^. hunting and water activities ImUy. Con^Hlve pay and banafits. Send detallad raeuma and salary requlrementeto:</p>
        <p>Personnal Oiractor, Chowan Hospital, POBoxm. Edenton.NC 37933.</p>
        <p>CERTIFIED Substance Abuse Counselor. Part-time for evenings and Saturdays OWI Assessments, group and indi vidual sessions. Salary negotia bte Call 355^3733.</p>
        <p>clInical social worker</p>
        <p>to work as tharapist/case man ager in chllW-ens outpatient program. Must have masters ree in a human svice field</p>
        <p>at least 2 years of clinical txperitnca. (food salary and benefits. EOE. Contact Personnel Department, Edgecombe Nash MH/MR/SAS, P.O. Box 4047, Rocky Mount, N.C., 27103.</p>
        <p>HWl PEJS TO SELL Re</p>
        <p>Reach</p>
        <p>icat</p>
        <p>DENTAL ASSISTANT/ HYGIENIST Needed full time Do you enjoy people? Are you interested in a challenging career position? Are you interosted in working for a dentist who recognizes talent and is willing to pay for It? We are searching tor an experienced professional dental assistant/hygtenist to become a part ot a dynamic growth oriented team. Please send resume to PO Box 1230. Winterville,NC 28590.</p>
        <p>RESPIRATORY THERA-PIST/TECHS-lmmediatc open Ings availabte tor registered A registry eligible therapists with a starting salary range of $23,300 $24,500. Positions arc also available for certified tocbnirians wHh a starting sala ry of S17,700-$19,500. Actual sal ary Is commansurafe with expe rtence. Scrtd resume A salary history to Personnel Director, Albermarte Hospital, PO Box 1507, Elizabeth^, NC 27909.</p>
        <p>SECRETARY/Receptionlst needed. Insfte computer experience helplul, word processing.</p>
        <p>accounts recoivabte axperience nscossary, Insuranco knowledge helpful. Pteasanf working environment. Reply to; PO Box 1004. Greenville, NC 27835-0004.</p>
        <p>CUSSlFtED DtSPLAY</p>
        <p>059 Hfp Wantad</p>
        <p>Medical</p>
        <p>DENTAL HYGlENiir 7Fu!I Time). If you are enthusiasMc, caring, and dependdbte, and en joy a chaltenga in a pattent cantered pracfice picase call 754AS71.</p>
        <p>CriilA (mmadlato spening. Be one of 4 CRNAt andTMOA in a ISO bed hospital in eastorn North Carolina. Located, aii the PamUco Riw which is part of the IntorcOastal waterway. You will have easy accasato all types of boating and wOtor spoiis. wa art 90 minufss from our baachss. Located iw a major university W4 perform allty^ of surgery except open heart and Nauro. Benefit package In cludsspaid vacation, sick leave; maforactice, madkal. Ate and dtaMlfty insurance AANA dues are paW annually. Satery based on 4) hour work week with caH every 4th nl^ and tvery 4lh weekend. Call or sand resume to: Mr Kenneth Ragtend, Ad mlntefrator, 919-975-4911 or 919 975-4331. Beaufort County HospI tal. 420 East 13th Street. Washington, NC 37189.</p>
        <p>OCCUPAtMwAL tHRAPISt wnted-licensad. To work with peopte with mantal ratdation in an ICF/MR community based program. Needs to be ah In-dspendent creative professional to work with ProComm in our Eastern NC region. Salary st ting in upp in's and excaltent benefits. Call Gail Horner at 781 3248 days or evenings f more intormatlon.</p>
        <p>PHYSICAL</p>
        <p>THERAPIST</p>
        <p>Home Health</p>
        <p>ALAMANCr HEALTH SERVICES, inc. is curreittty seeking a full tim PhyNcal Tharapin tor the Home Health Agency.</p>
        <p>Position will psrform a vMfy of administrative, managlal and technical duties In the mainlenance of a P.T. program. Honw Health axpertence Is pretened but will accept hospi fat P.T. experience. Newgraou-atos will te considerad ft you have clinical affUiafion with a home health department</p>
        <p>ALAMANCE is located in Burl togtan and is a short disfanot from several metropolitan towns such as (fosansboro. Cha pel Hill and Durham. We ottor a competitive NEW wage and benefit package and an on-slte day care facll^.</p>
        <p>For lurttwr Intormatian, i. contact or send your resume to:</p>
        <p>Human Resources Dipartmsnf</p>
        <p>ALAMANCE I^LTH SERVICES, INC.</p>
        <p>P.O. 80x3157 Burlington, N.C. 27215 (919) 229 1344</p>
        <p>EOE</p>
        <p>CLASSIFIED DISPUY</p>
        <p>LPNs/ORTs</p>
        <p>Lenoir Memorial Hospital is currently seeking: Licensed Practical Nurses: Full-time and part-time positions are currently aveilatite to work In the Medical unit. Must be licensed to practice in North Carolina.</p>
        <p>ORTs:</p>
        <p>2 full-time positions are available. Must hava completed a hospital approved surgicel technologist course. Previous experience preferred.</p>
        <p>Contact: Lynn Wallace Employment Coordinitor</p>
        <p>Lenoir Memorial Hoapital 100 Airport Road Kinston, N.C. 28501 or call (919) 522*7393</p>
        <p>CHOWAN NOSmAL^MC.</p>
        <p>P.O. IRX 19 E68RtaR, NC 27932</p>
        <p>(919)412-1451 fit. KM</p>
        <p>ICU NURSE * Immediate opening for a full time ICU Nurse. Registered nurse required. 12 hour shifts. Every other weekend off. Additional benefits.</p>
        <p>MTorMLT * Immediate opening. Part-time. Call. Includes all shifts. Possible fulltime.</p>
        <p>CRTT -Certified Respiratory Therapist Tech. Immediate opening for a fulltime CRTT. Call. Every other weekend off. Additional benefits. Welcome Qrads. For more information, contact Wanda Fletcher at Chowan Hospital.</p>
        <p>an equal opportunity employer...</p>
        <p>"Were Looking F(ht A</p>
        <p>FEW GOOD MEN</p>
        <p>We need sales people! And we're looking for a few good men and women to come into our sales force with the desire to earn some real money. It's not an impossible dream. Ford Motor Company is the Noj|f2 sales leader in domestic car sales and we want you to be a part of that drive.</p>
        <p>If you are interested in being associated with our local dealership, we urge you to come in and talk with us about how your future can change for the better!</p>
        <p>If you desire an interview with us, please see Pete McCHung at Hastings Ford. We offer excellent benefits and we think it worth your while to come in and see us.</p>
        <p>HASTINGS FORD</p>
        <p>ComBf ot KWh StfBt nd 264 Bypaat E. |</p>
        <pb facs="00096780_0058" />
        <p>C-14 The Dally Reflector, Greenville, N.C. Sunday. November 22,1987</p>
        <p>059 Help Wanted Medical</p>
        <p>RADIOLOGY</p>
        <p>TECHNOLOGISTS</p>
        <p>alance county hospi-</p>
        <p>T^  CHvtolon  AlwMnce Halth Strvke*. Inc. locelad In Burling^ It currwitly twking</p>
        <p>Vt'kUUii</p>
        <p>FtexIWt tdweulM avallablt.</p>
        <p>ALAAAANCE oftors compttltiv* naw waM and banafilt with an on tlla day cari cantw. Sand ratuma or contact:</p>
        <p>Human Ratourcas Dapartmant</p>
        <p>ALAMANCE COUNTY HOSPITAL</p>
        <p>387 N. Graham-Hopadala Road Burlington, N.C. 27315</p>
        <p>EOE</p>
        <p>I TAMiN ^ARNt to work</p>
        <p>* ln^|tr^homa for amotlonally</p>
        <p>^ wltha4yaar(</p>
        <p>* of axparianca ) amotlonally</p>
        <p>I group homa for amotlonally ditfurtMd boyt. Rrafar somaona with a 4 yaar dagraa and 1 yaar t working with the</p>
        <p>-------------,  disturbad.  Good</p>
        <p>^ salary and banaflts. EOE. Con-s tact Pertonnal Dapartmant, S Edgacomba-Nath, MH/MR/  SAS, P.O. Box 4047, Rocky i, AAount,NC 27803.</p>
        <p> CLASSIFIED DISPLAY</p>
        <p>059</p>
        <p>Help Wanted Medical</p>
        <p>FAMILY NU*if P^actitlonor or Ptysiclan's Assistant for rural family practica. Expri-anca prafond bjjtnot required. Send resuma to PO Box 64, U Grange, NX. 28SS1.</p>
        <p>ULTRASONOGRAPHER</p>
        <p>ALAAAANCE COUNTY HOSPI-TAl^a division of Alamance Health Services it seeking an Ulfrasonographar. Position It full-time, four days per weak. Requires natlonai Ultraaound Registration or eligible.</p>
        <p>Wboffar competitive NEW wage and benefits package with onsite day care available. Send resumato:</p>
        <p>Human Resources Department</p>
        <p>ALAMANCE COUNTY HOSPITAL</p>
        <p>327N.Graham-HopedaleRoad Burlington, NC 27215</p>
        <p>EOE</p>
        <p>XRAY CERTifltD Dental Assistant. S years experience In four-handed dentistry, will be relocating to Greenville. Can furnish references and resumes. Please reply to CDA 6404 English Ivy Lane, Raleigh, NC 37415 or call after 8p.m. 844^.</p>
        <p>CUSSIFIED DISPLAY</p>
        <p>SHOP EQUIPMENT AND REAL ESTATE</p>
        <p>DATE: Saturday, November 28th 1(hOO AM</p>
        <p>LOCATION: 1303 Highway 301 South In Wilson, N.C. Lee's Auto Sales and Service</p>
        <p>OFFICE EQUIPMENT Desk Chairs</p>
        <p>Office Machine Shop Equipment Allen Diagnostic System III</p>
        <p>Walker Motor Jack Accu-Tum Brake Drum Machine</p>
        <p>Transmission Jack Bear Marquette Engine Analizer</p>
        <p>White Air Conditioner Service Machine Spin Balancer Motor Stans</p>
        <p>Several Lots Of Metal Shelving</p>
        <p>Nice Parts Room Shelving</p>
        <p>SHOP EQUmHENT Shop Benches Parts Washer Hunter Precision Wheel Alignment Machine Weaver 7,000 Lb. Car Uft</p>
        <p>Various Jack Stands Bubble Balancer Coats Air Flat Tire Changer Shop Fans</p>
        <p>Dotlinger AM 13-2 Air Compressor</p>
        <p>Ajax CP5 Air Compressor</p>
        <p>Air Jacks</p>
        <p>Many Salvage Parts Motors, Transmissions, Starters, Generators And Other Parts</p>
        <p>Clark Propane Forklift 2,000 Lbs.</p>
        <p>REAL ESTATE</p>
        <p>Large fenced in lot with building's. Building one has 7 bay garage, large parts ropm, 3 offlcas, large show room and upstairs storage. Building two has 3 bay shop for body work, long storage shelter. This proparty has lots of potential.</p>
        <p>TERMS: All equipment cash day of sale. Real estate 10%, balance at closing in 30 days.</p>
        <p>TERMS: All equipment cash day of sale. Real estate 10%, balance at closing In 30 days.</p>
        <p>NOT HSSPOMStBU FOR ACCIMHTS</p>
        <p>060 HtlpWantwl MisoMlaneous</p>
        <p>ftMOM* cxportofict pr#f#rnid. 74M774.</p>
        <p>A l^IYLI EXTRA money ..or a ietl Avon can make your aav--27*/. .</p>
        <p>igraw. Can 355-1 HP WkMALjab winning ratuma. iFand up. C.R. Writing Sarvloae,3M</p>
        <p>A ll/6KkiM0 LAbV naadt round trto rida from Bathal to Aydan. Excallant .opportunity for Dupont warkor-wHlMp pay gasblr74a774.</p>
        <p>AitW In raonvilia S&amp;lt;ya^ vdll to accopttng ipMicSlons Mondto-Tuotday, 3Ursprn for momlng/affomoonhoip</p>
        <p>AiliiTAHT MaMAOIR</p>
        <p>Tralnot. 40-t- hours woskly. Will Includs avonim (3&amp;lt;loslng) and</p>
        <p>hMo^ and rafsrancss. Full</p>
        <p>East Grsonvltla Boulavard.</p>
        <p>  Grsonvltla Boulavard.</p>
        <p>No ptana calls.</p>
        <p>WBAlLi AiUllft wanlad for auto parts warahousa. Tw^y-Saturday for 40 hours.</p>
        <p>-iTRi MAMAOIft-out-golng, organizad, abla fa monago and aam roipact from</p>
        <p>omplmfaot. Can follow poUdao and load othors toward a suc-cassful oparatian. Excallant banaflts and opportunitlos. 13K Incrsasos with provan offlcian-cy. Sand work hisfory and sfatamont of why you Mlava you would txcal at this lob to Growivilla Monagw, P.O. Box 1551. Wilson, NC 378.</p>
        <p>CAFtERlA''MAlA0* tralnoa. 818K-830K with tx-callont salary advancamant attar training. FEE PAID. Atlantic Parsomwl, 355-7t.</p>
        <p>CLASSIFIED DISPUY</p>
        <p>060</p>
        <p>HtlpWantMl</p>
        <p>MIscrHrimous</p>
        <p>APFLKAlIf now baina ac</p>
        <p>Mfnwa iQr HIT ivtMI vnginvif*</p>
        <p>ing tadmlclan. Must to high tdwol gradala or oquivalont. Excollont company banaflts, salanr commansurata with ax-partanca. Call 75P477D for moro HwpnvMtlon.</p>
        <p>ASSISTANT OPERATIONS MANAGER</p>
        <p>Clolhlng manufacturar saoks assistant managor for our dtotrtbutton csntsrVmis facility ryslvas all rawlmatsriala, cuts garmants, diatrlbufaa cut work n out lying planto as welt aa fInMiIng and ahlpplng all com-plafod garmanti. RaUMtima-HMca laqulrad. SaMPraauma Including rafarancaa and aalary raqulramanti to Mark J. Ullmar</p>
        <p>aiHamlty lndilrloa,.32l* Flah</p>
        <p>-</p>
        <p>,Wtot Columbia,</p>
        <p>AttllTAUrJiiNAdlir(t-umor loant. 814,700. Atlantic Paraonnil,3S5-7l.</p>
        <p>AiWIATt ftAHACTI</p>
        <p>ad tar ladltt tUAIOai4JOO. Call tod, 7S-M4ltawlllng and SnoHIng Par-sonnal Sarvlca.</p>
        <p>AUto BOBy poaWona avail abta; body man, palntar.  coirbinatlon. Call bolwaan 0:00 and 5:30,750-7540</p>
        <p>AV6M At MAAE Vaar Christmas wishes come true. Earn graat money and got your gUtaaTadliceunt.CallTlMMO.</p>
        <p>66V MFAil TtCTBiriAW</p>
        <p>wantad. Only the vary bast cur rantly ompioi^ body tachni dan nood to apply. If you qualify you can giva yowsalt a rmm b calling Tony Alvmaia. 754-011 i for appolntmonl.</p>
        <p>CLASSIFIED DISPUY</p>
        <p>REAL ESTATE AUCTION</p>
        <p>R.F.TUGWELLFARM</p>
        <p>134Acres</p>
        <p>Sat., November 28,1967 11:00 A.M. Foantain Township, RL 2, Farmville, N.C.</p>
        <p>DIRECTIONS: Frun Fountain, N.C., take Hwy. 2S8 for approx. 2 miles. Turn teft on RPR 1241 at Todd|y-Farm apprra. mites on right. Abo, farm b approx. 3% mites from Farmville.</p>
        <p>TRACT |i-6.7Acres. All cleared. Over 1,000 feet oi road frontage on RPR 1241. Has old tenant house. Farmville water line proposed for property. TRACT 12127.3Acres. Approx. $8.0 acres cleared. 69 acres of woodland; majoolty reseeded. Beautiful stand 9 year old pines. Approx. 382 feet of road frcmtage &amp;lt;m lu&amp;gt;R 1241. Farm has a large two-story farm house sitting in oak grove. Abo, teige two^tmy pack house.</p>
        <p>1987 Tobacco Allotment:</p>
        <p>5.83 acres 10,966 poui ASCS Farm Smial iil405 TERMS: 10% down. Balance in 30 days. Confirmation day of sate. Bids will not lie opoi.</p>
        <p>The Auction and Realty Co. reserves the right to offer Uw pnx^ and tobacco in separate Iracti, comunatkm thereof and/or as a whole. Announcements day of the sale take (xecedence over aqy printed matter.</p>
        <p>For Bsre informatioe call Joha Tbgwdl at 4404514.</p>
        <p>Auction: Ttw Sound That Sells</p>
        <p>Interest 1^ Inc</p>
        <p>ex </p>
        <p>First Union</p>
        <p>FHA</p>
        <p>1-Yr. A.R.M.</p>
        <p>Conv. 15-Yr.</p>
        <p>Conv. 30-Yr.</p>
        <p>3-Yr. A.R.M.</p>
        <p>18.5%</p>
        <p>pts.</p>
        <p>w.0%</p>
        <p>3.25 pts.</p>
        <p>7.625% 1.75 pts.</p>
        <p>10.% 1.75 pts.</p>
        <p>10.5% 1.25 pto.</p>
        <p>0.025% 2 pts.</p>
        <p>Great Century Mort$(age Co.</p>
        <p>FHA</p>
        <p>1-Yr. A.R.M.</p>
        <p>Conv. 15-Yr.</p>
        <p>Conv. 30-Yr.</p>
        <p>3-Yr. A.R.M.</p>
        <p>10.5% l. pt.</p>
        <p>8.125% 2.0 pts.</p>
        <p>10.325%</p>
        <p>Opts.</p>
        <p>10.5% 1.0 pt.</p>
        <p>0.75% 2.0 pts.</p>
        <p>RIHT</p>
        <p>FHA</p>
        <p>1-Yr. A.R.M.</p>
        <p>Conv. 15-Yr.</p>
        <p>Conv^ 30-Yr.</p>
        <p>3-Yr. A.R.M.</p>
        <p>10.5% .5 pts.</p>
        <p>7.75% 1.75 pts.</p>
        <p>16.5%  pts.</p>
        <p>10.5% .75 pts.</p>
        <p>N/A</p>
        <p>Data provided weekly by the lending institutions. For information regarding participation in this column, call 752-6166. For information on specific mortgage programs, call the lender. Information is current as of Thursday. Rates, points and programs cannot be guaranteed. Pri^ams are for owner-occupied unless specinea TTiis survey does not constitute an offering.</p>
        <p>Pin COUNTY MEMORIAL HOSPITAL, Inc.</p>
        <p>P.O. Box 6028 / Greenville / North Carolina / 27834</p>
        <p>Public Notice Auction</p>
        <p>Date:  December 4,1987</p>
        <p>Time:  10:00 A.M.</p>
        <p>Location: 2210 May Street, West End Circle Greenville, NC 27834 Beige Storage Building behind Mandarin Chinese Restaurant</p>
        <p>Pursuant to North Carolina GS 160A-270, Pitt County Mamorial HoapHal. Inc. will dispose of the following surplus aquipmant by public auction.</p>
        <p>Msdtcg^Egujgnwnt</p>
        <p>1 Meillhometer Scales AseoitmentoflVpoles ICr,</p>
        <p>6cs I'liulaledMugsSoz.</p>
        <p>Sc Uowls9o^</p>
        <p>1 cs Assorted Mugs and Bowls 1 cs Moduflex Manifold Set S Hospital Beds</p>
        <p>Curtains</p>
        <p>1 Dental Machine 10 Castle OR Lights Type L190 1 Dietary Food Steam Table 1 CeniriluflH 1 Roiaior</p>
        <p>1 ^'^,rkinllll^ AmylaseLiiiaseAnalyzsrColsmanOI 1 Platelet M xt.: Model 34f&amp;lt;</p>
        <p>Assorted Biood Pressure Cuff Transducers Componi Ills lor 8 x 10' Soundproof Room I Baby Swing</p>
        <p>90 Assorted Registers lor Heeling/Air</p>
        <p>Condllloiimg tor Suspended Ceilings 10' and 14" duct size lor 24" squeres</p>
        <p>PHI County Memorial Hospital expressly diuvowa any warranty ol tha Natad aquipmant ineludlna hn-pllud warranty of merchantability. All llama ara baing told **AS It, WHERf M*'. Fttt County Mmnorial Hospital, Inc. reserves the right to delete from thia Hat. Tarma and oondMona will ba annaunoad grior to sala Hem* will ba on display Dacambar 3.1M7 from 10:00 A.M. to S.-00 FJI. All biddara muat raeio* ter prior tD sale lima wiih nama, addrasa, and valid drivars lleanaa. tala oonduetad by Chadaa E. layo, NLA. ^3296. Tha PIM County Memorial HoapHal Board ol TruitMa raaawaa tha right to rafaei any and all utda. Call Dabbla Tattarton at (019) 581-4483 for any quaatlona.</p>
        <p>lAlrCofnpfMtor</p>
        <p>1 Dry Eraaa Board</p>
        <p>1 Mac Btaklitodloallon Carl</p>
        <p>5 Computar Prtntar SUnda</p>
        <p>1 LaktaldaUlllily Cart Mortal 323</p>
        <p>ICMktoard</p>
        <p>1 KnlfaSharpanar</p>
        <p>9 Floor CMr Mata</p>
        <p>5VaccumPumpa</p>
        <p>ICardFHaCaMnal</p>
        <p>IHoMtaflTank</p>
        <p>lODtaka</p>
        <p>40 Pampan Aaaortad Siza</p>
        <p>90Tmahcana</p>
        <p>ecsim-OvaHXahaa</p>
        <p>1 Tabtalop Mtlal DMdar Rack</p>
        <p>IMatalRlngSMMt</p>
        <p>4FltaCablntla</p>
        <p>2Wira Carta</p>
        <p>FMNIonadWorkSpaoaa</p>
        <p>1 Exareyota Aulorrwllc Exarclaar</p>
        <p>MataiaMvIng</p>
        <p>2TrMMlinlUMacNnaa</p>
        <p>WoodCaMMa</p>
        <p>lOWhaalctoIrt</p>
        <p>3MalalKardaxCabinala</p>
        <p>gggflyira</p>
        <p>IMtWFItaDraiMr</p>
        <p>ISImptaxTlawClook</p>
        <p>SOCtialra</p>
        <p>7 Maial TaMa Top Wlra BaaktU</p>
        <p>29Tabtat</p>
        <p>iSCaloiilatora</p>
        <p>lABDlok Copar Modal 879 1Tataplwrw8IMlibod</p>
        <p>1 LantarTalk-A4&amp;gt;horw</p>
        <p>SIcaMacMnaa</p>
        <p>2Solaa</p>
        <p>IPtaalic SMI Unit</p>
        <p>1 Waatlnghouss Tatalypa</p>
        <p>1 Sony Vktarxiaaaalta Rarxxtor</p>
        <p>3 Etactric Typawrlter*</p>
        <p>Impiidiat 1 Hour Prior to Sata</p>
        <p>lTatalypaMod0l43'</p>
        <p>Tarara: CailiorQoodClwok</p>
        <p>60</p>
        <p>HatpWanlwl</p>
        <p>Miocaiiamom</p>
        <p>AIFIHTII HILFIKi</p>
        <p>Needed; must have own transportation. 744-343* loavo</p>
        <p>SvV^'tMitiVILLl-</p>
        <p>Tetacommunkeler. Position porferms routino and emergancy dispatching duties tar the City of Gnwnvllto. Somo oxporionoo as a talophont opor-ator. dlspatchar, or similar work which would pravtdo the ability to ipaak claarly and m-dealy In communicating within a 3way radio and wephono systam. High school diploma or oipilvalont required; emergency communications txporloncs proftrrod. Starting salary 113,*7740. Andy by Monday, Novombar 30, at Ito Psrsonnol Dwamant, City of Grsonvlllo, POBm 7307, 201 W. 5th Strsot, GrMnvillo,NC37S35-7207. EOE/AAM/F/H.</p>
        <p>CLkK/UHIER. 20-30 hours wMkly. Evtning and woskand shifts. Maturity and good work</p>
        <p>Grsanvlllo Boultvard. No phono</p>
        <p>calls.</p>
        <p>BaavisiiiHTiTSirtoip FApply at Blount PtT rotaum, 415 WMt 14lh Streot, bo-</p>
        <p>-3 pm. only. No phono calls. COUNTER ATTENOAHYs</p>
        <p>nsadsd for dry cloanors. Full or p^ timo. Apply In parson, 807 bicktnaon Avsnuo.</p>
        <p>bAV tAkt wkKks. th':</p>
        <p>ticPrsonnsl,3SS-7rai. kAkkPT6lS80xtra;i^ for Christmas. Takes only 10 minutas. Call Jasse at 7544f*4 batwaan 461pm on Fridays.</p>
        <p>FL6KAL DIONR. Atlantic F*rsonntl,3S5-7ni. #lHLNk' kAPHk k-TIST. Exparlancad In logo dasign, brochuras, latterhaad, knowladga of dosk top pubUshing software a plus, no-0105 or 32500 after fp:m.</p>
        <p>Fuu Time ocial work</p>
        <p>Position avallablo and ICF-MR Fadlltias. Exprtanos In working with multl-handlcapped prefsrred, but not required. Applicants must hava a Bactolor Dagrea In Social Work from an accrodttad coltaga or university. Forward rasuma to Blllit Franks, Howell's Child Care Center. INC., PO Box 315*, Now</p>
        <p>BOT.NC3l5n._</p>
        <p>4IT PAID lor leading booksi 1100.00 pw mia. Write: ACE-17*0, 141 S. Lincolnway. N. Aurora. IL 40542</p>
        <p>me PkibAY for Interior Doooratar Shop. Varies office duties and daslMlng sxpartance hal^l. Call 7a-mt for an ap-gommmt batween * 6 5. ask for</p>
        <p>iffiL&amp;gt;WAlltkO;moatcuttar. oxportanco holpful. full-tlmo. Apply In porson. Mon-day-Thursday baiwasn 2-4 p.m. No phono calls ptasse. GoMsn Corral 10* East Grssnvllta Blvd.</p>
        <p>CLASSIFIED DISPUY</p>
        <p>060 Help Wanted Miscellaneous</p>
        <p>indiistrl-</p>
        <p>al and Etactric Supply saoking collagt grad tor credit management pocltlon In Greenville area. On |ob tralnl ratuma to Credit Q Po Bex F-5, Florence iXPikllNtkb AlAl door Instaltar noodod, pay nago-tlabta. Call Graenvilta Ovariwad Door at 753-3574,0:00-5:00.</p>
        <p>training. Sand Oapanmont, ictSTC. 2*502.</p>
        <p>IkTkA ikik for hrlstmi with Avon. Ito to 50% oamhrn. For more Information call Eva Kaamay at 750-3071.</p>
        <p>B5hRh55l</p>
        <p>SENIORS</p>
        <p>GUARANTEEDJOB UPONORAOUATIONI Start your future with well paid training In your choice of 40dtf-teront lota. Excollont bonoflts and world travol. Mechantes, compulert and aviation are our ipoclallttat. Call 1-000442-7331/ 741Voroutthta NC 1-800-5214713.</p>
        <p>CUSSIFIED DISPUY</p>
        <p>060 Help Wanted, Misctlianeous</p>
        <p>mFWSSfwsnssnss</p>
        <p>sarvloe company Is sasklng to fill stveral positions In Ito Rocky Mount area. Positions to to fUtad are tor nunagors and asalstant managars tor multl-phast cataterlac In local industrial plants. Salary comman-surate with qualifications; full bsnsflts packagt avallablo. If Intarestad sand resume with salary rangas to; Applicant, PO Box 2101, Rockynitaunt, NC 37801.</p>
        <p>LllkiED HAIR bresstr</p>
        <p>*  ilr  De-</p>
        <p>Apply</p>
        <p>wanted at Oaorga's Hair De-slgntrs, Tha'Plaza</p>
        <p>Tuasday-Frlday. 10-5:30 l6AL dPFtik of intoma-tlonal modallM agsncy sseks naw facaa. ProfaMlonal or Mnnor, vt could to looking tar jmul Training available. *1*-734-3*25.</p>
        <p>CUSSIFIED DISPUY</p>
        <p>REGISTERED</p>
        <p>NURSES</p>
        <p>Positions available in the EMER* QENCY ROOM and INTENSIVE CORONARY CARE UNIT. Explore our working environment where independence, decision making and professional autonomy are valued and financially rewarded.</p>
        <p> Paid differentials for CEN,</p>
        <p>CORN, MICN, BTLS, ACLS</p>
        <p> Revised shift and week-end differentials</p>
        <p> Part-time benefits</p>
        <p> Educational assistance</p>
        <p>Full-time and FLEXIPOOL positions available. Flexible orientation and scheduling. Contact:</p>
        <p>Esther J. Moss, RN, BSN Director, Nursing Services</p>
        <p>Gommunity Ho^Aal</p>
        <p>OF ROCKY MOUNT</p>
        <p>AbUtlMr  ADstaMimt AlCZTaM</p>
        <p>(919)443 9101 EOE</p>
        <p>* V .</p>
        <p>060 Help Wanted Mifcellaneous</p>
        <p>060 Help Wanted Miscetlaneous</p>
        <p>CtNI AlifjiALSr Part-tlma taniMl toto naadad. Apply In paraon at Tanllr Strati Animal Hoipltal, Tuaaday and Thursday, ^4p.m.</p>
        <p>iiiiIlAkeo AbJutYR. OMrae naadad with orne out-MeMtasexperlenceor building or bo^ shop background. *18-t22K. Call Tad, 758-S4I Snelling A Snelling Personnel. liTPlNAflONAL STUDNT exchange organization seeks mature Individual to find and supwvlse homes for high school exchange students, ^od sup-ptamanTal Income. 912-432-0742.</p>
        <p>(mainteiIance person naadad for apartmant comptax. Mult to knowtadoaabta In all</p>
        <p>araas ot HVAC, plumbing, and gantral malntananct rapalrs. Must to dapmdabta. Possible housing provded. Qualiftad and Intarastad persons apply to Malntananca Parson, 10789, PO Box 1*17. Greanvllta, NC 27835.</p>
        <p>ReYaiL MANAGER Trainee Sortje Mils background will qualliy to learn full store operation. OeMlts included. l12,(Xto 115,00^ Call Tad 7584541 Snelling and Sneliing Personnel.</p>
        <p>MIoical YECHNOLOOIST: Immadlate openltig two full tima poalttons. Call. Familiar with Instrumant malntonance. Additional banaflts. For more Information confect Francis Boling, Lab Manager,' or Dabbla</p>
        <p>Chowan Hospital, PO Box 429, Edanton, NC 27933.919-4^4451.</p>
        <p>ROIS, AMRICA'S largest Inventory company naeto ambitious man and women to take Inventory In the Greenville area. PtaaM call 787-0591 between 9 and 5, Monday Friday.</p>
        <p>CLASSIFIED DISPUY</p>
        <p>CLASSIFIED DISPUY</p>
        <p>E.l. du Pont de Nemours &amp;amp; Co., Inc. Kinston, North Carolina</p>
        <p>P)</p>
        <p>Producers of Dacron Polyester Fiber</p>
        <p>LOOKIKFOR A PART-TIME kB?</p>
        <p>DuPonts Kinston Plant neads part-time employees for ongoing work in manufacturing sections of tho plant.</p>
        <p>Four difforent work schedules include days, evenings and rotating shifts.</p>
        <p>Part-time Jobs avorage 20 hours per week. Pay is $5.20 par hour, and shift differential when applicable.</p>
        <p>Apply at your nearest Employment Security Commission office.</p>
        <p>Du Pont Company amployaas and employment applicants are subject to testing (or dmg use, including msftjuans.</p>
        <p>Equal Opportunity Employei</p>
        <p>Eftoto Auction of Personal Proparty &amp;amp; Equipment</p>
        <p>*AUaiON SALE'^</p>
        <p>Saturday, Nov. 28 </p>
        <p>10:00 a.m.</p>
        <p>Personal property and equipment of Estate of Howard Wavne Nobles (deceased)</p>
        <p>Deputy Sheriff, Pitt Co., Rt. 1, Winterville, N.C.</p>
        <p>Auction to be held at the Kiwanis Building/</p>
        <p>Winterville, N.C. State Road 1129.</p>
        <p>Directions: Pitt Co., NC Hwy. 11 at Winterville, N.C. Turn south-west off NC Hwy. 11, on state rd. 1129 at Roberts Const. Co. &amp;amp; Tropigas, Ve mile to Kiwanis BIdg.</p>
        <p> ABSOLUTE AUaiON</p>
        <p>PARTIAL LISTINO</p>
        <p>FURNITURE: 3 sofas, 2 recliners, 7(ptus) upholstered chairs, pine buffet &amp;amp; table &amp;amp; chairs, card table, sets, pictures &amp;amp; lamps, bric-brac of brass, china, linens  table cloths  napkins  blankets  towels, ect., cooking utensils  pots, pans, silverware &amp;amp; cutlery, glassware  china, several quality sets, large selection small kitchen appliances, 8(plus) sewing rockers, luggage  many tine pieces, 6 pc. king size oak bed room suite, 1 king waterbed with 6 drawer ped. base, 1 pr. western boots lOVa EE, 3 pr. officer dress shoes lOVa EE, 7 pc. contemporary dining room suite, light oak, 1 tine 10 gun cabinet, oak, 1 exercise &amp;amp; weight bench No. WB 3000  3 bed room suites (cherry-mahogany); end tables, coffee tables, cabinet with glass top, 1 tine fur cape (dark), 1-5 piece Hex-Table dinette, oak, lamps (floor &amp;amp; table) much more!</p>
        <p>APPLICANCES: 3 Singer sewing machines, (1 portable), Hoover upright vacuum cleaner, 1 Hoover upright vacuum cleaner, 1 Hoover Quick Broom, Fans (ceiling &amp;amp; oscillating). Heaters (oil &amp;amp; gas), 1 15' chest freezer (Kenmore), 1 29' upright 2 door freezer (Cold Spot), 1 GE microwave oven, 1 auto washer delux (Kenmore), 1 dryer (Kenmore), 6 vaporizers &amp;amp; air fresheners, 1 chain saw, 1 portable table top gas grill with tank, large selection hand tools, 1 John Deere No. 210 mower-tractor, much more!</p>
        <p>ELECTRONIC EQUIPMENT: 1 Zenith record changer, 1 Zenith stereo receiver, 1 Zenith stereo cassette deck, 1 Samsung VHS video cassette recorder, 1 Emerson VHS video cassette recorder, 1 satellite TV system, (a) Drake  ESR 240 receiver (b) antena MTI2800 A Positions (c) outside 10' Peraclip mesh, (d) Channel Master Video-Cipher II, 1 RCA excell 100 23" color TV console, 1 set stereo speakers, 1 Bearcat No. 5 scanner, 1 Bearcat 210 scanner, 1 Bearcat 300 scanner, 1 Pocketvision No. 21 Realistic TV set, 1 car scame  scan &amp;amp; fare, 1 JVC QLA 200 turntable, 1 super pong. Sears radio game set, 1 auto harp, 1 23" RCA color TV console, 7(plus) radios several types, 8(ptus) telephones several types, many, many more pieces!</p>
        <p>OFFICE FURNITURE: Desks, chairs, files &amp;amp; cabinets, typewriter, adding machine, 2 small office safes, several calculators, 1 Kory embossng machine type 8-10 disc, many midie max flash lites, mag flash life, many phones, P.B. &amp;amp; portable  much more.</p>
        <p>ANTIQUES: Old pcs., collectibles, many old quilts, 1 Chevelle mirror W/stand, 1 antique love seat, 2 rockers fine oak, very old, 1 porcelain china floral bouquet pc., many pc. collectibles bric-brac, mugs, decanters, bottles, 1 old cast iron kettle, 2 fine wing chairs, 2 fine old oval picture frames, 1 sewing cabinet cherry, 1 old oak Chifferobe, books, pictures, frames, 2 Victorian lamps, 2 old oak wash stands w/mirrors, 1 Victorian coffee table 8. end table vv/marble tops, 2 tine antique rockers upholstered, 1 tine Victorian sofa, red velvet, 1 tine Victorian chair, many, many more pcs.</p>
        <p>GUNS: 2 Winchester Mod. 100 308 Cal., 2.50 Cal. Black Powder (1 Thompson Center). 1 Remington Nylon 66 .22 Cal., 2 Ml Carbine. 1 Fox Savage Double Barrell 12 ga., 1 Remington 1100 Llght-20 ga., 1 Ruger No. 1 Single shot .270 Cal., 1.22 Single shot, 1 Beretta double barrel black powder shotgun, 71908 Mausers, 2 7.65 Cal. auto, 1.32 or 38 cal. revolver, 1 Ruger .22 Cal. single six, 1 Smith &amp;amp; Wesson Mod. 60 38 Special, 11ver Johnson Cadet mod. 55.1 Super Titan .380 auto, 1 Remington 1100 20 ga. barrell, large amount of ammo, tor all guns.</p>
        <p>VEHICLES: 1 1984 Chevrolet Caprice Classic, 4 door, 11981 Ford Courier pickup truck</p>
        <p>Many, Many Other Items Too Numberous To List!</p>
        <p>SPECIAL NOTE OF INTEREST</p>
        <p>Deputy Sheriff, H. Wayne Nobles, (Deceased) was widely known with many "Interests" locally as a businessman &amp;amp; farmer &amp;amp; law officer. You'll want to be on hand to attend &amp;amp; buy from this large selection of household furniture &amp;amp; appliances, collectibles, period &amp;amp; antique pcs., guns, electronic equipment, office furniture &amp;amp; vehicles. "Absolute Auction" the last bidder is the buyer.</p>
        <p>SALE INFORMATION</p>
        <p>Come early, all buyers-bidders, must register. Cash or good checks with ID. No refunds, "As Is, Where Is". Nothing held back, everything will be sold to the last bidder. Registration begins 8:30 a.m. Saturday, Auction site Kiwanis BIdg. Not responsible tor accidents.</p>
        <p>LOCAL INFORMATION - EXECUTOR First Citizens Bank &amp;amp; Trust Co.  Kinston/ N.C.</p>
        <p>SALE AND AUCTION CONDUCTED BY:</p>
        <p>COL. HERBERT W. PATE, AUCTIONEER</p>
        <p>Aucfiod Appraisal Service, N C Lie No 48?</p>
        <p>Rt 1, Box 23 Kinston N C</p>
        <p>527-5412 Kinston, N.C. or 726-8732 Morehead City</p>
        <p>FOR INFORMATION</p>
        <pb facs="00096780_0059" />
        <p>OM</p>
        <p>ItelpWailtwl</p>
        <p>MtectlIancoM</p>
        <p>ing Miary</p>
        <p>roSmfFrSi_______</p>
        <p>PMltlon Win In-Mlvt proMsIoiMl. btlltlM In</p>
        <p>rtwfM rO ffl# 0vV#IOpfn#ffn PT</p>
        <p>gronnn oi Canartt County. Tno succaatful applicant will bo mporalblo for auloting In short rango planning actlvltlos. Including roioning roquost, zoning ordlnanco InforoooMnt, tubdlvi-tlon rovlow, dovolopmont pro-|oct  monitoring, and ra^ praparatlon. Excollont vorbal and writtan skills aro assantlal. Applicant should have Bacnoior's dsgrao In planning, gaography or rolatod f Md. Wbrk oxparionca In local govommont and a familiarization of Cartorat County ara prafarrad, but not mandatory. Intarastod can-dldatas should apply to: Lynn Phillips, Planning OIractor, Cartorat Counfy, Courthousa Squara, Baaufort, NC 27l1-im. Application doadllna Oacambar 4, IW. Cartorat County Is an Equal Opportulnlty Employar.</p>
        <p>PkftiilVr'a'sTa'birshid salon In downtown araa soaking protaulonal stylist with or without cllontola. Call Linda at 7ia-742S batwoan 6:00 and 8:00 . p.m. Good banatlts and commission.</p>
        <p>mrmrcmsELSir</p>
        <p>Primarily Ihtorastod in those with human sarvlca background wishing to gain valuable experl-ance In tho field. No monetary compensation, however, room, utlllflas and phone provided. Call AAary Smith at .Me REAL CrIsU Cantor 7SB-4357.</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>00</p>
        <p>iSB</p>
        <p>ftUTI WWtto WKStb</p>
        <p>Ibr local daUMryrfriOtor trail-</p>
        <p>. . .. efiMiXlleaiiift.</p>
        <p> qiO^MW IWI IBi1flBflP|p F.Jw</p>
        <p>wa</p>
        <p>SMon^!</p>
        <p>wmi alac trical background for service and Installation of sound systems. Contact 1-000-346-8725.</p>
        <p>WlYTFiAitt MIBM6 at piftop t tnp Pdfii Ptppftnwrt.</p>
        <p>IVKiUNILTIMM.</p>
        <p>"If It's popla, wa'ra tho pros." Suita F,5flaArll Boulevard.</p>
        <p>2 Arlington .355^.</p>
        <p>r^nrosToSivfSs</p>
        <p>LOCAL FACILITY OETHOME EASIER Join a large happy family Profosslonal drlvers-run na-tlonwldo</p>
        <p>Competitive pay and benefits P&amp;lt;tCkftQ0</p>
        <p>Insurance, rotiremant, bonuses Credit Union affiliation</p>
        <p>Mlmimumage23</p>
        <p>2 years verifiable OTR expert-</p>
        <p>fOCt</p>
        <p>Good driving record</p>
        <p>Call Bill Holland collect at 918-864-9639</p>
        <p>Wingate Taylor /Maid Transportation</p>
        <p>A Burlington Northern Motor Carrier</p>
        <p>EOE</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>MEDICAL LABORATORY TECHNICIAN</p>
        <p>Needed for relief coverage at a State facility.</p>
        <p>Call 758-3151, ext. 242.</p>
        <p>BARTENDER WANTED</p>
        <p>5 Days a week, Monday-Friday.</p>
        <p>Apply at the front desk</p>
        <p>COMFORT INN 264 BY PASS</p>
        <p>1929 Model A Ford</p>
        <p>Exceilent condition. Restored Authentically for showing.</p>
        <p>Call 758-2877</p>
        <p>DM</p>
        <p>WaiitMl</p>
        <p>MREMPLOYEER</p>
        <p>CALL</p>
        <p>355-4636</p>
        <p>for screened lob-ready temporary employees who are anxious to work In light Industrial or clerical fobs. One phone call to</p>
        <p>PERSONNEL</p>
        <p>TEMPS</p>
        <p>Can ease your mind and givo you satisfaction with qualfflad heip.Thats</p>
        <p>355-4636</p>
        <p>PERSONNEL-</p>
        <p>TEMPS</p>
        <p>Arlington Contra, Suita F 202 Arlington Blvd.</p>
        <p>EoifoMlNEtLIVE IN with aderly lady. Call 746-3159 for furthor Information.</p>
        <p>MkT-TiM^ cMpYEft op-</p>
        <p>ERATOR for data entry. Knowledge of dBase III, multimate and/or Woodstar 2000. Flexible hours. 8304)105 or 355-2508 after 9p.m.</p>
        <p>AAA EMPLOYMENT</p>
        <p>KNOWS THE JOB MARKET AND WILL PLACE YOU INTHE CAREER OF YOUR CHOICE!</p>
        <p>SALES/NANAOER to 45K Local 'puts your career In</p>
        <p>hNANCE A INSURANCE to</p>
        <p>tition offers I status!</p>
        <p>_______________JNtol8KFee</p>
        <p>PaidI Commarcial andCADD background? Professional</p>
        <p>SECRETARY to 8325 up Fast paced medical office Is modem with wall known doctors. MANAGER TRAINEE8275-I-CollageGrad? Usedegreeto ctlmbtothotqpl ELECTRONICTECH Skills determine salary. Stimulating! RECEPTIONIS-r$160Am b!tlous7 Good personality! Train now!</p>
        <p>WAREHOUSE S160 Drive fork IIH? Lots of work!</p>
        <p>FRONT DESK Mature? Meet &amp;amp; great jpub!lc In baautlful sur I roufMnnotl MACHINE OPERATOR 86.00 up Manufacturing company will hire dapendabie parson.</p>
        <p>PARTS 8270 Dealership needs you now! Mora8's for axperlonca.</p>
        <p>DAY CARE Conne play with the children!</p>
        <p>SALES Large ticket Items sell self! You'lfraap the rewards! STOCK CLERkW up Employer WIN train! Parts KnowMogagivesedga! NURSES ART. Tondar care needed In private home.</p>
        <p>101 West^ Street Suite 203 758-1393 Low Foe Personnel Service</p>
        <p>CLASSIFIED DISPUY</p>
        <p>060</p>
        <p>Htip WantGd MscgUrimous</p>
        <p>PkSONAL AIDE tor handl-capped student In exchange for room and board. Only nwture Individuals should apply. Con-</p>
        <p>PH^t iLICitofti Needed for loul marketing firm. Even-</p>
        <p>fiYn EA84lNEks/Real Property. National Co. seeks ox^lenced Ntla examiners. Full A part-time, Indepandant contractors. Send resume PO Box 8173, Greenville, NC 27835.</p>
        <p>WAlTfeSSES wanted. Will train. Apply In person between 11-2 only. Waffle House, Green ville Boulevard.</p>
        <p>WAltilESSES EOE part tinw at night. Must be able to work weekends. Apply In person at Peppl's Pizza Den, 421 Graanvllle Boulevard.</p>
        <p>WAttb: XFklNCEO service station attendant and exporloncod cashier. AMly In person. Holiday ShellVni S. Memorial Drive, Graanvllle.</p>
        <p>wXfiHuit WkKki.</p>
        <p>83.50-84.00 per hour. Must have exceliant driving record, be able to lift heavy material, and operate a forklitt. Atlantic Personnel, 355-7931.</p>
        <p>WEsttkNilEtNnowaccep^ ting applications for daytime waitresses. Apply In person Mondoy-Frlday, 10-4,.</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>East Carolina Lincoln-Nercury</p>
        <p>congratulates</p>
        <p>Bill Brown</p>
        <p> %</p>
        <p>MFRCURY</p>
        <p>LINCOLN</p>
        <p>Salesman of the month for October!</p>
        <p>Please come see me for all your new or used car needs.</p>
        <p>C3MC</p>
        <p>MERKUR</p>
        <p>Bus. Phone: 756-4267  Home Phone: 355-5395</p>
        <p>West End Circle  Greenville, N.C.</p>
        <p>SUPER SPECIAI</p>
        <p>THIS WEEK^S SPECIALS</p>
        <p>. 1984 Honda Prelude</p>
        <p>Dark blue. 5 speed, sunroof............</p>
        <p>WAS</p>
        <p>NOW</p>
        <p>*5,295</p>
        <p>1983 Honda Accord</p>
        <p>Automatic, air.................................</p>
        <p>1983 Escort GL</p>
        <p>4 door, air, automatic....................*2,495</p>
        <p>1983 Buick Regal</p>
        <p>4 door, blue, local trade, bucket seats,</p>
        <p>vinyl top, nice family car.................*4,295</p>
        <p>1983 Chavrolat Cavalior</p>
        <p>Clean, local trade.......................*3,495</p>
        <p>1981 Chevrolet Camaro</p>
        <p>Charcoal Gray, Automatic, sporty car.</p>
        <p>1981 Toyota Craasida</p>
        <p>Automatic, sunroof, clean..........</p>
        <p>WE ARE THE FINANCING SPECIALISTS!</p>
        <p>BROWN &amp;amp; WOOD</p>
        <p>DOWNTOWN</p>
        <p>llOSDtakliimAw.</p>
        <p>752j</p>
        <p>MO HotoWlll Miscellaneous</p>
        <p>ANXIOUS TO WORK?</p>
        <p>Ws ar# currently hiring forll^t Industrial tomporary assignments in tna following areas:</p>
        <p>Assemblers Machine Operators</p>
        <p>204 E. Arlington Blvd. Arlington Cantro Offka&amp;gt;ark,Sto.E Gratnvllla.NC 27834</p>
        <p>3557850</p>
        <p>KELLY</p>
        <p>Services</p>
        <p>The Kelly Girl People</p>
        <p>Not an agency-Ntvar a fee</p>
        <p>Equal OpportoH^ Employer</p>
        <p>U.S. law roquirts all applicants to show proof of Wentlly and rIghftoworklntheU.S.</p>
        <p>CUSSIFIED DISPLAY</p>
        <p>060 Help Wanted Miscellaneous</p>
        <p>ANXIOUS TO WORK?</p>
        <p>We era curranfly hiring for light Industrial tomporary astlgnmanfs in tha following arass:</p>
        <p>Fork Lift Operators ^ Material Handlers</p>
        <p>204 E. Arlington Blvd. Arlington Contra Offica Park, Sto. E Greanvilla.NC 27834</p>
        <p>3557850</p>
        <p>KELLY</p>
        <p>Services</p>
        <p>The Kelly Girl People</p>
        <p>Not an agency-Navar a fea Equal Op^mj^ Employar</p>
        <p>U.S. law requires all apphcanfs to show proof of identity and right to work in the U.S.</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>EXECUTIVE DIRECTOR</p>
        <p>Pitt/Greenville Convention and Visitors Bureau is in need of a chief executive officer.</p>
        <p>Responsibilities, include: attracting conventions and meetings to Greenville and Pitt County; selecting, hiring, training and supervising staff; developing organizational policies and procedures; developing and implementing sales and marketing plans.</p>
        <p>Requirements: applicants should possess a bachelors degree in an appropriate field with a minimum of three years experience in the marketing and tourism industry. Good sales experience and a willingness to travel extensively are necessary.</p>
        <p>Compensation: salary range for the position is $32,000 to $38,000 plus life and health insurance and appropriate travel and meeting expenses.</p>
        <p>All resumes must be received by December 31, 1987. Send resume to: Rudolph Alexander, Chairman, Pitt/Greenville Convention and Visitors Authority, Mendenhall Student Center, East Carolina University, Greenville, NC 27858-4353.</p>
        <p>The Daily Reflector, Greenville, N.C.  Sunday, November22.1967  C-|5</p>
        <p>040 Help Wanted MIsctllaneous</p>
        <p>ROUTE SALES. Atlantic Fer wruwl, 355-7931.</p>
        <p>fhMAN NVENIENT STORES it now hiring Deli per ion tor (toy shift. Approximetoly 35 hn per week. Apply In person, Highway 33 West.</p>
        <p>SERVICIE TECHNICIAN. Elec tronic/mechanical background or aptitude. Atlantic Personnel,</p>
        <p>oraptlfi</p>
        <p>355^7931</p>
        <p>SPECIALTY STORE needs a Assistant Manager to run full wratlon. $11,^813,500. Call Twf 7504541 Snelling and Sntll-tng Personnel Service.</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>061</p>
        <p>Help Wanted Sales</p>
        <p>*],"Tio- licensed</p>
        <p>A^STATE AOENTS-One of Groenville's most aggressive Jeks lulTtlme, motivated, ambitious sales agwH. We provide extensive train ng proorams, excellent working conditions with a pro-fttilonAl atmosphere Lall CEMTURY 21 JAnIt BCWSER ANDASSOCIATES confldantlal interview, 355-7800.</p>
        <p>dfliCk-ACTlON- Classified Ads are the answer to passing on yow extras to someone who wants to buy.</p>
        <p>CLASSIFIED DISPUY</p>
        <p>061</p>
        <p>Help Wanted Sales</p>
        <p>while enhancing your lifMfyle. Excollont commission and in-cenfives. NC real ttfato Ikarna required. For more details, call Carolyn at Erwin Realty 355-7870.</p>
        <p>ADVRTISINO ACCOUNT rep.</p>
        <p>Excellenf earning potontlal. Atlantic Personnel, 357931,</p>
        <p>IF YOU'RE NOT USING your exercise equipment, sell If this intw in these columns. Call</p>
        <p>/52*d146.</p>
        <p>CUSSIFIED DISPUY</p>
        <p>ROUTE SALES TRAINEE</p>
        <p>Coca Cola of Greonvilie has a need for incHviduait who have the following:</p>
        <p>\</p>
        <p>Outgoing personality Good basic math akiila Clean peraonal and driving record Enjoy meeting people Enjoy outdoor/physical work</p>
        <p>Our growth orlonted company ia aeeking reaponaiblo, career/minded individala. Experience ia not neceaaary but a Claaa A or B chauffeur licenae and prior public contact work la a plua.</p>
        <p>We Offer.</p>
        <p>Excellent annual income potential Paid vacationa, hoiidaya, paraonal daya Company unHorm program Comprthanaive training program</p>
        <p>If you have the above qualHicationa, we will be accepting appHcetkma from 9:00 a.m.-4:00 p.m. Monday thru Friday.</p>
        <p>CoMhColo of Greenville</p>
        <p>264 By-Pass at Staton Road</p>
        <p>No phono calls please Equal Opportunity Employer</p>
        <p>No Cash? No Pioblem!</p>
        <p>Ybur Old Car OrTmckCan Be Ail The Down Payment Ybu Need!</p>
        <p>1988 Corolia Deluxe</p>
        <p>1988 GT-S Sport Coupe</p>
        <p>Justbecauseyoudonlhavealotofcashonhandis  Choose fnxn a huge selection of Toyotasiixlud^</p>
        <p>noreasonnottogetanewToyotaNotatToyotaEast,  the all-new Corolia Deluxe rriodels, affordable sedans arxJ</p>
        <p>anywav. Right now we make it easy for you to buy a brand  wagons with afresh, contemporary flavor. Orthedynamic</p>
        <p>new, 1988Toyotat Because now your old car or truck can  SR5 Sport Coupesfeaturing innovative yling, exciting</p>
        <p>beallthedownpaymentyouneed!  features arfo proven Corolla ecorxxny. And the GT-S Sport</p>
        <p>Its truewith approved credit you can buy any new,  Coupesexhilarating high performance cars with refined,</p>
        <p>1988 Toyola in slock and use your old car or truck for your  aerodynamic lines, first class features and a remarkably</p>
        <p>down payment!  affordable price!</p>
        <p>l^lrcelCoi^</p>
        <p>i159^4441!</p>
        <p>Iritroducing Toyola's lowest-price can the new, front-wheeklnve Tercel Coupefeaturing outstanding mileage, plenty of room and traditionai Toyota quality.</p>
        <p>60 morths iBim al 10.99% APR finandng and your old car valued at *2,000.</p>
        <p>Tax and tags are extra</p>
        <p>Take*500 Cash Back!</p>
        <p>And now you can really savewith ^500 cash back!  Hurry!  With prices this lowplus ^ cash back</p>
        <p>IfstiTjejuslbuyjBtfiyiwiaininanew1987Toyo&amp;lt;amodelin  our supply is going fast! Doni miss your chance to take</p>
        <p>slock. Redeem ttiis coupon and Toyota East will give you  advantage of great savings and selection now available at</p>
        <p>^SOOcashback!  To^lS^</p>
        <p>r</p>
        <p>I</p>
        <p>I</p>
        <p>I</p>
        <p>I</p>
        <p>I</p>
        <p>I</p>
        <p>I</p>
        <p>L</p>
        <p>&amp;lt;500</p>
        <p>Redeem this coupon for *500 cash to use toward your down payment or for an instant cash rebate when you buy any new 1987Toyota car, truck or van from stock at Toyota East</p>
        <p>Umit(xie rvxHiegoliabie 0CX4XX1 per retai ojslomer. Olto^ expires 11/30/87.</p>
        <p>1</p>
        <p>I</p>
        <p>I</p>
        <p>I</p>
        <p>I</p>
        <p>I</p>
        <p>I</p>
        <p>I</p>
        <p>J</p>
        <p>ShopHlbutiSWrtiit</p>
        <p>Weieopenevery weekday urtfl the last customer is served andSalurdays1il5! SatufdiySBivtoBc OurToyoia Service Depertmer4 is open Saturdays from 9am-1pm. Can now tor your quick service appoinlmert</p>
        <p>T0VD1ABST</p>
        <p>109Trade Street Greenville 756-3228Call UsTdl Free: 1 -800-682-5437</p>
        <p>tmsreslBd in driving the best? Ask us about Euro-leasing-leasing thebestforyou.</p>
        <pb facs="00096780_0060" />
        <p>0*16 Tti Dally Retlgclor. Oreenvllle. N.C. Sunday. November 22.1967</p>
        <p>11 ^ Halp Wanted ^ Salat</p>
        <p>Ml Halp Wanted Salas</p>
        <p>m u AiA ix tTnrs SPff^rtSutrtTtemv^E</p>
        <p>ffcJISJSSS.""</p>
        <p>b^er needed for naw and ax-foting home sales. Immadlafo opportunltlat-all naw offlcas-competlHva commluions. Naw construction offerings ara m^ foadMv. For confldm-" RIcttard Lane t Ball &amp;amp; Lana. 752-4025.</p>
        <p>gktlOl WduBE plus 1-3 &amp;gt;? MtdMl</p>
        <p>nr fortunq 200 company.</p>
        <p>MKibk liF ikiAANI</p>
        <p>eomwv Is leaking an Indlvldu-4l In tha Gmavnlllt aroa wfw has ho capacity and dMlra for a</p>
        <p>2*FUTfc SALES. Salary</p>
        <p>gpeommtalon. Atlantic Par-PMItL#SR-7f3l.</p>
        <p>our bisuranco and financial sar-vfoca. Profoulonal training and cfoxH at our expensa. Office nd sacratary supplied at com-PMy amanso. Handsoma financial package and fringa benafits. For a confidential Intarvlaw sand resume to: Parsonnal Oiractor 14478, PO Box 1347, Graanvllla.NC 27335.</p>
        <p>WWWMTlWAKSTe</p>
        <p>^Into 6r2jvffo,''kwk*g^ totot raga; Ba your own boa and</p>
        <p>&amp;gt;a"aiarg CBS'S</p>
        <p>'^CLASSIFIED DISPLAY</p>
        <p>CUSSIFIED DISPUY</p>
        <p>La</p>
        <p>GRADY WHITE BOATS</p>
        <p>Now accepting applications for our production openings. We are a quality oriented company looking for quality people to join our team. -Please apply at Grady-Whlte Monday-Frlday, 9:00*11:00 and 1:00-3:00.</p>
        <p>COLLEaORS</p>
        <p>Temporary collection positions available. Responsiblle for collecting medical accounts. Collection experience preferred.</p>
        <p>Day, evening, and Saturday hours available. Salary plus commission. Interested candidates should call 919-641-7700. Ask for Mrs. Ell-Ingwood.</p>
        <p>Ml</p>
        <p>Htip Wanted Sates</p>
        <p>kalT timc/FOll TiMI</p>
        <p>ulM. liKteMndmt salM con-irodor for Amorlcan Exprou Company covoring Groonvlllo aroa. Position Includts Miot, sorvloo and sotting up of account. E.O.E. Ropiy to Salas/ 7143, PO Box iwf, Groonvlllo, NC 27135.</p>
        <p>iFor</p>
        <p>STATE AGENTS wantad. For your confldontlal Inlorvlow, call Joan Hoppor at Unlvorslty Raalty, 35^5344. An Equal Opportunity Employor.</p>
        <p>Equal Opportunity Employor. RAL litY Salas Agont. At-</p>
        <p>trj^vo ^mlnlqn_ pack^</p>
        <p>wHh liK^vos. Call Tim Sml... at tfw Roal Estato Canter for oonfMsntlal Intorvlaw 3554444. AL ESTATE</p>
        <p> AGENT part</p>
        <p>timo or full time, one desk</p>
        <p>available. 3S542SB. glli RRtitMYAfiRs</p>
        <p>needed to work with expanding CaWe TV. Contractor, unlimited moorne potential, local or out of town work available. 754-5ls.</p>
        <p>ilAMLlATRkSHOPIsnow acoapting a|llcatlons for Sales Associates for the Christmas</p>
        <p>season, ^ly In person at 10 a.tn. on Tuuday, November 2A</p>
        <p>at Sears Leather Shop, Carolina EastAAall</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>WE REPAIR SCREENS &amp;amp; DOORS</p>
        <p>C.L. Lupton Co. 752-6116</p>
        <p>MAHHEWS SEPTIC TANK CO.</p>
        <p>NfW INSTA.LATIONS .REPAWS PUMPING 1 CLEANING PItl County Potmlt 1104 14 ysrt Etptrltnct</p>
        <p>PHONE 753-4097</p>
        <p>8 A M. To 9 P.M.</p>
        <p>ROOFING</p>
        <p>STORM WINDOWS DOORS &amp;amp; AWNINGS</p>
        <p>C.L. Lupton Co. 752-6116</p>
        <p>NURSES</p>
        <p>can^anjoy tha pere&amp;lt;^ advantages In working for a company that Is employeoownad. Harltsge HosptW, as a subsidiary of HealthTrust, Inc., offers Its employees a superb letiramant p^ramthTQu^the Employee Stock Ownership Pisn. As a Heritage employee, you are part owner of this progiMalvo, growing healthcare facility.  k  7  .yv  jwiowiwr</p>
        <p>Coma to work for yourself in one of the following areas:</p>
        <p>REGISTERED NURSES</p>
        <p>. Msdc^rgical area has vacancies for staff RNs with Med/Surg. experience andfor PedMric xp6nwncw,</p>
        <p>amad LW^oTan!^  '***  Boglnnlngt"</p>
        <p>- Emergency Rooin; Part-time positions available</p>
        <p>- Operating Room: Full-time positions available UCENSEO PRACTICAL NURSES</p>
        <p> MedlceUSurgical areas: Full-time positions vaTlble - QYN Aroa: FuU-ttr</p>
        <p>ill-ttme positions available</p>
        <p>WEEKEND SMFTS</p>
        <p>vcenclfo1ajT* and'uray*****</p>
        <p>*&amp;gt; P*u excallenl differentiala:</p>
        <p>- el. second snitt Oifforential  32.00 Third Shift Oifftranlial</p>
        <p>- 31.S0 Weekend Oifforential</p>
        <p>Above average base and differential pay also avallablo tor LPNe.</p>
        <p>Contact:</p>
        <p>Pam Otwans Paraonnai (919)641-7140 HERITAQE HOSPITAL</p>
        <p>111 Hospital Drive/Tarboro, NC 27886</p>
        <p>UTs 9o To USmUE, TOKSSEE ChrishaatToarSaeaaAarllLILIE, 13</p>
        <p> free Buffet Breakfast Fri., Sat., Sun. Mornings</p>
        <p> See The Lights Of Christmas At Twitty City</p>
        <p> Enjoy An Evening Dinner &amp;amp; Concert Starring Conway Twitty</p>
        <p> Tour Nashville Recording Studio's^ Stars Homes And Other Historic Sites.</p>
        <p> Have Lunch On The Belle Carol Riverboat</p>
        <p> Be A Guest On Crook &amp;amp; Chase TV Show For A Live TV Taping</p>
        <p> Tour Cheekwood-See The Trees Of Christmas Decorated To Represent Each Country.</p>
        <p> Opryland Hotel For Country Christmas Feast And Entertainment.</p>
        <p> The World Famous Grand 'Ole Opry</p>
        <p>2PopltToARoom  ..............S32Stach</p>
        <p>3 Popl To A Room......................S3IS ooch</p>
        <p>4 Poopio To A Room......................$295 oach</p>
        <p>MlLNIVnRIIFMMITIM-IIMtl-IIW tofitem-I^Mirlaf</p>
        <p>f Randall Huggins</p>
        <p>MMIETaWIEnERnilSES</p>
        <p>Kinston. N.C.</p>
        <p>Bilfy Joe Royal</p>
        <p>IsCoRosrl</p>
        <p>TNORSDAYy .NOVEHRER 26,19R7</p>
        <p>Lonoir Oomly Shrim Gliib Hnslon, SC.</p>
        <p>IpMUSwitStar  ttt,ailMa</p>
        <p>HBgy HoUHB</p>
        <p>ALL SEAIS RESERVEO - MOM EECR</p>
        <p>Producod By HomtTown Enttrprisgs Sponsorad By Ltnoir County Slirinors</p>
        <p>TMal OutMs: Sound Shop-Klnslon, AlhMos Coraor-Twin NNors M3S Now Born  Bobs TV i Appllonco-Oioonvlllo  ItaH Rooord Olop-WosMnglon Sq. Mall, WasMnglon  SIngor SlorsgorMoy M^ QoMsboro  SigMs  Sounds-Srontwood Shopping Contor, WHson .0111100 Auto Parto-QrNton</p>
        <p>0R0IU622&amp;gt;066R</p>
        <p>042</p>
        <p>NMp Wanted TaadiMrs</p>
        <p>fomHa.nmr*'  Will</p>
        <p>jwstwfct 0 four quiiffor program In .OrMnhouatand rounds</p>
        <p>Molnlsnanco. WHI</p>
        <p>andcoopsrolt</p>
        <p>oordlnafo</p>
        <p>Grotnhoust</p>
        <p>mor^ TK^y onroli,"li</p>
        <p>and matotain rocordi on</p>
        <p>SStoteiSR</p>
        <p>work'o^tTwily**^vito"tttS</p>
        <p>919-7544130 Ext 239. AA/</p>
        <p>JOI 'VAANVi Counaaior-</p>
        <p>wSZi</p>
        <p>djgoa m counaaling raquirad.</p>
        <p>p?fra*"s*:rr7r;:</p>
        <p>now (VfoWfUW vy IfOyMftMf</p>
        <p>30, t^ Sand Ittfors of appllca-PiSonnal</p>
        <p>Offkar, Boaufort County Com-</p>
        <p>munl^ Coll^ PO Bw N49 Wfod*gfon.llc 27839. An aqua oppr^unHy/afflrrrMitlvt aa^</p>
        <p>r * f* WTTirrTteinvw BCTIOn</p>
        <p>7524114**  '*7:  C''</p>
        <p>M3 Halp Wanted TachnicalSTradas</p>
        <p>r?</p>
        <p>ijrVTBTIT.</p>
        <p>Ml 2444723 affor</p>
        <p>frwnrtrlm 7:00 p.m.</p>
        <p>Snpemricaais?</p>
        <p>ttw t^ancaiUrq Spact</p>
        <p>touat bo'txparlanct with praclalon maasuring aqulpmant and blut prin roadfng. Exparlanoad In tha Mt-up and oparatlon of CNC</p>
        <p>A tlpm,rt 919997-4744 or ^ roMim# to Moro Procltlon, PO Box 250, Sharpiburg, NC 27170.</p>
        <p>CUSSIFIED DiSPUY</p>
        <p>SPECIAL</p>
        <p>Safe</p>
        <p>Model S-1 peclal Price</p>
        <p>122</p>
        <p>Reg. Price $177.og</p>
        <p>TAFF OFFICE EQUIPMENT</p>
        <p>569 S. Evans St. 752-2175</p>
        <p>Rent A</p>
        <p>NEW CAR</p>
        <p>As Low As</p>
        <p>$18.00</p>
        <p>Per Day</p>
        <p>Sharpest Fleet In Town</p>
        <p>RENT WAY AUTO RENT Brown &amp;amp; Wood</p>
        <p>Downtown</p>
        <p>752-2882</p>
        <p>LAOieS:.</p>
        <p>Am your chairs covwad with shMts and towala? Protact your Chala with claar piasllc covars. Baa them A know lhay aro protoctad. Sofa, chair A 4 pillows covatod  $129.</p>
        <p>Auibyi Ptadic (tevirs  iatttiLs_</p>
        <p>STANCILL A FRIENDS INSURANCE</p>
        <p>ALLMSKCMPMSURANCE</p>
        <p>Com. lotoxo. pMMb. wybMM, dc.</p>
        <p>MJTO=SaasiipoMi MoMtHonw MRBNALUflM 8 PR 25 Ym ON, nuN=tiii TmtSYMnOld, tINNHtltS TamiOYMnOld, PfUN=IM Sing* PimiunvTii Siw=t%</p>
        <p>758-2651 Anytime</p>
        <p>043 Halp Wanted Technical A Trades</p>
        <p>043 Halp Wanted Technical a Trades</p>
        <p>043 HBlRWpflted TtchnicBlBTYadBS</p>
        <p>044 WOffkWtnteU</p>
        <p>Immediate Openings For Industriai Positions</p>
        <p>Hoavy lifting, matarial han-dltng, machina oparators and ralaM poaitlons Immadlataly vallabla. Must have Industrial ai^lenM, plwna and transpor taflon. A beltar opportunity with oxcollant bontfits. Apply In person at...</p>
        <p>ANNE'S</p>
        <p>CIV WALL 8iMli and framers naodad. Good pay. Plenty of work. Call TSSMOtS after 7:00p.m.</p>
        <p>BxpiriBncfo in pww iriQiiiBwrM matal buildings raqblrad. Supervisory txporltncod prefonrad. Must ba familiar with directions of: Parapots, canopies, accassory components, etc. Pay according to ox-parlanca and ablllfo, erltn hospl-iallzattan and paid vacations. Apply In parson, Custom Building Co., 7fr4220, Greanvlllo, NC.</p>
        <p>WAhTED; First c^ Auto Mochank; 4Vi days airwaek, 2 weeks vacation, 5 paid holidays; top pay tor rIghTparm. ^y In parson Chuck Autry Bote 1104 Oi^lnson A\m., 752-</p>
        <p>ARI YOU IN NilDOF havino your yard claaiM up for the winter and don't have W time? Call7S7-lSIOforagood|)rlte.</p>
        <p>IXIIIllMU&amp;gt;AdUYAL</p>
        <p>Mlling hangifa. Must have valid NC driver's llcania. Only sober</p>
        <p>imiiinitt*</p>
        <p>fochniclan, tap GM dealer, excellent pay, fringe bonaf Its. (fon-tact Mika Millar, Pools BuIck Co., Inc., Kinston, 522-2511.</p>
        <p>BROWN'S PROFESSIONAL</p>
        <p>painting and mlldaw and moMurt control. Call 750-4134  Ll -POR l^raa jitlmala. Jon's Painting and Wallpapar-k^. M about vmyl si^.</p>
        <p>SDUHihA fkll Sarvict. Ail typos dono. Stump removing.</p>
        <p>752-4420 or 7S74117.</p>
        <p>TEMPORARIES</p>
        <p>758-6610</p>
        <p>Flowors Offlct Complex 1410 South E vans Stiaat (Use Evans Street Entrance)</p>
        <p>SCRIEN PRINTIRl rrinttx, a new rapidly growing screen print firm has ground floor positions for self motivated Iraflvld-uals with screen print experience. Management and production positions available. Willing to train Individuals who are self motivated and looking for a future. Call 752-0433 tar ap-pobitmant.</p>
        <p>SAkPIUTIkVAWOcustomcab-bwl ma^. Con^itlva rates. Call 754te00 for a ra estimate.</p>
        <p>044 WorfcWhnttd</p>
        <p>CLOMNfiNO-fr birttKteySr fact</p>
        <p>SItePo^"*?**</p>
        <p>MASONS NEEDED. Call 825-4531 or 732-1044, from 5:00 to 10:00. Top pay, up to $12.00 an hour.</p>
        <p>ADDITIONS, painting, Im-provemant, repair; also decks, garages, toncas, ate Haddock ^tructlon. 355-7044.</p>
        <p>^Y5M HOMfei remodeling, decks, additions. 30 years Of top QMltty work. Frao estlmafos, JF Eteiards Builders 830-5470.</p>
        <p>MBCHANit WANYeD to rebuild and repair anginas. Sal-</p>
        <p>in)our*7M01*"</p>
        <p>TERMITE AND PEST Control techlnclan nooded. Excellent pay and banatlts. Work with tho bast at Tarminex. 3014 S. Manso-rlal Dr., 754-4424.</p>
        <p>FALl LAWN CLIAKiKg, gutters cleaned. Call 7544200 tor a fraaastlmata.</p>
        <p>iXPhiNCth bependeble woman will clean your houso. 754-UIO.</p>
        <p>CUSSIFIED DISPUY</p>
        <p>CUSSIFIED DISPUY</p>
        <p>CUSSIFIED DISPUY</p>
        <p>CUSSIFIED DiSPUY</p>
        <p>OM WarkWmted</p>
        <p>n!6 WINDdWfr</p>
        <p>RfCi</p>
        <p>wofd'*1l!ko</p>
        <p>r-T! '' cToantng fcmjwsss. Rotoranoiaand trant-</p>
        <p>porlaMan.</p>
        <p>fe^</p>
        <p>I^PKItocarobrUta</p>
        <p>gry^gyVn^ygyifc</p>
        <p>ssiroaiS"***</p>
        <p>OK81ILL a dtiiTSSIiS: ^VUIAL ifftVtei. nsl</p>
        <p>din^ iKlu^ windowa. Call 7S44200 for a fraoottlmalo.</p>
        <p>AyAllAILI Now io do work. Strow fumlahid, rakodondotc. 7324304.</p>
        <p>yard </p>
        <p>MBVMf</p>
        <p>nf iiiif AkTHI</p>
        <p>houtKltanari Whathor you naad hite wm or on 0 ragular</p>
        <p>Mrs. Black 3SS-5M4.</p>
        <p>Aaintir and Hangar;' cfoan, honait, fast. Francisco Marcado, 524-3394, Griffon.</p>
        <p>CUSSIFIED DISPUY</p>
        <p>Get $500Cash Back!</p>
        <p>3500cold, hard cash can be yours now at Sg^non Buick-Poniiac-GMC Tn^* Its trueahd easy to dojust make usyourveiybest deal on any brand new 1987 Buick Century OT Pontiac6000in stockandyouUget $500cash bade! Use it toM^your down p^Qmentorforsomeb^tpy holiday shoppii^l</p>
        <p>igBui&amp;lt;kik&amp;gt;rl988.</p>
        <p>AillMirteil</p>
        <p>Come see all of the newyears new carsindudiig the all new, totaltyred^gned 1988Buick Regals. Or</p>
        <p>amine all the luxury (^a new Park Avenue or Ekctra. Buick has desig^ these stylish carstofit your Ufe-s^e andyour biK^ Test cfa^ one soon at ^mon Buick-Pcmtiac-GMC Truck.</p>
        <p>Save Hundreds Afore At S^mon!</p>
        <p>New car saks ae doing weU, so were currently overstocked vviih late model, local trade-ins. UtereforetMyre all maikedw:^downforspel)isales!Heres.)ustasaniite;</p>
        <p>Yiar lUteMoitel '  Stock  Oaacrlption  was  SdaPHBl'^</p>
        <p>1984ChevyBlazer  4040C  Sharp6-cylinderwilhaiilhmalict^^  8,495  6,995</p>
        <p>1986 Pontiac Bonneville  8094  Exira;&amp;lt;toilocaltrade-in!</p>
        <p>1986PontiacGrandAm  8086  4KkwLE sedan loaded with luxury!</p>
        <p>Wat</p>
        <p>^,495</p>
        <p>9,495</p>
        <p>9,995</p>
        <p>1966Chevy Blazer</p>
        <p>8,795</p>
        <p>8,995</p>
        <p>8093</p>
        <p>6-cylinder iTKXIel with autornalic transmission &amp;amp; only lowner!</p>
        <p>1985Oidsmobiie 98 Regency 2119A Fulty-equipped Brougham rrxxlel with only lowner!</p>
        <p>1987PontiacGrandAm 8088 2-door LE model with AM/FMs^, power</p>
        <p>windows &amp;amp; low meagel</p>
        <p>10.995</p>
        <p>10.995</p>
        <p>9,495</p>
        <p>9,695</p>
        <p>10,995  9,995</p>
        <p>BUICK*P0NTIAC6MC TRUCK, INC.</p>
        <p>Highway264Bypass Farmville 753-7103</p>
        <p>Nurses .. .You deserve the best.</p>
        <p>And we've GOT the best the Women's Pavilion at Heritage Hospital! A place</p>
        <p>dedicated to the special needs of women.</p>
        <p>The Womens Pavilion includes "Special Beginnings/' the area's first birthing center, with seven beautifully decorated LDRP suites, a large operating room, and a Level O Nursery.</p>
        <p>We want you to see the new Women's Pavilion for yourself, so we're inviting all...</p>
        <p>Labor &amp;amp; DeUvery R.N.s&amp;gt; Level II Nursery R.N.S and OB/Gyn RJV.s to</p>
        <p>An Open House For Nurses</p>
        <p>Come enjoy the refreshments, meet the physicians, the nursing staff and tour our Women's Pavilion. Bring a friend.</p>
        <p>Sunday, November 15 or 22, 1987 3 until 5 in the afternoon</p>
        <p>For more information, contact:</p>
        <p>Pam Owens, Personnel Director at 641-7139.</p>
        <p>Heritage Hospital 111 Hospital Drive Tarboro, N. C. Z7S86</p>
        <p>ate</p>
        <p>MitAliA*A4hUMiN</p>
        <pb facs="00096780_0061" />
        <p>^usmuch</p>
        <p>brochurt.</p>
        <p>mor.CaM7M96M.</p>
        <p>IldHT VIAfc 6L6 A3R?rM</p>
        <p>Pitlitr ttarto. turntablt.</p>
        <p>UCKET TRUCKS FOR SALE</p>
        <p>W Farm Equipmtiil IRRFsAL^MRSojSw^</p>
        <p>Combine with 13' bMn platform. Call 7S6-S130 after 7pm</p>
        <p>on Livestock flSSSSaCRDNaJar^</p>
        <p>Stablee, 732-3237. ikNtSeS FOR tale, registered or grade. Also feed and tack. 74-19.</p>
        <p>TalI space FOk RENt boMnd PCC, $30 par month for tell and pastora, no feed. Call 3iS-713 after 7 P.M.</p>
        <p>WiNDHOM BROTHERS Post Steel Buildings. Specialty, horse bams and fied. Also horses boarded and trained. Located between Farmvllle/Greanville. 1-0Q0-&amp;lt;t2-432; local 733-3M7.</p>
        <p>Oft Miscellaneous</p>
        <p>nrnr</p>
        <p>chain Off white &amp;lt; iiaw,$73.7te-M49.</p>
        <p> MMAtAk Woo^.</p>
        <p>oso. A flashlM arrow sign $200. C5l after ,27-4720.</p>
        <p>UMinUM MOBILE H/M tng (3 Gallon) $19.73. le home skirting, $3.9. . Jlders Bargain Center, 738-7I1.</p>
        <p>MTMfciib AOkLiAkCE SALES uaad washers, dryers, ranges, refrigerators and freezers like new, reduced, fluarantaed. Call B.J. Mills, |(adcJack,74-344t.</p>
        <p>PT(}jyikMAllMiNkift.E</p>
        <p>Excellent condHlon. Call 73-ISH or 737-3333.</p>
        <p>WATIOL HioAL own and Hat size9, $73.73-000l. RSi-VSmreiirisimas party with ut at Spoiisworld. Call Tte-4000 for details.</p>
        <p>kANb IW frost free , w. rafrlgorator and stove for sale 7Slo13or 7310347.</p>
        <p>SLl HAKIi TiCi, 73$ 13, for small loads sand, top-loll, Slone, pine bark. Also bKkhoe and driveway work. &amp;lt;IARPET iALI motel remodol-Ing, will have 32 rooms of carpet to Mil. IIX 1, 11 X 20, coral col or. $23 each place. Available after December 1. Call 738-3344. extension 300.</p>
        <p>{hAPTS WANVeO to Mil on</p>
        <p>conslgnnwnl In new craft shop In Ayi^. No painted wood Hems. Call 744 2104 blHiffi llfiairri&amp;lt;i 4 I, good condition, $73. stand $23. Sharp AM/FM /tape deck, $100. Wall</p>
        <p>'$20. Entertainment Call 333-SOU. lEN oiecfric range, ining table, mahog-m suite, drawing stool, and much</p>
        <p>s,fi2nll73*-I70.</p>
        <p>lALEi brand now iaga itexlacket, size medium. In -  I  will  sell  for</p>
        <p>I-7II4.</p>
        <p>band, moMrlhg.</p>
        <p>isfwatch and (fla-</p>
        <p>KMSSS</p>
        <p>rtldSf, Inc. 747-84.</p>
        <p>la  A"?</p>
        <p>p.m.call752-wr'^  '</p>
        <p>Experienced In all ma|or rapairs; heating, air, electrical, plumbing and appliances. All work guM-anteedVCall 737-1923.</p>
        <p>mm  LtANh^,</p>
        <p>apartments or offiOH. Will trav-Titleast M milM. Call between 3andp.m.737-13U.</p>
        <p>VAkb AUiktCNAMSriiak</p>
        <p>|M&amp;lt; Isawsi. Raasonable ratM. for Gary, 737-3273 or 7Sft-</p>
        <p>0A7  For Sate</p>
        <p>nBsror</p>
        <p>Call Harreisons for your bMt pries on quality treated lumber. Contractor InqulrlM welcome. Op10ajnjM9^^^^^_^</p>
        <p>06E  AiitiquBE</p>
        <p>MWI^iaifiTOoi-</p>
        <p>leetlblM, variety of merchan-dhe, will alM do cloan-sweep for Mtate sale. Open Safurday 10:00-3:00, Sunday 1:00-3:00.24 East of Grsenvllw at Pactolus.</p>
        <p>798-38M.  _</p>
        <p>TAG SALE Our furniture from Scoltand is In. Ovw' 300 plwws phis Hems from a local Mtate. Preview Saturday November 21, all day and Sunday November 22,11 a.m. Sale starts November 22.1 p.m. teeclal Items Include several sets of Queen Anne chairs, Including a set of 14 and 8 matching Queen Anne breakfast tabtes, Mveral nice sideboard. Wbodslde AntlquM, Allen Road,</p>
        <p>075 Computers</p>
        <p>fSSISISSoKP</p>
        <p>color monitor, diskdrive, Vic 1321 printer, ioystick, business and game software, $423. Tele-</p>
        <p>OM FiMi,Wood,Coai</p>
        <p>Seasoned, $80. 100% oak, $80. Seasoned, $U. 1-823-4837 after  or anytime weekends.</p>
        <p>CE.'s FIREWOOD, by the cord, hardwood $73, pine $40, mixed $70. Call 83P0444. Will deliver.</p>
        <p>AkMfPS Wood sErvice,</p>
        <p>seasoned firewood ready now. Call 734-3730.</p>
        <p>FIREWWD F^OR SALE $U per</p>
        <p>cord. Call 738-13U.</p>
        <p>POR SALE oak flrmvood, $83 a cord. Split, delivered and stacked. Call733-4923 after 3 p.m.</p>
        <p>OAK WOOD for Mie. Haul anyNme. 737-01)7or 737-1873. EaSONED or GREEN OAK flrowood for Mie. Call after 4 p.m. 732-8847 or 732-4420.</p>
        <p>EAMEd oak wood for</p>
        <p>Mie. $40 pick up load. Call 732-3234.</p>
        <p>H.lf i^lREWOOD 5T Mie. Sfan's Cycle Center 73741392. W6b^ksALEall7U-4340</p>
        <p>Ml Furniturt</p>
        <p>mmfsmrsi:!</p>
        <p>$ISe.734d718.</p>
        <p>bililTfE $Ultl, solid glass top table with 4 brass and bamboo chairs. Original cost $400, bast offer. 734-U73.</p>
        <p>MR $AL wen slttl^ma Atattreu, couch, end tabtes, foot stool and chair. Call Dave at 7SM182.</p>
        <p>iPMkLt hARA sing51^-</p>
        <p>hOgSny chest, Nke imw oondl-tlsn. $400. Call 734-1443.</p>
        <p>IWkL MAkkli mhiiogany Queen Anne tea table, like new, $100. Call 734-3443.</p>
        <p>MAYeR^D with pedMtaL $180.737-7fi0or 744-3841  .</p>
        <p>012 GRragt-YRrd Srm</p>
        <p>mtilUcLLEC^l'BLfe</p>
        <p>JAB's Hidden TreasurM Beside Tyson Bros.in StokM Open Thursday, Eriday, Sunday Mp.m.Saturdfy,9a.m.-4p.m. TXKb'sAir 111 Pearl Drive, Saturday and Sunday. 9a.m. un-Ml sundown. 333-22M.</p>
        <p>014 Hoavy Equipmont</p>
        <p>IBfShHSffMBprs!</p>
        <p>Bulldozers, van trailers, mobile honws, forkllfts, trucks, autos, boats, low boy trailer, tractors,</p>
        <p> I much more. 919-483-4733 for</p>
        <p>CLASSIFIED OISPUY</p>
        <p>ffiiH mjSFm</p>
        <p>swtajl, 10" (teluxe Electronic radtei saw wHh 2 biadH on2-dO0r cabinet with casters. LNW MW. $330.73441047.</p>
        <p>P&amp;lt;M IAlI: kefrlgarator. gas stove, and air condlHoner. CaH 738-7330.</p>
        <p>CLASSIFIED DiSPUY</p>
        <p>" Cedorloa Homo Daaler WaiAil</p>
        <p>Cedar log hoiMe are really^ aeliing' Join a winning team  protected territory  dealer training ~ each sale generates $4,000.</p>
        <p>fdaldhaalaal  Imm</p>
        <p>wVlvllNII wiHPClvlvvf lINd</p>
        <p>P.O. Box 19522 Greensboro, N.C. 27409</p>
        <p>099 Miscallaiiaous</p>
        <p>KIkAtiiEMlATIki</p>
        <p>"ilMSf</p>
        <p>CLASSIFIED OISPUY</p>
        <p>LOANS ON aVV, StU and trade. SouHwrn Gun A Pawn Inc., 732-2444.</p>
        <p>fATiH2fl$1^,3eMl23 aach and Oil drum. QII73A83U or 738-3840.  -;?</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>NEEDED: PART-TIME HYGIENIST</p>
        <p>For expanding dental office. Will work with full-time hygiehist 1-2 Vi days a week and will control own scheduling of patients. Can begin work before or after Christmas. Call Dr. Steve-Hoard In Tarboro, 1-823-8162 for an appointment.</p>
        <p>MfMjjjisarttangg^</p>
        <p>klkiiALlfGitl-t^idngsrSOO. Daima Sartos. Naw Hand-Cradwtodbadtersad. SSOOaach.</p>
        <p>wdwtodbadjpraad. siOOaach. 734-24.</p>
        <p>DOIgraTOffVmlcrowava ovsn, programmabla, 2 years oM, or^l cast 83, bod oftor.</p>
        <p>CUSSIFIED DISPLAY</p>
        <p>The Daily Reflector, Greenville, N.C.  Sunday, November 22,1967 (*-|7</p>
        <p>099 MiscellRiwous</p>
        <p>INSTANT CASH</p>
        <p>UMN^ . iurim Om, TV s, gold and sllvsr iawalry, coins, most anything of value. Southern Gun A Pawn Inc., 732-2444.</p>
        <p>CUSSIFIED DISPLAY</p>
        <p>GRADY WHITE BOATS</p>
        <p>Accountant-Immediate Opening for individual with 4 year accounting degree and minimum 2 year work history including computer experience. Prefer candidates with CPA or CMA and experience in a manufacturing environment. Cali 752-2111 extension 257, Monday-Friday, 9-4 for an appointment.</p>
        <p>099 Miscellaneous</p>
        <p>GOLF CART, WMHnghouM, now batorrtos, $4. Call Lar-ralMNobtos, 744-3244.</p>
        <p>SoGiui AK Ranch Mint iackat. Only worn once. AppralMl avallablo $3,0. Sell price $2,3. 333-4437.</p>
        <p>CUSSIFIED OISPUY</p>
        <p>099 Miscollaneous</p>
        <p>kEk$d*E kiAvv bOfY Ph gM dryer, excallanf t Non. $100.3^.</p>
        <p>KEfeOSENE HtATik Aapatr: Wicks tostaliod. Call One Saurcs Hardware, 734d2M.</p>
        <p>CLASSIFIED DISPUY</p>
        <p>IF</p>
        <p>...you canjollow directions ...you want a career in saies ...you want the potentiai to make $4,000 a month</p>
        <p>Come by</p>
        <p>JOE CULLIPHER SUBARU 60S W. Greenville Blvd., Greenville Monday-Friday Before 12 Noon And Ask For Charles Wickizor</p>
        <p>A neat appearance and a professional attitude a must.</p>
        <p>- Mazda</p>
        <p>X*RE</p>
        <p>\cUs</p>
        <p>&amp;amp;</p>
        <p>;\aV</p>
        <p>Lcduccj</p>
        <p>OaV</p>
        <p>5 Days Onlyl</p>
        <p>Friday, November 20th thru</p>
        <p>Wednesday, November 25th</p>
        <p>\00*</p>
        <p>\o</p>
        <p>Oioos</p>
        <p>ytoia-</p>
        <p>CO</p>
        <p>RETAIL</p>
        <p>PRICE</p>
        <p>1987 CadillRC^Sedtn Devllle..................$19,995</p>
        <p>1987 Chrysler Fifth Avenue..................$14,995</p>
        <p>1997 Uukalt Pwrfc'AvGiiiin.  ...............fM,99e</p>
        <p>1987 Pontiac Grand Am SE (4 d^r)  ........$13,995</p>
        <p>1987 Oldsmobila 98 Rggeikijfi **  .. .$1</p>
        <p>1987 Pontiac Gr 1987 Buicki 1987Bu9l( 19861</p>
        <p>jv,:</p>
        <p>Ml</p>
        <p>/$lf</p>
        <p>.$6,!</p>
        <p>t^dor).</p>
        <p>19|i!^llhMW Truck...</p>
        <p>iTruck Cab Pius...................$7,995</p>
        <p>IqEdOSX......... $9,495</p>
        <p>I628LX...........  $9,495</p>
        <p>I Accord LX.......................$9,495</p>
        <p>ir XJS...........................$24,995</p>
        <p>mJetta.......................$7,995</p>
        <p>Truck..............  $5,495</p>
        <p>iX..........................$8,995</p>
        <p>tX (2 -I-  2). ...................$13,905</p>
        <p>$10,495</p>
        <p>1C...........................$5,995</p>
        <p>M2 door).....................$7,995</p>
        <p>rOflt^...................$11,995</p>
        <p>r984 Mazda</p>
        <p>1984 Toyota Camry... ^</p>
        <p>1984 Pontiac Firebj||Cd?^r^-&amp;gt;^^^^   $6,995</p>
        <p>1984 Volkswagen Rabbit. .T/yv.........$3,995</p>
        <p>1984 Buick Regal Ltd.........................$7,495</p>
        <p>1983 Ford Eaeort............................$3.995</p>
        <p>1983 Mazda RX-7............................$8.495</p>
        <p>1982 Subaru Wagon. ............... $3,995</p>
        <p>1981 Honda Prelude. ..................$3,995</p>
        <p>1981 Lincoln Mark IV..........  $8,995</p>
        <p>THANKSQIVINQ SALE PRICE</p>
        <p>$18,499</p>
        <p>$13,899</p>
        <p>tit,a9e</p>
        <p>$12,389 $18,499 I9,$N 10,899 $10,399 $10,899 $10,399 I $8,399 &amp;gt;38,899 19.899 199</p>
        <p>$8,</p>
        <p>18.</p>
        <p>$8,299 $22.499; 8,999^ 84,48^ $7.99^ 12,41^ Wf-</p>
        <p>199</p>
        <p>18.899</p>
        <p>18.899 82,799 $8.889 2,499 17.499 82,999 $2,899</p>
        <p>87.899</p>
        <p>yioUtS &amp;amp;</p>
        <p>Spec</p>
        <p>During Our 5 Day Sale...</p>
        <p>First 100 Customers To Test Drive One Of Our New Or Used Vehicles Will Receive A Coupon For A Free Thanksgiving Turkey From Overtons Supermarket.</p>
        <p>CWBTONS</p>
        <p>III JARVIS smitr  HOME Of OREENVIitl S BEST MEATS' OUANHTV NiChTS REStAWfO</p>
        <p>756-1877</p>
        <p>-Mazda</p>
        <p>603 Greenville Blvd. Greenville, N.C.</p>
        <pb facs="00096780_0062" />
        <p>C.-I8 The Dally Reflector;&amp;lt;SfanviMe, N.C. Sunday, Novembar22.1987</p>
        <p>099 Misctllaneous</p>
        <p>NEilV is OaLl high top quarlum, complete vltn filler, lloht, hood and wooden two tank tftnd. All accesMTlet Included. Also, to gallon aouarlum. Fish alio. S1S outfit, III sell for ISO. 355^003.</p>
        <p>NO-POST refrigerator, side-</p>
        <p>PitNtV BOWES mailing machino. Like new. Half price. Call7S-MSI.</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>099 Miscollaiwous</p>
        <p>MAKING OUIlTR?^S^ for sale at a reasonable prke. Call 753 4SM.</p>
        <p>NEW AND USlo slate pool tables. Sales, service and supplies. 12134Mor 799-3037.</p>
        <p>NEW WALKk' and motocycli helmet. Call 75I-0SS3.  x</p>
        <p>RED, WHITE, and blue golf cart. Recently painted, good batteries, charger Included. 1050. Mike after 4:00,7S0-177I.</p>
        <p>CUSSIFIED DISPUY</p>
        <p>COMPUTER OPERATOR</p>
        <p>. ,</p>
        <p>National Spinning Company, Inc. is in search of an experienced MVS Computer Operator to play a key role in the start up of an IBM 4381 MVS/XA Data Center.</p>
        <p>The successful candidate will have a minimum of 2 years experience operating an I6M0S/MVS system with CICS. A computer degree will be a plus.</p>
        <p>For prompt consideration, send resume and salary history to:</p>
        <p>P.O. BOX 191 WASHINGTON, NC 27889</p>
        <p>Attn: Computer Operations Manager</p>
        <p>EOE</p>
        <p>099 Miscellaneous</p>
        <p>SVEN F00T&amp;gt; "Colorado Spruct" artificial Chrlsfmas trst and pint quilt rack. Call 751-7495.</p>
        <p>SHAMPOO VduEliUoi Riint shampooars and vacuums at Rsntal Tool Cnmpany.</p>
        <p>StilNOLES 911.M squart, 15 lb. Mt $4.95, r'xM' lab hardboard siding $1.49. Rojact plyood V $" $2.25, 3/4 $$.95: Bulldtrs</p>
        <p>7Am"</p>
        <p>iOFA, dwir, rockar-oak, $35T bar, $1M. McGragor clubs, bag, $125.752^, 70%*.</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>DOG HOUSES</p>
        <p>SPECIALLY raiCED.</p>
        <p>AcoHWid</p>
        <p>BuiMtngs and Truck Covers</p>
        <p>102 E. Greenville Blvd. 355-2603</p>
        <p>099. Miscellaneous</p>
        <p>IP1NV PiANti walnut finish, Sto^a Cl^ $500. Golf Clubs,</p>
        <p>Call 756-4007.</p>
        <p>TaWKd SUkiM, 7.00R.</p>
        <p>UOA Tannin epwpy.</p>
        <p>Ilkanaw,</p>
        <p>fanning, ovarhaad</p>
        <p>iMjl^ a old. Cost $2500, $1,000 firm. Call 355-369.</p>
        <p>As, dryars, WMgwyors, frtaiars, itovas $100 up Guarantaad. 746-6929.</p>
        <p> A^TOIAMNO. iail for $$00. CaH7S|-S23 Or 752-4640.</p>
        <p>CLASSIFIED DISPUY</p>
        <p>HOUSEKEEPING</p>
        <p>SUPERVISOR</p>
        <p>Heritage Hospital in Tarboro, North Carolina, has a full-time position available for a first shift Housekeeping Supervisor. Previous experience in floor care and Housekeeping and previous supemisory experience preferred.</p>
        <p>Position answers to Director of Housekeeping and responsibilities include daily duties of floor technician as well as supervising daily work schedule of other Housekeeping employees. ^</p>
        <p>Benefits include flexible paid days off, company-paid life Insurance, dental, medical and disability insurance available, plus more!</p>
        <p>Heritage Hospital is an employeeK&amp;gt;wned facility which offers its employees an excellent company-paid retirement plan.</p>
        <p>Interested candidates should call (919) 641-7140 for appointment.</p>
        <p>REGISTERED NURSES</p>
        <p>Join the nursing staff of Lenoir Memorial Hospital, a 322 bed, progressive facility located in Kinston. Our salary and benefits package features:</p>
        <p> A basic starting saiary for RNA*s and RNs of $9.60/hour</p>
        <p>3-11 diffarantial of $1.00/hour</p>
        <p> 11-7 differantiai of $1.25/hour</p>
        <p> Weekend differentiai of $1.25/hour</p>
        <p> Free individuai major medicai coverage</p>
        <p> Free iife insurance</p>
        <p> Hospitai contribution equai to 4% of gross salary to 401K Pfan after 6 months of employment Immediate, $100% vesting.(Must be 2016 years old to participate)</p>
        <p>Naw RN positions have been added effective 10-1-87 due to steadily increasing patient census. Full time and part time positions are available. Vancancies are in Medical. Surgical. OR, Emergency Room, Orthopedics, ICU, L&amp;amp;O, and Newborn Nursery. A bonus of $500 will be offered to new hires for a limited time. A $750 bonus Is offered to any new hired RN who works on a medical unit.</p>
        <p>Contact* Lynn Wallace or Robert Brown, Personnel, Lenoir Memorial Hospital 100 Airport Road, Kinston NC 28501 or call 919-522-7393  Equai Opportunity Employer</p>
        <p>JOE CULLIPHER</p>
        <p>r' j</p>
        <p>means business</p>
        <p>1988 Subaru Justy DL</p>
        <p>Fully factory equipped.</p>
        <p>*12722</p>
        <p>'Swung Pfic 18.782.75, clown ptynianl cash or tmM tses. amounl Hnancod 15,787.75, fl-nnoa diaigs $i.ai9.aA toM at paynMnts $7,837.40, delortod pwnwM pdoe MA32.4I), t1S0% A.P.H., SO monthly paynwnta. Tai</p>
        <p>1988 Subaru 3 Door</p>
        <p>$22507</p>
        <p>Mo.*</p>
        <p>! 'StNIng prioo I11,9a2aa, down paynwnt cath or trad* 1,1 plui $800 isbUt, amount. Ikuncwl I10.233S3, Niwnco ctwgo $3470.67, total of payniMna $1340440, daltnad paymant prlca $15.503.20. 1150% A.P.R 00 ntonlMy paymanta. Taa and taga ara not includad.</p>
        <p>Used Car Clearance Sale</p>
        <p>PAYMENT</p>
        <p>1987 Nissan Pulsar Sspead, air. stock pits. Salaprica $10.495........  $209.2460  mos.</p>
        <p>1986 Chevrolet Astro Vsn 7 paasanger, V-6. stock P175. Sals prlca $11,724.... ...... $242.7856  mos.</p>
        <p>1986 Nissan Truck 4x4, king cab. rad, stock P176. Sale price $8,975...................... 189a 1164 mos.</p>
        <p>1986 PontiSC Grand AM 4 door, eutometlc, air. stock P150. Sale prlca $8,878  $186.7354 moi.</p>
        <p>1986 Honda Civic 4 door, automatic, air. stock P123. Sale price $8,429.......  $175.7464  mot.</p>
        <p>1986 Toyota Corolla 4 door, eutomatic, stock pise. Sale price $8,425...................$175.74s4 mos.</p>
        <p>1986 Honda Accord LXi coupe, stock Pi28.saia price $10,750.......................$220.3256  mos.</p>
        <p>1986 Dodge 600 Convsrtlblo stock loesASaie pnce $7,995.......................$163.2954 mos.</p>
        <p>19861 /2 Toyota Supra Leather interior, stock P125. Sale price $15490................$317.23 60 mos.</p>
        <p>1985 Ford Tempo GL 4 door, stock pi 77. seie pnce $8.495. '..... ........ .$140.8846  mos.</p>
        <p>1985 Nissan Maxima Automatic, 4 door, stock pito, sue pnce$10,795.!..............$240.03 S2mos.</p>
        <p>1985 Chevrolet Camero Auiomaiic. stock loaoc seiepnce$7,790...................$173.4346  mos.</p>
        <p>1985 Oldtmobllo Doha 4door, full power. Stock P1S9. Sale price $9,725...... ........$213.29 52 mOS.</p>
        <p>1985 Dodge Caravan SE 7 passenger, stock pi 12A Stia price $9.729.................$213.29s2mos.</p>
        <p>1985 Ford LTD 4 door. Vs. stock P1T9. Sale price $5,895...............................$119.6246 RIOS.</p>
        <p>1984 Chevrolet Colobrlty 4 door, stock PI82 saie pnce $9949..........$ 121.3945 mos.</p>
        <p>AH pmmniawtlh$1.t5 down CMher had. 12.8% A.pn. Taimdt^iratiolincludMl ., l {  k</p>
        <p>JOE CULLIPHER SUBARU.</p>
        <p>60S W. Qreenville Blvd. Greenville</p>
        <p>for lull dMMIs</p>
        <p>756-8885</p>
        <p>096 Miscellaneous</p>
        <p>ir* CLOR TV ^</p>
        <p>nation. $12$. Also Zebre^ Chet 2 large breeding cegce and acassorles. All birds Mdsquip-ment$l00.7S$-1in6</p>
        <p>T* 2 ROUND trip tickets to BMtan, lowest fere poesbile, ThankMlvIng weekeM. 703-M9-6S54 or call Tommy Sfoughlen 757-0234.</p>
        <p>II #00T SATELLif E Sysfem, excellent condition. Assume loan. 10 speed bicycle 2 months oM, ISO or best offer. Cell 756-3912 from 7em until 3pm.</p>
        <p>1993 BMW S2$E-Arttc blue with pearl leather Interior, AAA/FM cassette stereo, excellent condition with all mochenlcel records. Bra Included. $13,000. Call 3S5-6S36 morning or night.</p>
        <p>2 A HOAttXi 2S,000 OYU's M each. One gas heater, 56,250 BTU's, thermostat control ventod, $100.746-3261 after 5.</p>
        <p>102</p>
        <p>Mobile Homes For Sale</p>
        <p>Ab Nt MlL ffOME MO DOWN PAYMENT, If you have ever been In the mlHtary. Call collect 756-6996, Luv .Homes, Greenville.</p>
        <p>A</p>
        <p>e61^IlVY HOUilN CENTEN under NEW MANAGEMENT. Unbelievable Sale Prices on houses in Inventory. Mutt Seo to Betiovo! 70 x 1A Fully fumlshod, ceiling fans, qardsn tubs, and many more extras. PAYMENTS un^ $200.00 month. LOWEST Down Payments In areal NO DOWN PAYMENTS for quallflod buyws. ON the LOT FINANCING!! Pre-owned homes under $100.00. "SPEND the HOLI DAYS" Warm and C-o-i-y In e home from Chooowlnlty Housing Confer. For more intarmaflon see Robert, Bob, Sue and Patsy or Call Collect 946-0657. Mon dey-Frlday, 0:30-8:00, Saturday I;t4:00, Sunday 1:009:00.</p>
        <p>Ik You're FINALLY ready tor tho vary best crafted manufactured home on the market, you're ready to look Into Mascot. Undersurpotsed vorkmanshlp available from 1280-1778 square feet. Priced from mid $30's-mld OSD's. Don't take our vord for It, write today for our free brochure. Charles Miller Horn, Rt4 Box 266, La Grange, NC 28551. Phone 523-9160</p>
        <p> Phones LOWEST PRICES EVER. Guaranteed! A!! remaining 1987 homes mutt go now! Choose ftwn 2  3 b^oom homes at</p>
        <p>drastically reduced prices. We sacrHlce, you tavo. TrI-County honws. Inc., 804 Greenville Blvd. SW, 7S69131. Call or coma by today!</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>PROFESSIONAL</p>
        <p>RESUME</p>
        <p>SERVICE</p>
        <p>Composition, cover letters, reference sheets, envelopes. Prompt service.</p>
        <p>A</p>
        <p>ATUfme</p>
        <p>PERSONNEL SERVICES</p>
        <p>209 Commerce Street, Suite B 355-7931</p>
        <p>102</p>
        <p>Mobile Nomas For Sals</p>
        <p>rm</p>
        <p>  1988 Horton, 14 wide, 2</p>
        <p>bedroom mobile home with payments under $135 par month. Mil BUI Jackson, Johnnys Mobllo Homo Sales, 756-4617.</p>
        <p>CLASSIFIED DISPUY</p>
        <p>102</p>
        <p>MoMla Homes For Sal# </p>
        <p>BblilLlI Wlbk RfeMI/Lika new 1917 models. Urge dowrt payments, already made by former cutfomert. Their lost your Mini Call collect 7569996, Luv Homes, Greenville.'</p>
        <p>CLASSIFIED DISPUY )</p>
        <p>ENTRY LEVEL Supervisory Positions/ Sound, highly respected and quality oriented manufacturer is seeking additional persons for assistant supenrisory positions. Must have 2 year degree or 1 year supervisory experience. Responsibilities require strong organizational and communications skills. Manufacturing and computer experience also) plusses. Opportunity to grow with company based on proven performance. Reply to: Entry Level 3245, PO Box 1967, Greenville, NC 27835.</p>
        <p>OPPORTUNITY IS KNOCKING</p>
        <p>- If your are self-motivated, quick and eager to learn, personable and diligent in the pursuit of your goals, we have a program designed to help you turn dreams into goals and goals Into reality..</p>
        <p>Were American Lincoln Homes, the nations leading telemarketer of log and conventional home packages, and we're ready to share the secrets of our success with you - to show you everything you need to know to be successful.</p>
        <p>How successful? Listen to what a couple of those Who "answered the door" have to say:</p>
        <p>In the past ten months. Ive sold over $839,000.00 In home packages for American Lincoln Homes. Thats $83,900.00 worth of commissions and the year Isnt over yet!</p>
        <p>-JerrySix Goldsboro, NC</p>
        <p>With one more sale. Ill have booked over $70,000.00 in commissions since January. That kind of extra income means a lot to me, and to my fami-</p>
        <p>ly-</p>
        <p> Mary Lou Batten Wilson, NC</p>
        <p>As your training proceeds, well give your as many qualified sales leads as you can handle. And, if you show us that you have what it takes to be successful, well enroll you In our start-up cash program. Once training is completed, you can begin to take advantage of our flexible hours and set your own schedule.</p>
        <p>Our sales program is not for everybody. But, If $50,000, $75,000, 4100,000 in earnings per year is where you want to be, we want to talk with you.</p>
        <p>Does it sound too good to be true? Isnt it worth a phone call to find out? Call, toll-free, today or send your resume to:</p>
        <p>1-800-682-8127 AMERICAN LINCOLN HOMES P.O. Box 669 Battleboro, NC 27809</p>
        <p>Attn: Bill Yaich</p>
        <p>102</p>
        <p>Mobile Homes For Sale</p>
        <p>lAWN ifM 3 iMdroom, 2 brttn, 72x14 with built-in TV, itoreo, microwave, and Franch doors, hymanh at low at $207 a nmtti. Gill 7S6-6996, oollact Luv Homas,Groanvllla.</p>
        <p>CLASSIFIED DISPUY</p>
        <p>102</p>
        <p>MoblltHomesi * For Sals</p>
        <p>aMurII PAVMKnT 19^ 3</p>
        <p>badroom, 76 foot Oakwood, un-furnithad. 9A% APR, sat-up In BIrchwood Sands. Call Ed Allan,</p>
        <p>752-6643.</p>
        <p>CUSSIFIED DISPUY</p>
        <p>AUTOMOBILE SALES</p>
        <p>Immediate opening for automobile sales professional. This position offers excellent earning potential as well as an outstanding company benefits program including insurance and company demo. For consideration please apply in person at</p>
        <p>Toyota East Dava SIgmofi, Sr.</p>
        <p>109 Trade St., Qreenville, N.C.</p>
        <p>TIME TO GET UNDERWAY</p>
        <p>As the start-up for our Rocky Point plants draws near, job openings are still available in the following departments:</p>
        <p>FIBERGL.ASS</p>
        <p>FABRICATldiM</p>
        <p>Lamination experience will be needed for the following jobs:</p>
        <p>Finishers &amp;amp; Patchers</p>
        <p>Hand-lay fiberglass mat, roll to proper finish, and patch defects.</p>
        <p>Equipment Operators'</p>
        <p>Operate chopper, gel and wet-out guns</p>
        <p>METAL</p>
        <p>FABRICATION</p>
        <p>Experience shearing, bending, welding, and painting aluminum required. Assemblers of glass windows are also needed.</p>
        <p>As a progressive company in the motor yacht industry. Carver Boat offers comp^itive wages and benefits. Resumes will be accepted at the Employment Security Commission Office in Burgaw, NC.</p>
        <p>An Equal Opportunity Employer M/F/H</p>
        <p>CARVER</p>
        <p>AFFORDABLE</p>
        <p>FRANSPORTATI</p>
        <p>19B7 Tempo &amp;amp;</p>
        <p>I</p>
        <p>2987 Topaz</p>
        <p>Power Steering</p>
        <p> Power Brakes</p>
        <p> Polycast Wheels</p>
        <p> Radial Tires</p>
        <p> Digital Clock Air Conditioning</p>
        <p> AM-FM Stereo</p>
        <p> Automatic</p>
        <p> Tinted Glass</p>
        <p>BMW) on tm down coUi or tn plut NC him im nd ItaoriM (Of W mOTIh* 1 11.$$% A.P.R, MNng pric* of *7.W ioMI o( pw-nwntilt.340.IO.dollnild|Myinwilpfki$10.SI1.aa  ^</p>
        <p>EAST CAROLINA</p>
        <p>LINCOLN-MERCURY-GMC TRUCK-MERKUR</p>
        <p>West End Circle 756-4267</p>
        <pb facs="00096780_0063" />
        <p>102 Mobil* HomM , r For Sale</p>
        <p>A?rivt oi In^iw MliOinT</p>
        <p>W# hava VA Financing wHU no Down Paymant rao^rad. Call for Information: 7S6^.</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>102</p>
        <p>Mobile Homes For Sale</p>
        <p>ARIAtfcifvi TixM, all applT ancM, cantral air, taka wnr peymanta. 752-7S0or 746^.</p>
        <p>CLASSIFIED DISPUY</p>
        <p>V WAREHOUSE LEADER</p>
        <p>We are seeking an Individual who has a strong background in warehouse and inventory functions. Supervisory experience is desired, knowledge of computerized data entry and reports is needed. Send resume to:</p>
        <p>-) '</p>
        <p>Cox Trailers, Inc.</p>
        <p>P.O. Box 338 Grifton, N.C. 28530</p>
        <p>Train to be a</p>
        <p>TRAVEL AGENT TOUR GUIDE AIRLINE RESERVATIONIST</p>
        <p>Start locally, full time/part time, train on live airline computers. Home study and resident training. Financial aid available. Job placement assistance. National Headquarters - Lighthouse Point, FL.</p>
        <p>A.C.T. TRAVEL SCHOOL</p>
        <p>1-800-327-7728</p>
        <p>Accredited Member N.M.S.C.</p>
        <p>DAYTIME HELP NEEDED:</p>
        <p>Frontline  Yeast Roll</p>
        <p> Cashier   Waitresses</p>
        <p> Hot Bar NIGHTTIME HELP NEEDED:</p>
        <p> Cooks * Waitresses</p>
        <p> Hot Bar</p>
        <p>Apply between 2:00 &amp;amp; 4:00 p.m.</p>
        <p>No Phone Calls,</p>
        <p>Please!</p>
        <p>102.</p>
        <p>Atobile Homes For Sale</p>
        <p>riOVoobitbhomMfor</p>
        <p>Jayml* at 7St-7m or</p>
        <p>CUSSIFIED DISPUY</p>
        <p>102 AMbile Homes . For Salt</p>
        <p>miLi R6Mi W iALt: 3</p>
        <p>badroom, firaplaco, cantral air, waatiar/dryar. Call tM-iOM aftar;30pjn.</p>
        <p>CUSSIHED DISPUY</p>
        <p>EMPLOYMENT OPPORTUNITY GREENVILLE UTILITIES COMMISSION</p>
        <p>DATAPROCESSINQIUNAGBi  SltaryRM8aS23A46-tll5,33l</p>
        <p>3.  '  .</p>
        <p>The Greenville Utilities Commiesion of Greenville, NC, is seeking qualified candidates for the position of Data Processing Manager. This Is a'newly created position and department. Selected candidate will be responsible for all facets of data processing; coordinating Installation of a new DP system (DEC, VAX82M &amp;amp; Digital Systems, Inc. software); testing and acceptance; establishing dally procedures and schedules and forming user groups for main system an PC users. Must have two years experience in billing, Inventory control and all financials In a municipal utility environment. Degree in DP or related field required with minimum two years experience.</p>
        <p>Applications accepted through December 18, 1987: Personnel Office, Greenville Utilities Commission, P. 0. Box 1847, Greenville, NC 27835-1847. Employment is contingent upon passing a physical examination including a drug screening urinalysis.</p>
        <p>"An Equal Opportunity Employer</p>
        <p>Chicken n Bar-B-Q..</p>
        <p>Also: Shrimp*Rlbs*BBQ chicken. Locations in Central and Eastern N.C. Has opening for Restaurant Managers. Previous Restaurant or Hospitality experience helpful...</p>
        <p>Salary and Bonus up to 40,000/yr. or more. Investment Opportunities Above sverag* compensation !BC/BS Insurance Paid Vacations</p>
        <p>Send Resume to Regional Office.</p>
        <p>Attention: Greg Alloore Suite 130 Gum Branch Square II Jacksonville, N.C. 28540</p>
        <p>or call us:(919)346-6150</p>
        <p>QUAUn CONTROL ENGINEER</p>
        <p>- Simpson Industries, Inc., Greenville, NC. We have an opening for a Quality Control Engineer with a minimum of 5 years Q.C. experience in the following area: machine and process capability studies, S.P.C., QeoTol, metric systems, N/C machine processes, CMM programming experience, and ability to communicate with shop personnel and upper management. A minimum 2 year degree in a related technical field is required. We offer a competitive benefits package and salary commensurate with experience. Send resume to:</p>
        <p>Simpson Industries NC Inc.</p>
        <p>PO Box 1645, Greenville, NC 27834 Attention: QC Manager '</p>
        <p>W* an an Equal Opportunity Employar</p>
        <p>NOVEMBER</p>
        <p>NATIONAL PICKUP MONTH</p>
        <p>&amp;amp;</p>
        <p>^ PHELPS CHEVROLETS 22nd ANNIVERSARY</p>
        <p>We Have Over 100 Pickups In Stock!</p>
        <p>Call one of our salesmen today I</p>
        <p>Clyn Barber  Rex Wainwright Mike Outlaw  Edward Briley Mike Phelps  Jimmy Foreman</p>
        <p>Let them tell you about the Phelps $1000 Down Payment Match and Special Discount Letters from Chevrolet!</p>
        <p>Down Payment Match Certificate</p>
        <p>value not to exceed</p>
        <p>$1000</p>
        <p>We will match your down payment up to $1000. Please bring this Down Payment Match Certificate witii you.</p>
        <p>2308 Memorial Orive  Greenville  756-2150</p>
        <p>102 Mobile Homes . .ForSal* .</p>
        <p>MbWitLLMafcaanaNaron  Oakwood, 2 badroom with ax off of inxxiO. Call</p>
        <p>14x40, IMSonnar</p>
        <p>*51^, i badroom," 1 Vi</p>
        <p>I oowN 6w This a</p>
        <p>bodroom, 2 batti l4xM with</p>
        <p>ffi&amp;amp;Sb.""-'</p>
        <p>Mtl datm  i</p>
        <p>  14' wide only $ias/</p>
        <p>m^^ dollvory. .H to-</p>
        <p>PTiil AOTHlS-</p>
        <p>\R'&amp;gt;!N4LHCMES Has Dona IfAgajn. 1N i4x7D 2+2 doluxa homa-Paym^ undw $t&amp;lt;o per r. Soloctlon Of Oalim Doublowldat Under $30,000. No monoy down to quallfltd Homos, Hlghwoy 70, Kinston, $23-0404</p>
        <p>OJWJiwldt, 2 bedroom. Sm down with payments under 1140 per month. Cell Bill</p>
        <p>^ AND REfN). Payments starting atjm.W and less than $115 par month. Come in today to comparo and save. TrI-Cowrty</p>
        <p>eSKW.'Siot*</p>
        <p>WAnTthBST? </p>
        <p>oW*r: ntw and pre-owned homw; mumptlons; owner-</p>
        <p>noTRoneydown</p>
        <p>if You Qualify.</p>
        <p>Ho  refused.  Call  to</p>
        <p>day. Carefrae Housing, 3S5-7a3.</p>
        <p>WHV ^AY hNti No com-pwlson. Now 1980 homes for as Imie as 8484 down and less than $149 par month. Tri-County ' Groonvlllo Blvd. SW, 75441131. Call or come bytodayI</p>
        <p>14X78 SAFSWAY. 1982 3 btd^. 1 3/4 baths, assume tow equity. Call 944-4825 or 757-1251.-</p>
        <p>1971 TEAYtON, 12 X 45, new carpet and linoleum, 3 bedrooms, m baths. Stove and retr^^lncludwt. Afters</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>102 ' Mobile Homes For Sale</p>
        <p>rgariwwiiiflow. new</p>
        <p>carpet, all appllancai. wastwr/ dryir, price nagetlaMa. 78|-I7sr IMS 2 ilM^ air W dttonad, all aopHanoas fumish-ad. Call 2S4-fll8 days, 734-1273 avsnings. -</p>
        <p>CLASSIFIED DISPUY</p>
        <p>0^ Reflector, Ureenville. N.C. Sunday. November 22.1987  (&amp;gt;-|9</p>
        <p>102 AAobll* Homes For Sal*</p>
        <p>wTBAiawab t2 X 40. odd oendllleN, fumMwd. $4580 nogo-tlablo. 734-1543.  ^</p>
        <p>cash.</p>
        <p>CLASSIFIED DISPUY</p>
        <p>''rAOMUUf</p>
        <p>753^182  753-2778</p>
        <p>EVEfY DAY LOW PRICES</p>
        <p>1985 98 Regency Brougham -</p>
        <p>Full power, leather Interior.</p>
        <p>Excellent condition. New radials. Warranty included ........</p>
        <p>1985 Maxima SE-</p>
        <p>Full power, power sunroof, excellent condition.  *. _ _ _ _</p>
        <p>Warranty Included............*10,500</p>
        <p>SHOP AND COMPARE!!</p>
        <p>102</p>
        <p>/Mobile Homes For Sale</p>
        <p>nominal, 40x12, great corvOtlon, lot rent reasonable or "*!BOtla6lo. Cpun^ kx^km, 2 miles south Confect Ron 7M-2I32</p>
        <p>CUSSIFIED DISPUY</p>
        <p>102</p>
        <p>/Mobile Homes For Sale</p>
        <p>1978 voeue mobik hama. 14x34, 2 bodroom, I bath. Includes refrigerator, tiovt, 2 vdndow air condHlonars. Muat te moved frompnisant locaflon. Call 732 3218 or 74309.</p>
        <p>CUSSIFIED DISPUY</p>
        <p>SpeeiaU</p>
        <p>1986 BMW 325</p>
        <p>4 door, charcoal gray, 5 speed, sunroof, one owner, fully equipped.</p>
        <p>All Makes &amp;amp; Models Of Cars &amp;amp; Trucks!</p>
        <p>AMERICAN</p>
        <p>TRUCK&amp;amp;ALrm</p>
        <p>SALESLEASINGSERVICE</p>
        <p>Hwy. 11 South, Greenville, N.C.</p>
        <p>(Wintervllle, N.C.)</p>
        <p>756-3635  1-800-682-2216</p>
        <p>Joe Cullipher's$500 Rebates On Select Models Of Dodge Trucks</p>
        <p>1988 bodge Ram 50</p>
        <p>M 352</p>
        <p>Mo.</p>
        <p>S'* Psyraml CMh or Irada $798. amount nanead M.ias. nanea PW?*"** *8.13720. dafarrad paymant prtea 18,83220.11.5H A P B., M monthly paymanta. Tax and taga art not Ineludad</p>
        <p>Stock #2772-8</p>
        <p>1988 Dodge Dakota</p>
        <p>M 58^</p>
        <p>Mo.</p>
        <p>*6 Phi ISOO raoala. amount nanead *A520.20. dafwrad paymant prtea 811.019.20,11.50% AP.R, 60 monthly peymtnts. T*c and legs era not inchidad.</p>
        <p>1988 Dodge D-100 Truck</p>
        <p>Mo.*</p>
        <p>-SalHng prtea 18,918. down paymant oaah or trada 1888 ptua 8800 rahala amount nanead</p>
        <p>111,269.40,11.5% A.P.R., 60 monthly peymenit. Tas and tegt ere not included.</p>
        <p>stock #2268-7</p>
        <p>1988 Dodge Aries</p>
        <p>$19776</p>
        <p>Mo.*</p>
        <p>- SaWrte prica tO.991. down paymant cash or Irada tW8. amount Hnwtcad S8.9B2. nanea chaijt *227180. total ol paymanta $11.88880. datarra paymant prtea 112284 40.1120H A.P R.. 80 montnty paymanta Tia and lags art not Inctudad.</p>
        <p>Joe Culliphers Pre-Owned Specials</p>
        <p>4 Door Sedan Sale  Over 30 to choose from</p>
        <p>All cars have power steering, power brakes automatic, air. Most cars have power windows power locks, cruise control, tilt wheel, luxury packages.</p>
        <p>1984 Chrysler Fifth</p>
        <p>1985 Chrysler FNIh Avenue</p>
        <p>1985 OKtomobile 98 Regency ' &amp;gt; '</p>
        <p>1986 ChevroM Caprice 1984 Chrysler Nete Yorker 1983 Chrysler New Yorker</p>
        <p>1982 Okfsmobile Cutlass 1987 Plymouth Reliant 1977 Oldsmobllo 98 Ragancy</p>
        <p>1982 Plymouth Grind Fury</p>
        <p>1986 Plymouth Grand Fury</p>
        <p>1987 Plymouth Grand Fury 1984 Ford LTD Stattonwagon</p>
        <p>1963 LInooln Contlnantal</p>
        <p>1983 Marcury Grand Marguis Brougham</p>
        <p>1985 Chrytlar Libaron GTS</p>
        <p>1986 Paugaot Stattonwagon</p>
        <p>1984 Dodga 600 1983 Chrysler E-Class 1982 Oldsmobito Oolta 88</p>
        <p>7 Ywr/79,000 Mile Wamntji</p>
        <p>P!ymouUi</p>
        <p>OogoJfuchs</p>
        <p>TEL.7SS-01W</p>
        <p>3401 S. MEMORIAL DRIVE GREENVILLE. N.C.</p>
        <p>LEASING</p>
        <p>CAR TRUCK</p>
        <p>TEL. 756^186</p>
        <p>i</p>
        <pb facs="00096780_0064" />
        <p>Q.20 The Dally Reflector, Greenville. N.C. Sunday, Novettiber22.1967</p>
        <p>102 Mobilt Homes</p>
        <p>' ^^EiS35S??bSraS!^ *</p>
        <p>Hit or rant. Cell 7136.</p>
        <p>'Ifis OAKWOOD 14x70, 3 i.miMtti,manytxtrM. 1. 0300</p>
        <p>flnancod. paymonH 0300 a month. Located , In Graonvllte. Call 07^ or</p>
        <p>'Ts-soas.</p>
        <p>tiM Parkway doubtewida, a</p>
        <p>" heOraemo, 3 baths, contral air, firaplaca, front and rMr docks, catnodral calllnfls, axcallant condition, taka ovar paymonte, no money doam. Call batwaan 0:00 and 3:00, 7S0-7S40; 534-3335 ' after 5:00 and waakands. nOO iiff RATON by Redmair4 X 74. Taka up payments, will pay to move locally. 3 bedroom, 3 full battw, undamming, central tiMt/air. Want to bulto houM. Call 757-1050 atterOpm.</p>
        <p>Has 40x14 3 kbROOM, with oardan tub. Absolutely NO Down Payment. Call 754-7400.</p>
        <p>e M WIDE, payments as low 0141.04. Greenville volume Iter. Thomas' Mobile Home Satea. Across from Airport. 753-</p>
        <p>LAYTON doublewide, 3 bedrooms, 3 baths, .masonite sMIng, shingle roof, oxoaltent buy. On sale this month tor only 331,500. Call collect 754-4004, Luv Homes, , Grsenvllle.</p>
        <p>1000 40x30 TOP OF the line Nor lis doublewide, lived in only 3 months. Solid handmade ash cabinets, sprayed ceilings, lacuul, nearly 1000 square teet of living space, air, shingle roof, and masonite siding , original price $43,000, will sacrifice at manufacturers cost at 334,050. Call collect 754 4004, Luv Honm, Greenville.</p>
        <p>3305 DOWN with payments 3140, 13 X 45 Repo, 3 Call Bill JacW Johnny's Mobile Homes, 754-</p>
        <p>4407._</p>
        <p>OS OAKWOOD, 3 bedroom, 3 bath, auume loan with no . money down. 7-11 a.m. 754-0714.</p>
        <p>lOSMusiol instniments</p>
        <p>SRS^o^SlS'a^^</p>
        <p>set of Tama-Rock drums. Call 7SM471andaskforTom. fsiiALr one full-size cello, pood condition, grMt for beginn-Rgstudant. Call after 1:30, 355-3m for details.</p>
        <p>HAOSTROM ELECTRIC OUlTAft, (yaquisfo design, and cam. Excellent condition. $750</p>
        <p>negotiable. 355-4437._</p>
        <p>MUilCAL AND PA equipment. We install church PA,1^y, sell, trade and rent all types of musical Instruments including PEAVEY. Mac Stewart Music, 3730 East Ash Street, Goldsboro. 791-0130.</p>
        <p>U6 TRUMPET for ule. Used ume Mnew.</p>
        <p>YAMAHA ORANOpianos, used. Only 33999. Piano and Organ Dtofributers, 3554003. VamAHA ELECtONE organ with synthesizer, a few years , oM, 33300 negotiable or willing to .trade restaurant equipment. Days 7534333, nights 757-1314.</p>
        <p>' YAMAHA PCR-OM organ, plays by card, like new. 31400 wgoNa-btoCall7S4tU^^</p>
        <p>112 Woodstoves ' SlSAuflfuLl^^^^E!</p>
        <p>heats entire houM without a</p>
        <p>- noHv tan. 3135. Call 355-7700 day,</p>
        <p>- 794^99 night.</p>
        <p>reHiT</p>
        <p>FIREPLACE Mr, flat surface for . cock^, 3300. Call after 4 p.m..</p>
        <p>: 114 Instructioti</p>
        <p> fnRrWBfTf5^TAgf!</p>
        <p>*Tour Guide, Airline Reserva tionlst. Start locally, fuPlme/</p>
        <p>&amp;gt; part-time, train on live airline computers. Home study and res-</p>
        <p> ident training. Financial aid 0 available. Job placement - assistance. National Head-</p>
        <p>&amp;gt; quartars-LighthouM Point, FL.</p>
        <p>* A.C.T. Travel Sdmd.</p>
        <p>1400-337-7730.</p>
        <p>. AcoraWtad member NJM.S.C.</p>
        <p>115 Loot A Found</p>
        <p>WT ^^^^hxnate! Irish tram Wsslha Bob, 754-3999.</p>
        <p>-Setter tram Wssthaven arw . Contact</p>
        <p>apMtment</p>
        <p>1,2&amp;amp;3</p>
        <p>Bedrooms</p>
        <p>WITH FIREPLACE * CEIUNQ FANS</p>
        <p>Je</p>
        <p>$9S Security</p>
        <p>OAiaMonlh</p>
        <p>WaahorfDryar</p>
        <p>Connaetiona</p>
        <p>Pato</p>
        <p>Altovmd.</p>
        <p>Mow Offering</p>
        <p>Now units avallabla. Ceinptoto with waaliara, dryora and loamakara.</p>
        <p>MONOAV-FRDAY 9:304:10 SATUROAV124 SUNDAY 14</p>
        <p>lilt Mda Cheto</p>
        <p>If Hoot Odw.</p>
        <p>355-2198</p>
        <p>li|Ml Hieiie8 OppertiMiity</p>
        <p>115  Lost A Found</p>
        <p>LOST: tiack Lab. all Molly at 757-3317.</p>
        <p>Ill</p>
        <p>Business Srvicot</p>
        <p>eO'S^^^teStoRJta?</p>
        <p>walls, uphoislery, carpet; vinyl repairs, cleanlM, recoloring. Frw estimates. 74437.</p>
        <p>122</p>
        <p>Busintu Opportunities</p>
        <p>TSoSI^Syl^U^aw</p>
        <p>business with C.J. ^is A Co., Inc. Financial A Marketing Con-sultants. Serving the SouthMstern United States. Greenville, N.C. 355-7799, nights 7#-8444</p>
        <p>duN 9HP FBI SjiLl:</p>
        <p>I: Ongoing business. Inventory and flx-turas. Call Linwood G. Bo^ RHitor 79^5135, Wllllamsfon, NC.</p>
        <p>LOCAL ROUtE FORSALE</p>
        <p>Local route tor mIo. No selling. CoHaction only. Will require 313,050 cash InvestiTMmt  In-vastment secured by equipment. Net Mrnlngs on existing routes average 3393-3450 par weak. For additional Information, call 1-000-3474553 or write Tech, PO Box 373, Jonesboro, Georgia 30337.</p>
        <p>SNACK VENOINO</p>
        <p>Hottest Machine In YMrs.</p>
        <p>Retire In 10 years. Unbellevablo return, possible 3 to 4 months. No com^ition. Work 1 day per month. 50 secured locations. 3A000 to 330,000 in vestment. 14004744144. Ext.13.</p>
        <p>TINDER BOX</p>
        <p>INTERNATIONAL</p>
        <p>FRANCHISE AVAILABLE GIFTS. PIPES, CIGARS FINANCING AVAILABLE PROFITABLE ESTABLISHED BUSINESS</p>
        <p>Call today 1400-3334334.</p>
        <p>124 ProftSSkMMl</p>
        <p>Holloman. North original chimney</p>
        <p>Carolina's sweep. 30</p>
        <p>years experience working with chimneys and fireplaces. FIreplaoe repair, chimney caps Installed, screens for chi</p>
        <p>tops. Call day or night, 7S3-: Farmvllle. tK.</p>
        <p>132 ComnMrcial</p>
        <p>a grMt locatloni This bulldtog hM 5 offkm In the front with a large starim arM In the back. The 5 efilces. kitchen, 3 bathrooms, conference room,</p>
        <p>WW KHWy IIWKW mis m GOfnpiSIS</p>
        <p>psdUMS for sny bvsifMSS* OMI JlmHllI CENTURY 31 JANET BOWSER A ASSOCIATES, 395-7100.</p>
        <p>PRdALiLdAiC. Approx</p>
        <p>Imately 10.000 square warehouse and office q Greanvltle.Cail75^7333.</p>
        <p>feet</p>
        <p>In</p>
        <p>BREAT COMMERCIAL</p>
        <p>iBTn</p>
        <p>Grlfton.</p>
        <p>lST</p>
        <p>on</p>
        <p>oximately 1.4 .</p>
        <p>IIS between A'</p>
        <p>It. Call Roi atJ. L.Harrtef 471 lor 534-9433.</p>
        <p>m  oommardal</p>
        <p>property on HJghwwy Q. 3130 perroad........</p>
        <p>Sa30I; Bill Fan.'</p>
        <p>3S4444Qr 7944953. rAeMWACTnaaraifpori: CHy wafer fiable, oouM be uM for moblto home park. Call Elizabeth Modlln at J.X. Harris ASons, Inc. 790471 lor 753-3947.</p>
        <p>134</p>
        <p>Condominiums</p>
        <p>ForSolo</p>
        <p>TSSSIT</p>
        <p>TOWERS If you haven't soon thoH delighHul Nudsnt condos, you've missed the best housing on campus. Ex-collont pricing and financing. Whether Ifs one occupant or four, we can fill your needs. UnlversWyMfy 355-5044; Jean</p>
        <p>M^Fornm^rSnl^</p>
        <p>TSB!"</p>
        <p>Grnanville just 4 mites oN 344,44 acres clearad, 35 wooded, good tobacco and peanut allotmants, 313SJM0. Call University Realty 3SS-5044or Jack Horton 7544797.</p>
        <p>700 ACRES, dgecombe ounty, 35 mites from Greenville. Mostly cleared land. Very prodiictive farm with good fobaccoiteanut allotments. Owner will consider selllnjt part or all. Alw 30 acre tracks adjoining property. University RMlty 355-toM or Jack Horton 754-fW.</p>
        <p>74 ACRES wHh 34 claarod; 3.04 pounds tobacco, 3319 pounds peanuts. Located South of Stokes on Hww 30. Price 37A0Q0. Call Worley Warren at Aldridge A Southerland, m-3500; nights 795-3333.</p>
        <p>WANTING TO RELOCATE!</p>
        <p>Red Oak Plaza is now in the process of interior and exterior remodeling. Office or commercial space can be designed for your individual needs. Extremely reasonable. Call now 757-0123 or 756-0765.</p>
        <p>SUPER SUNDAY OPEN HOUSE 21114 pm</p>
        <p>tot aoeiaw soao. coioim NiNMa, lomiU Ikrtno md iMn-teg aien temed ytrd, Me ol eteitei OMOttonK Frem I9i MM iwn NwOi on VuiNordwi L M nodmwi nood. M4,tee.</p>
        <p>MK no. KINO ST Compite ly wmDdilid homo with a tun eswn, loietnod poitei, oiim tergo hNoiwn, tpoolouo grate nmm. Oractlona; Tako  lo MU. turn Ian on Kino Nnte</p>
        <p>goMoaiTt ciue *ni. muWuI homo on bonulllul hM mm teMteunr doooraiod. txrao-UOM: turn noed w Countiy Oh*. iMuaaon rtghl. sn JH</p>
        <p>mm WHh nloa brtok nemo.</p>
        <p>tweor^DhocSwn******** SM OMttoMwwdoCroooM Turn Ml, tiral houoo on lott. oteraH</p>
        <p>nee iwrae wHh aioli windowt and akyXiMt. ) bodraoma, 3 etetw and douste n*n* oraai tew OdlllH atetetee: Tita II le *11 lum Ian tetera tteh en use and Mlew alona.</p>
        <p>a aie and ioHo Opmi</p>
        <p>BLACKSTONE</p>
        <p>REALTY</p>
        <p>':i 6-908</p>
        <p>Property Owners</p>
        <p>...got a light sJtch that doesnt work?</p>
        <p>...a leak under a sink?</p>
        <p>...a door that doesn't close securely? ...shingles blown off?</p>
        <p>...a hole in your sheetrock?</p>
        <p>...soiled area in carpet?</p>
        <p>...a closet shelf falling down?</p>
        <p>Why Call</p>
        <p>...an electrician ...a plumber ...a locksmith ...a roofer ...a drywall man ...a carpet cleaner ...a carpenter</p>
        <p>NOW...YOU CAN CALL ONE NUMBER. 75B-3720 A RECEIVE AU THE SERVICES LISTED ABOVE!!</p>
        <p>WE OFFER 7 YEARS OF EXPERIENCE IN RESIDENTIAL MAINTENANCE.</p>
        <p>NO JOB TOO SMALL!! COMBINE YOUR ODD JOBS A GIVE US A CAUII</p>
        <p>Monday-Frlday 8:00 a.m. *tll 4:30 p.m. CALL 758-3720 For FrM Estimate.</p>
        <p>7 YEARS OF CATERING TO APARTMENT COMPLEXES IS NOW AVAILABLE TO YOU. THE SINGLE UNIT RESIDENTIi</p>
        <p>Speclalldng In Rental Property Tumoma</p>
        <p>rameo east.</p>
        <p>144 MomBtPorlBtR</p>
        <p>ITWmm iveryfyng</p>
        <p>you've wanted nd nwral Tim xgcutive homg offers 4 spMlout bedrowhe, IwMl otoM with ta^iood nmri. toige Mt-ln kHchon wHh Jetm-Ira range, gvaniaad dm wHh Mlt-lne, ptoyroom (or 5th</p>
        <p>Watl-cgrad for homo In mbit ..... 3700</p>
        <p>ALL YhI AMkNITIIS you'd for enhance the olggance of thie bMutltwl four bedroom homo locotod In Wotlhavon VI. This homo will tfoal your hoort at 3144J00. Call Anita Worthington. GRI, Aldrldgo A SoutiNrtwid RMltars. 7544500 or3954441.</p>
        <p>kl9^VAldANt6 voforoni Roducod to . M lovoly 3 bodroom homo to 0 grMt locattan to randy for your fomllv. Coll AiMta Wor-IMinfon.'GRl. Aldrldgo A Smrniirtand.</p>
        <p>4441.</p>
        <p>mmkii</p>
        <p>qyallfted vof</p>
        <p>m.m. m%</p>
        <p>AUrMgo 7944930 or 355^</p>
        <p>AYDtR-Youcanpayoquityi</p>
        <p>  i^lltyl</p>
        <p>at country to grMt room, wltn</p>
        <p>tog</p>
        <p>oiwmothlaFHAnon-quoll loon; brick ranch hat docor in grMt roor tireptece, three bedrooms, two baths, front porch and dock, fonnd In yariL 344,900. Coll Suo itAtorldgoAS</p>
        <p>Dunn at Aldrldgo A Southarlond 794-3900, nlghti3SS-3SOO.</p>
        <p>tLVROeRE. For Hw family who nood too moot epaco tor tho dollar. Ovar 1900 iquara foot to-cludos formal araat. dm, 3 badrooms, 3V5 baths and study. Extras Include ecremed porcn. wooded M, oiaumabte loan, hardwood floors, immaculofo. 304,900. Ask for Suo Dunn at AMrtotao A Souflwrland RmI-tors, 79A3500; nights 399-3500. trhfEL - xcoltent for first time home buyer. 3 badrooms, 1 bath, living room, dining room  kitchon combination. 330,000. Coll Bradtey Gray 753-3499 or Univarslty RMlty ^5044. #373</p>
        <p>SEARCHING for tho right townheuM? Watch CloiNfM ovorydoy. _</p>
        <p>144 HmiBeB For S4lt</p>
        <p>and dotirabh Graotroom am</p>
        <p>4----w.- - -a</p>
        <p>toHodouo and foaturgo buUt-to nflGrauigvg, dMk, gnd brgskfgst grw. L900. Ta sm&amp;gt; cfil Nancy 0u3ay. Aldrldga A Southarland  I. 794^, days, or 794-</p>
        <p>S99Lavmtogs.</p>
        <p>bITMIl - Varyattraotivaoldtr homg, 3 sfo^, four bsdrgoms, I bath, qufot nslghborttood. Unl-vartlty Raalto 3S9-Stf4 or Brodfov Gray 7SMM9.1349</p>
        <p>mStsrsi</p>
        <p>, MMtwostory - araai, dm, fincad to yard and detatfted goragt, vinyl siding fofldw matofteianoa. 944,900. Ask for Suo Dunn at Aldrldgo and Southarland, 756-3900 or nights 355-290A</p>
        <p>lilitAk Hii IIMY'HaLiti Fi</p>
        <p>nally a Witm badroo, 3 bath bride homa to an axQsitent arm</p>
        <p>you can afford. Ovor 1370square M Include graalraom with flraplac*, aat-to kitchen, fenced yard and larga daiachid^age, ULfOO. Aek for SuaOwmd Southgrtond, 754-</p>
        <p>iiiTTATV</p>
        <p>TnreTwrap</p>
        <p>around front porch tovilee you to this brand new home with loigo graotroom with firoploco, mostor bodroom downstotra, dockand ,NO.CaliSut Aldrldga A nights</p>
        <p>two upstairs, Stobaths. scramad 00^ 017,100 Dunn at Call Aldi Southarland 7S4-3S00,</p>
        <p>355^3510.</p>
        <p>ilgat VALLiY-slBrSS luxury homa an Ihf goH couTM. All formal araas, 31' x 23' family room, master bedroom auifo ontronco to</p>
        <p>amago. OMSJOO. Kll Bovtrly Quoon at Aldrldgo A Southarland. 754GS00; nights 757-0434.</p>
        <p>AXllA6-For tW family that noodi four bodrooms at o modosf prtcot LIsfod for 045,900 this Capo Cod hot a grMtroom with flraplaoa. Iwalpump, fonc-od to yard. FHA men^lifytog lorn assumption is a bonus. For turtoor Information ask ter Sue Dunn at Aldrldga and Southarland, 754-3S0A nights 3SS-25S0.</p>
        <p>FOR SALE BY OWNER</p>
        <p>3 bedrooms, 2 biths, hardwood Hoort, largo mostor bodroom wHh a&amp;lt;4oining drossitig room Bd|acont to bath wHh tunk-on tub, Blato onby, formal living room and dining room. Kitchon and dinetto combination with many extras such at built-in dusk, two walk-in pantrios, rook mapio cabinots, and built-in laxy Susan, laundry room, Btudy, douUo car garaga and ou^ side shop aro some of tho many faaturaa of this homo in tho Oakmont saction. For appointment, call 756-2281.  !</p>
        <p>AROUND TOWN</p>
        <p> One, Two &amp;amp; Three Bedrooms Available { o Private Patios, Clubhouse and Pool o A community of families, professionals &amp;amp; students o 24-Hour Maintenance o Minutes from ECU and Medical Center</p>
        <p>752-4225 1400 Willow St.</p>
        <p>1 Bedroom Specioll $3IX) Off First Month's Rent.</p>
        <p>Hours; 9-5:30 Mondoy-Fridoy, 1-5 Sbtufdoy &amp;amp; Sundoy Professionolly Monoged by Shelter Monogement Group</p>
        <p>144 Houses For Sato</p>
        <p>  tour</p>
        <p>m wHh ^age. Vahte packad at 9110000. ^ tar AnitanMortlitogton, GRI. AM|^ASouflteHaw079A3W</p>
        <p>ivmwtoifearijg</p>
        <p>divisen. 3 badroom. 3 bath ranch WHh deck, 14x33 Shop garage, new 9H pack and roof. MM 940's.7A45T</p>
        <p>AMiLV-ChKk out thSM numborsi Four bodroonts, throo full bathe, over two thousand tqMra foot for only 394,900. Ad-3nmI foatuTM includo, don, dtotog room, tcrotnod porch and garago. Must SM to btllovo. Aik^ &amp;amp;I0 Dunn at Aldrldgt and Southorland, 794-3900, nkdllt35S-2W3</p>
        <p>ttiTBAL' LtAYiON and convontenct along with affor-doMllty con bo yours to this thrM bodroom brick homo, largo oat-to kitchen and foncad to yord. 9M900. Call Sue Dunn at AMrlte A Southarlond. 754-3500; nips 3S5-25M. CHARMIN 3 bodroom. 2 battT brick homo. Situated on boouflful wooded lot In Country Club area to Griffon. If you art loaking for o rMlly nico homo -look no furthor. Cnorlio Forbos 754-7157 or University RMlty 355-5044.1343</p>
        <p>CLkVEWbOO 1JOO+ souare foot on lorgost lot ta subdivision. Buildsr will contribute soma oqtots and/or doelng coots. Rumbtey RMlty, 3S3-20l2; Janot Rhxiarolll, 744^1.</p>
        <p>144 Housts For Sato</p>
        <p>kikRY OAKS By Ownor-i squara teat. 3 bodrooms, 2 baths, oxtro larga grMtroom with firoploco, largo kitchon, braanfost room, formal dining room, utility room, offlco and garago. Nico lot. |3I,900. 395-&amp;amp;4 or 754-2904.</p>
        <p>RIklY~5Xki  Cmtom porary Styling combinad with comfortabw aasy living, this homa teaturas laraa master badroom and bath. Formal llv-Ing raem, dining room, sunken grcatroom with fireplace overlooking fenced and wooded</p>
        <p>beckyard. 3 badroom/2 both. 399.500. Call Aldrldgo A Southorland of 754-3500,'</p>
        <p>Kothorlno Vtoson 753-5778. ffRRY OAKS &amp;lt; a premium notghborhood and premium homo. Wrap around porch highlights this 3-4 bodroom, 3Vi bath, 3 story farmhouM. Glowing bricfc wood burning firoploco with built to sholvos and cabinots odd comfort and function to your groatroom. Formal dining room. Pricad In the 390's. Call ERWIN REALTY 355 7078 or Jim Burhans 355-5337.</p>
        <p>SkRYbAKi-FAtholar famllyl This lovoly, talnod homo with 3 bedrooms, 3</p>
        <p>large</p>
        <p>main-</p>
        <p>full baths, family room os well as formal areas Is situated on o lot. Home</p>
        <p>picturesque has over 2J</p>
        <p>3500 square feet and alM foahires a super nice office . Wcedi</p>
        <p>or 4th badroom.</p>
        <p>I to Mil at</p>
        <p>3109,900. Cont^ Mable Savage at CENTURY 31 JANET BOWSER A ASSOCIATES, 355-7300 or 754-3090.</p>
        <p>144 Houses For Sale</p>
        <p>CLOSE tD ARLINOtONI Brick, 3 bedrooms, 1V5 baths, large family room. Largo tancod to M with lanWcaptog and path) with brick BBOTSh^ traaiNind storage building. Univarslty RMlty 359-5144 or Gall Johnston 355-7914124A</p>
        <p>CLUB FINES-boautiful 4 badroom, 3 bath two-story on lovoly woodod lot. Salters trans-torrad, nood to move quicki mi University RMlly Joan Hopper 754-9143.</p>
        <p>UNTRY HOME - On Stan tonsburg Road. Brick, 3 bodrooms, 2 baths. Tasteful dscor. Located on large fenced tot close to hospital area. Unl-vorslty Realty 355-5344 or W. Bradley Gray 752-3499. #247</p>
        <p>144 Houses For Sato</p>
        <p>NtlMWiiABY idVlit Largo graotroom. with flropiaco. with calhodral coll-Ing, 3 bodnMHiL 3 bathe, hMt pump, woM dock, on a beautiful vvoodid lot. Spodal pricod at 349,900. Coll Sfovo Evww RMlly 359-2737.</p>
        <p>CONVkNIENfLV LtAt^b brick ranch offors 3 bodraoms, m baths, formal living room, don, onclosod porch and fon^ back yard. Blanche Forbes R alty 754-2131 or J.C. Bowon 754-7424.</p>
        <p>COUNTRY LIVING 3 bedroom, m bath, Nice count^ kitchon, payments based on Income. Call now for details, AAoMley Insurance A Realty 355-5047.</p>
        <p>MOVING?</p>
        <p>For free informaiion on housing costs, taxes, schools, etc., across the street or across the nation, call toll-free 1-800-523-2460, ext. G849</p>
        <p>THE REAL ESTATE CENTER</p>
        <p>355-6666^</p>
        <p>211 Commerce Street, Greenville</p>
        <p>OPEN HOUSE 2:0(M:30 Coopar Strate In WInMnllle</p>
        <p>FEATURED LISTING -</p>
        <p>(XIAFTWIN08: Compare this custom 3 bedroom, 2V4 bath, 2 story home with others in the MlD^Os. Youll be impressed! See it today! Your Host: Richard Allen.</p>
        <p>BRITTANY RIDQE. New traditional home offering great floor plan, including 3 bedrooms. Formal dining room, eat-in kitchen with bay window. Fireplace and many other features. Call today for your exclusive showing. Mid 390s.</p>
        <p>9 V4 %</p>
        <p>3 Year fixed on owner occupied homes.</p>
        <p>Call for Details!</p>
        <p>I</p>
        <p>ALTONS TRAIL. Immaculate cedar home, over 2500 square feet. Hardwood floors, rustic eat in kitchen with Jenn-aire range, double fireplace in greatroom and a master suite with sauna. Located on a large wooded lot. $131,500.</p>
        <p>RANDOMWOOD. Contemporary home in excellent condition. Offers unique floor plan with over 1,900 square feet. Located on large acre wooded lot. Mid-nineties. Call Tim Smith for appointment.</p>
        <p>COUNTRY LIVING just outside the city. This country INilliamsburg offers gracious living at a slower pace. Over 2000 square feet and 4 large bedrooms make this an outstanding value at $87,900.</p>
        <p>THE FIRST to see this immaculate split level. Peafturee 3 bedrooms, 2V^ bathe, wet bar^deck and pnuch more. Owners are anxious to sell, so call us today.</p>
        <p>brick home has a well landscaped yard and an assumable 9.5% loan. $58,000.</p>
        <p>BE THE FIRST TO SEE this immaculate brick ranch In Orchard Hills. This well cared for home includes 3 bedrooms, 2 full baths, attached garage, deck and 4 ceiling fans. Affordably priced at $54,900.</p>
        <p>BETHEL. 3 bedroom br|ck ranch offers greatroom with fireplace, double garage and central air. Located on nice private wooded lot. $43,500.</p>
        <p>OWNER READY TO SEU. University area home has 2 bedrooms and 1 bath with large screened porch and deck. Located on a nice corner lot with mature trees and detached garage. $44,000.</p>
        <p>NEAR WMTERVILLE ofl 1.2 acres. This 1,485 square foot brick ranch offers outstanding value to the per son that wants to be in the country. $39,000.</p>
        <p>THIS CHARMING RANCH With its many extras may be just what youre looking for. Its excellent condi- INVESTMENT PROPERTY! 3 bedroom house offers tkm and super location make it one you dont want good cash floor, annual rent $3,600 and priced to to miss. Call today for your personal showing, sell. $31,500. Call office for details.</p>
        <p>$87,900.</p>
        <p>YOULL BE IMPRESSED with this new 3 bedroom ranch situated on a wooded lot in the Winterville Area Excellent floor plan. Mid $60a</p>
        <p>REDUCED. OWNERS READY TO SELL. Farmvllle, just North of town. Quiet rural neighborhood with a new atx)ve ground pool. Freshly painted outside this</p>
        <p>Richard Allen..</p>
        <p>..On Call....756-4553</p>
        <p>Edgar Wall</p>
        <p>33(M78</p>
        <p>Sten Joynar</p>
        <p>Tim Smith</p>
        <p>7SA4007</p>
        <p>3554430 </p>
        <p>Moky Ungtoy</p>
        <p>Jhnmy Cowan 7534333</p>
        <p>7324004</p>
        <p>IAImi --------</p>
        <p>waro mawDom 75SqSS0</p>
        <p>New Homes^Xhoiee Loeatiom</p>
        <p>NORTH RIVER ESTATES. 3 bedroom, brick home attractively decorated and ready to move Into. Call today for your personal showing. High $40a</p>
        <p>BRAND NEW and in the $40a This 3 bedroom brick home with 1V^ bathe is situated on a large lot In the country  Simpson area.</p>
        <p>r-Patio Homes-</p>
        <p>3 btdrooms and 2 tMths  2 badrooms and 2 baths</p>
        <p> Heal pump  (tontral heat and air conditioning  Rear patio  Masonite siding or brick veneer  Landscaped and wooded with beautiful pinaa  Conveniently located  Quiet neighborhood  Affordably priced In tlwAOe.</p>
        <p>CANTERBURY. This charming one story country home in siding has 3 large bedrooms and 2 baths. Master bedroom Is complimented with a double vanity dressing area with walk-in closet. Full length front porch perfect for swings and hanging baskets. Low 880s.</p>
        <p>CANTERBURY - THIS 1% STORY farmhouse plan Is ready to move into In Wlntervifle's newest and most exciting neighborhood. This home offers an entry foyer, formal dining room with bay window and the master bedroom downstairs offers a spacious 15 x 12'6* arrangement. The home also includes a deck. Priced In the 80s, this home offers you 1,7(X) square feet.</p>
        <p>vans</p>
        <p>ompany</p>
        <p>Buiklers, Developers, Realtors</p>
        <p>mmmmmmmmym</p>
        <p>752-2814</p>
        <p>Jack Qordon, Broker 355-6494</p>
        <p>WInnia Evans, Bmkm 752-4224</p>
        <pb facs="00096780_0065" />
        <p>144 Housts For Sale</p>
        <p>COimtRY UVINO but only mhHrtM from Graanvilla. Owiwr MxloM to Mil this 3 bedroom homo on very largo lot. Groat buy wllh ovor 1200 square foot. Prkwl In Itw mid 40's. Unlvorsl-ty^Roalty 3SS-S0M or Glenn MIzo</p>
        <p>m-mLtm.,</p>
        <p>toUNTRY HOME Hleor loasr 3 bedrooms. 1 bath, living room with fireplace, 2 acres. Assumable tOW FHA loan. $395 monthly rent. #214 University Roalty 3S5-S0M; Jean Hopper 7SMI42.</p>
        <p>OUNTkY LIVING just outside the city. This home features throe bedrooms, IV$ baths, huge let and attractive decor. Srs. Call Mary Catherine Spikes at J.L.Harrls a Sons, Inc. 7SI-47n OT7S0-S467.</p>
        <p>eSOBTftY - fteautltuliy ap-polntad home on 3 acres In quiet rural setting. Spacious 3 bedTMm with 2 full and 3 half baths, study, family size kitchen, formal dining area and groat room with rugged wood burning fireplace. CairERWIN REAL TY 355-7070 or Jim Burhans 355-5007.</p>
        <p>COZY TWNHOUSE- xcellent location; hw&amp;gt; bedrooms, private patio, fireplace In great room. $40,900.00. Call Aldridge A Southerland at 755 3500, Kathormo Vinson 752-5770.</p>
        <p>USfM HdM BILDR Will build by your plans or ours. In houM financing with no closing costs. Call 937 6101_</p>
        <p>CLASSIFIED DISPUY144 Housts For Salt</p>
        <p>IMS lovely home located in ous GrayMgh taaturos 4 oms. plus bonus room for . or recreation. All formal areas with hardwood, great room with firqplace. AAany extras. For appointnMnt to soa this exclusivo property priced In the 150's call June Wyrick at Aldridge &amp;amp; Southerland 755-3500 evenings 756-5716.  &amp;gt;</p>
        <p>eORfeklNVkftYgoodcondl tion. Two bedrooms, hardwood floore, llvlng-dlning combina tIon and galley style Call Faye ^art</p>
        <p>tion and galley style kitchen.</p>
        <p>ayeS^artatJ.L. ^  a Sons, Inc. 750-4711 or 753-2000.</p>
        <p>.Harris</p>
        <p>EASY TO OWN at 029,900 and within walking distance of the university. Home has two bedrooms, I bath, living and dining room. Investors delighf. Ask for Sue Dunn at AldrldM a Southerland Realtors, 756-^; nights 355-2500.</p>
        <p>FIVE BEbROOM, 2-story houM for sate by owner. Big kitchon, m baths, large lot, new vinyl siding, 400 S. Lee Street, Ayden.</p>
        <p>bedr*m</p>
        <p>IS, m</p>
        <p>FMkA kOM 3 baths, excellent condition, large lot. 4221 University Realty 355-5066; Jean Hopper 7519142.</p>
        <p>In quiet</p>
        <p>wooded Treetops, 222 Hidden Branches, 2 bedroom, 2 bath Villa. Fireplace, great view, all appliances Including washer/ dnrer. Pool, tennis. Bargain at $43,500. Call 755-4166.</p>
        <p>CLASSIFIED DISPLAY144 Housts For StIo</p>
        <p>tkClLLtNt Ld^ATlSB Custom buitt ranch stylo homo. 3 bodrooms, 2 baths, living room, dsn with firaplaca, dining room, carpwi and back scraanpd poreh with patio, on a boautifui wooded loL One year Homo Warranty. Prkad to Mil quickly, $04,900. Call Stove Evans Realty 355-2727.</p>
        <p>MCIPtloBALLY WClT maintained 3 bedroom home situated on a large comer lot. Sunken living room with flrepiaca and numerous other amenities. Priced to sell at $52,500. Contact Mable Savage at CENTURY 21 JANET BOWSER a ASSOCIATES, 355-7100 or 755-3090.</p>
        <p>; Joan</p>
        <p>OOROEOUS NW home, ready to move rl^t Ini Stately 2-story on large corner lot In Windsor. 3 bedrooms, 215 baths, huge groattoom wHh fireplace. University Rsalty 3555066; Hopper 7519142.</p>
        <p>OkAt LOAk ASiUMPTlON No quallfylngl 9V5% FHA loan assumption on this 3 bedroom home In Camelot. Home fMturos groat room with built-Ins, large oat-in kitchen, and garage. Price reduced to $77,900 with a loan balance of SM,000. Monthly payments $610.57 PITI. Call Janet B(^, CENTURY 21 JANET BOWSER a ASSOCIATES 355-7000 or 751 3090.</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>At Hastings Ford, Eastern North Carolinas premier Ford dealership, we are in need of a weil trained Body Shop Technician for our 'service department.</p>
        <p>We in turn offer our employees one of the areas best benefit programs, including Insurance and vacation. If you think you are qualified for this position, please come out to Hastings Ford and see Her^ Powell In the Service Department for all the details.</p>
        <p>"On the other aide of town, but well worth the trip</p>
        <p>e</p>
        <p>A Race ybu Can Count On</p>
        <p>HASTINf^FORD</p>
        <p>I0tn Street &amp;amp; 264-Byiiass  GreenvHe.ilC  19-7S8-0114</p>
        <p>FOR A GREAT SELECTION ON dIEW &amp;amp; USED CARS</p>
        <p>WYNNE CHEVROLET</p>
        <p>CARS JUST OFF LEASE AT A SAVINGS TO YOU!</p>
        <p>J</p>
        <p>SALE PRICE</p>
        <p>1985 Pontiac Grand AM LE 2 door mm m m</p>
        <p>Burgundy,loaded,48,500miles.  P*'</p>
        <p>Or lease for24 months for......... &amp;lt;Cl9month  w</p>
        <p>1985 Nissan Maxima Wagon</p>
        <p>Metallic beige and brown, loaded</p>
        <p>with sunroof. Extended warranty.  #   A  mm</p>
        <p>32.500 miles. Or lease for  P*'  ^  I  T#</p>
        <p>24 months for..................ZoS  month   4m f  0# W</p>
        <p>1980 Cadiliac Fieetwood Brougham</p>
        <p>Medium metallic blue,  R *1  K</p>
        <p>loaded,54,000miles.  P*'  13m# 3U</p>
        <p>Or lease for 36 months for month   I * ^ ^</p>
        <p>1987 Ford Escort GL 4 Door</p>
        <p>White, automatic, air, power steering and more.  ft jr M m</p>
        <p>22.500 miles. Extended warranty.  Pr</p>
        <p>Or lease for 48 months for........... 140 month  ww  ww hm ww</p>
        <p>1986 Jaguar XJ6 Sedan</p>
        <p>Cobalt blue, loaded, 28,200  a  h  a</p>
        <p>miles. Extended warranty.  - por  i  T KB  1</p>
        <p>Or lease for 48 months for.*594 month thm  I f</p>
        <p>All leaaoB raqulra Mcurlty depoilt equal to ont tnonlh'e paymant and tirti month's pey-iment on delivery. Tex and tags extra.</p>
        <p>All Makes and Model Vehicles Available 24 - 36 - 48 - 60 Month Terms</p>
        <p>nA/lew^ou9TiUtfc tSGosig,  jofease^W)."</p>
        <p>LEASING PROFESSIONALS, INC.</p>
        <p>3101 S. Evans Street Greenville, N.C. 27834 Call: 355-2788</p>
        <p>144 Houses For Salt</p>
        <p>P4AALI! by owner SuMlvlEion, appTOTlmafaly</p>
        <p>ISM square foel.abodroOT, 3W bam. formal Ihring rwm, formM dining room, kitchon with</p>
        <p>gira^, lo^rfo^ 1M6 In8TliS''5rJ5a'S</p>
        <p>$109,905. Shown by appomimom only. Coll aftar 4p.m. waakdays, viMkinjS. 7512299.</p>
        <p>m lALt Tt OWNES 3 bodroomt, 2 baths, firaplaoo-Low aquHy, amumo loon. 752-7607.</p>
        <p>SCI The oNfiV LVriR</p>
        <p>In you thli ipaclous ranch Is on ovor an acra of land. If hat all formal araat, huga dan with firaplaca, aat-in knchon, tMw baS^t, 2 baths, and ooragt unballavably pricad at tM.9W. Ask for Sue Dunn at Aldrldga I. Southarlond 756 3500, nights 355-2508.</p>
        <p>POUR kCOkoOMS at a roa-sonable prica It hard to find, but we have it. Ovor 1700', 2Vk botht, fenced backyard, pricad In the SSO's. 1209 UnlvorsHy Roalty 355-5066; Joan Hopper 7519142.</p>
        <p>CLASSIFIED DISPLAY144 Housts Far $slo</p>
        <p>dltlMllin-Thls iiom^ Nofurw fhroa bodroomt, extra cIomN. larga tancad yard and N</p>
        <p>Kicad to sail In fht 40's. Coll ary Cafborlna Spikat at J.L.lari1t S Sent, Inc. 7S0-471I orm-5467.</p>
        <p>AAiPfM UNTkY Lub</p>
        <p>SETTINOj GoH corf dittanca from fho courM. Ftvo/Slx bodroomt. 3W balht. Thit lov oMo floor ptain offart all formal araot, hardwood floort, douMo garage, and a back yard made tar anfarfainlng. $135,000.00. Call Aldridga S, Wharlond at 7513500; Kolharina Vinton 752</p>
        <p>5778.  _</p>
        <p>RlPtON-Malnfanco free ranch taaturliw larga living room wHh flrepwoo Interf, huge kHchan-dlnIng room combination. throo bodroomt, two balht and ftncad backyard for privacy. Wt Call Jan Cox at J. L. Harria A Sant, lnc.7S147llar 8305311.</p>
        <p>CAlMiilAilO  brick, 4 bodroomt, 3 botht. axcaltenf floor plan, lecatad on ivgt let In tubdMtion. Call Unlvartlfy Ra-aNy 3515866 or Gall Johnttan 379S4.f230</p>
        <p>CUSSIFIED DISPLAY144 Houses For Solo</p>
        <p>MBILS HOME-Iwo bodroomt on largo lot. Coll Faye Stawari, J.L. Hmit and Sant 7514711 or 7S120S0</p>
        <p>NIB NSfkuCtiN. thit now h-adlflonal It at the ond of a fdtf, no-lhru ttraef In lovoly Eatfwood. Foaturts aat-in Mtafwn with pantry and toll of coMnol tpaco, greatrooom wHh firaplaca, plut 3 spacious</p>
        <p>_____________balht, ond formal</p>
        <p>dining room. Large dock for your owldoor onfortainlng. Quality oonthrwctlon thruout ond the In the neighbori^ol $12,900. To MO, call Nei^</p>
        <p>0</p>
        <p>nNW HOME IN ^morftohT Comfort and styla! That's whal you'll find In this new 3 bedroom home. Formal dining, large aat-in kitchen, greafroom with firiplaoa are fust a few of if t foofuret. And you know If t quality conttrucfed becauM ift BOWSER BUILT. Bulhfor will pay up to$2jl00 In doting costs. Sat Janet Bowtor, CENTRUY 21 JANET BOWSER &amp;amp; ASSOCIATES 879,900. 3S170M or 7510500.</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>-----1</p>
        <p>144 Hsuiw Fer Sale</p>
        <p>144 HeustsFerSsIs</p>
        <p>144 Hsuast fer Salt</p>
        <p>HdAirBNfitkV-enipylfie</p>
        <p>caunlry M anwll iubdlvMan only mbwfoa from Graanvllla. This contemporary boasts 3 badroama, 2 fuH battis, garaoa, dining and apt hi kitchan an 3/4 acre M. Brodimr Gray 752-3699 or UMvorsHy Realty 355-5166. 1241</p>
        <p>fMMtWATI FRliSid at $69,900. You could bt living In IMe 3 badroom, Contomperory today. Al$e faaturis; groat room. Hvfng room, dining ream, and oaf-ln kitchan. Now carpet and nowly polnfod Inside. Ownor anxiaua fo^l. $09,900.00. Call AMrite S Soulhortand at 755-3500; IWlMrlnaViMan 792-5770.</p>
        <p>yillo's fbiar neighborhoods, this ffiTM bsdroom ranch has racanf-ly undsrgona soma ramodaling, hicluWiw a new roof and fiw paint. The extra lof^ kitchan, living room, groalreein, and play room ware certainly designad for entortalning. Large size lot, toncod back yard,</p>
        <p>and screonad back porch are but</p>
        <p>tous ^girM? * oao^^M ffrsBiaoe. large country klfcim wimbey wmm. Amo tbroe badreoms tncluSng a largo mostor suHa. Only mmutoa from the hospital and ownor is anxious to^l. Priced In the 00's. Coll Garry Lombart, CENTRUY 21. JANET BOWSER ft ASSOCIATES 355-7100 or 355-im.</p>
        <p>tov^homa. Pricad to Mil at 999,900. Soa Moblt Sovago, CENTURY 21 JANET BOWSER ft ASSOCIATES, 395-7100 or 796-3098.</p>
        <p>UIV At PuMe ilSlfTi This darling four badroom one and a half both homa has greafroom wllh HrMlaca and garage. FHA</p>
        <p>rwws.'ssws</p>
        <p>Sue Dunn af Aldridga and Souttwrland. 796-3500 or 355-2911.</p>
        <p>MaiNTANC fraa brick ranch with throo bodrooms, hardwoods under car^, spSKtowa</p>
        <p>utility room, and lo^ toi^ yard and outsMt storage. Coll R^ Oavon^ of J.L. Harris ft tons. Inc. 750-4711 or ^4402.</p>
        <p>lAN6I Atbil N5M -</p>
        <p>Recently tekan into Historical Oistrid in downtown Kbistan. New vkiyl siding and roof. Ap-</p>
        <p>Unlvarslty Raalty 359-5066 or Judy Sadewski 523-9060.1260</p>
        <p>DICAL CiNtIA aIIa. This 3 badroom, 2 bath homo toaturos vaulted grsatroom wHh antlqut brkk flrepiaca, formal dining room, and spacious kitchan. Oversized saparato garage Is wired and has planty of room tor father's toys. On a large lot. Priced to sail of $M,500. To SM, coll Nancy Dudley, Aldrldoe ft Southerland RMltors, 756-^, days, or 754-S996,evanlngs</p>
        <p>LlAsi WitH eptlon-Super</p>
        <p>  *-ii iiah   41</p>
        <p>nBiOHDOrnOOCHnrBB DBOrOOIflSa</p>
        <p>m oaihs. Now roof. Call Faya Stowari of J.L. Harris ft Sons, Inc. 790-4711 or 793-2000.</p>
        <p>LVELY FAMILY HOME toafuros 3 bodrooms, ivs baths, contral hoaf/air, patio, carport and storage building. Blanche Forbes Raalty 756-2121 or Wll RaM752-M0f.</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>CLASSIFIED DISPUY</p>
        <p>^IjOOOBack!</p>
        <p>Just w4ienyc)udioi]^ the idbatesvvere over, Leith Qcls/^6ssanbr^^ than bade! Now you can take advantage of tnity9at savings. Because i^iKM.Iaaiiinted time onty,you can stiii get  rebates (XI our oitkeseiectiondb^ new, 1987and 1968OidsmobOe</p>
        <p>and 1987rissanino^Gveusatiy and youll see theiesneverbeaiabeltertiinetobuy!</p>
        <p>HELD</p>
        <p>OVER!</p>
        <p>aeOOCashBackOnAUNew 1967and 196801dsmobUes!</p>
        <p>Nowyou can  all the luxury OldsmobQe has to offer-^and  it for less fixxn Leilh</p>
        <p>Qlfe/^fissaa ^^^Wl you bijy a riew 1987ex'1988 Olclsmobile, yw can eiqject to fiiid outstancSr^ levels (rfsif)efkxC|ualily(]ualityyoulaiow is Ixdh in, qjuafityyou can see and feeL \buU cunoitty fiid a great selection (il trand tiew (TKxlds  in stock. QKXjse</p>
        <p>the (xiethatsr^ for you and get *1,000cash back when you use this (xxflxxi!</p>
        <p>$</p>
        <p>r</p>
        <p>I I I I I I I I I I</p>
        <p>L</p>
        <p>*1,000Cash BackOn All New l^^Q8sans!</p>
        <p>CASH BACK!</p>
        <p>LEITH OLDS/NISSAN</p>
        <p>Redeem this coupon for 1,000cash back goodtowaid^pirdc^mpa^iiientorforabig cash rebate  the purchase of any new,</p>
        <p>1987or 196801dsmobfleor 1987Nissan model in stodc</p>
        <p>Umit (xie non-negotable (X)upm per retaO aistomer Not valkl vvith any other offer or coupon.</p>
        <p>Offer expires 11/30/87.</p>
        <p>I</p>
        <p>I</p>
        <p>I</p>
        <p>I</p>
        <p>I</p>
        <p>I</p>
        <p>I</p>
        <p>I</p>
        <p>I</p>
        <p>I</p>
        <p>J</p>
        <p>Whoi it comes to style, luxury and peifonnance, petle keep comirffi to us for our weat sdectkxi of brand new Nissans. From toe rnornent you slkte behind me vvheel, youll (jfecovereveiytoingyouseeandevetytoingyoutouchiscles^iedtoatoanceyour . dm^ pleasure ara engneeredtodldiver rod value fox'the riwney.Especialty now whoi you use toiscoupon good for*l,000cash back on your new 1987rassan!</p>
        <p>1988ModebAreArriviiigDayy!</p>
        <p>991 Greenville Boulevard SW Qreenville 75&amp;amp;3115 CallUslbUFlee 1-800653-9218</p>
        <p>1bWin*MW,OIIOI</p>
        <p>NodSdiasenecessaiy, Bcenseddnvers 18&amp;amp;older.Coinein{orcompietedetail&amp;amp;</p>
        <p>f</p>
        <pb facs="00096780_0066" />
        <p>C.M The Dftlly Reflector. Greenville. N.C. Sunday, November 22,1987 ,</p>
        <p>Idd Hnnaaa Par SrIO</p>
        <p>144 Nanees Far Sate</p>
        <p>144 Houses For Sate</p>
        <p>144 Housis For sate</p>
        <p> tW aVWVWw V W</p>
        <p>4I1T 4 BtAIFUL-Nieo</p>
        <p>Hon, fualHy buIR home faatur-kiglBaSaoma, 2 Iwlht, family teem wHh firaplac*. fonnal dln-IM and oahki kHchan on large tor. Oflarad tor $0,91. Unlvar-Nly Raalty 3SS-5$t or Gall Johnoton279a4.277</p>
        <p>Mlw LlitlW ianwloTl badrooms, 2W boHw, targt family room, lomwl dining room. kHchon wHh oot-ln otm and cariwrt on largo wood^ wHh</p>
        <p>famwd In back^. W Call UnlvarsHy RooMy 3S5-SM6 or Gall Johnston, 35S-79S4. ,</p>
        <p>H5B-4miPviwrr87i</p>
        <p>MBumoHon of ImiIow iwdrkat foit w lOiignT-dffvr aratrnavan. Thto 3 biwoom farmhouM of-toro ptonty of privacy and at S99.900-milwt n quH* a bargain. So* Jarwl Bowoar tor doMto. CENTRUY 21 JANET BOWSER ft ASSOCIATES 3SS-7$00 or 75t-</p>
        <p>arn.</p>
        <p>homo wHh 3 badroonw, 1 bath, aat-ln kHchan and living room. Locatod In tovaly runB airta. Pricad In Hw O'. Aha hn .IS ciaa wHh atabto that adfokw eroparly Hwt can b* PurdMMd. Qmtact Ban SkMtoton. CENTURY 21 JANET^OWSER ft ASSOCIATES, 3SS-7IW or 3SS 3419.</p>
        <p>AMR</p>
        <p>Alice Moore Realty</p>
        <p>201 Plaza Drive, Suite C. Greenville. NC 27858</p>
        <p> ___355-6712  Anytime_______________</p>
        <p>TURED PROPERTIES______i</p>
        <p>THIS HOME  I- I'l'i' fi'UicecI to $51,000 to  </p>
        <p>. . . i 'u HJt' ^ tH'nrooms and 1 . Hatns It . . . .f -   ,)nd the owno' is amio.:,' t"</p>
        <p>IF YOU ARE :ooK nq tor space at a reasonable price oi:1e^ home on a double lot cou'd be ' ! IS seectal wtb 2 fireplaces, one's rnasto'</p>
        <p>'   , ki! -hen .111(1 gorqeoiis den. Si95.000,</p>
        <p>REDUCED A ipt (V house i2,bOO squarf leet- d .1 I-'" !' Fo-mal rooms, preev deu, 3 bediuO'Ms, &amp;lt;.</p>
        <p>I  h  -  tr  1  r  -I</p>
        <p> S104.000.  i</p>
        <p>THIS LOVELY .0( r th h i</p>
        <p>IS  os  1  ns  1  -I  I    '  :  ai  .  </p>
        <p>HHASnCA,  : V REOUCFD *'-0m ?55 ,  1  $48.000, i</p>
        <p>A A "''d,pi,'. riG opoo'tiinir, '  !</p>
        <p>COUNTRY  LIVING, A .i.-.^dneiiS  Caic-'a:  t</p>
        <p>- tia ' $265.000.</p>
        <p>THIS GORGEOUS 4 bedrooi</p>
        <p>TOWNHOUSES</p>
        <p>.im'K 'Oom SI 32,500 NEW</p>
        <p>CLUB PINES. O.vners a'</p>
        <p>1L ^  S87</p>
        <p>LOCATED IN  Ri \</p>
        <p>has nciuded rT,,-,,</p>
        <p>  '"'A n.i d' n..i:ns ivu'i  'u  a.</p>
        <p>BEAUTIFUL LANDSCAPING m.if.es ,</p>
        <p>^  0  \  it  t  1</p>
        <p>I  II I] a I ai iia'aLjt' $65.500.</p>
        <p>G</p>
        <p>LOCATED IN LYNNDALE 'mslAvai', s ha 1  a</p>
        <p>I'l" I'li'd Ov.'iA" ,ci, an-.;'' ;S |," 1  ,</p>
        <p>'.Aa've 'nan.: - ; S118.000.</p>
        <p>COZY &amp;amp; CHARMING S</p>
        <p>nonn &amp;gt;n VveSihdven  nc.r.hho</p>
        <p>sc n d  1  C</p>
        <p>in.i'i.^es O'S'-nd a- $110.000.</p>
        <p>STATELY BRICK -'O'-'ia n,. ir.ng : n  \ ll S a  I  n  n</p>
        <p>horne A-'ih mana ciims .v    -.a.i</p>
        <p>mi"., arad .".alK ,.p 'had 'ic  $138.000</p>
        <p>GREAT INVESTMENT  .mi</p>
        <p>RINGGOLD TOWERS  d "i.  1 bath, all</p>
        <p>house.\a'es iii.-h drsi '  ,&amp;gt;.1 naht, 2 b'edrjoms t'.ar</p>
        <p>the purr .d unr $45 000,</p>
        <p>SHENANDOAH. Nr.v p.amt and nuA r irpet maKe this ., taedr.i  , hat'i townbouse a '.eis qcs'd invt'stmen: '! .-ni iiqht ,|i $41 500.</p>
        <p>NEW IISTING'  vr ht'iPOiinn 1 h.ith lownhoupt'm ex'elir.'it .lira's n P.asaibir. -ent with option to PufCh.ise $34.500  ,</p>
        <p>AVAILABLE IMMEDIATELY' Tpis .3 bedroom fiat lurated .-I V'.i'su Ridqe- .\ith Florida room includes '"nqssiti ' .r I'Os'r,liver and AindOA r-eatmr.sts 1 , ' - ' ne-A I ..-'t I $66 900.</p>
        <p>COMMERCIAL AND OFFICE &amp;amp;</p>
        <p> __ INSTITUTIONAL  PROPERTIES_</p>
        <p>COUNTRY CLUB EXECUTIVE PARK a new r.ubdivi- .  .-.   s- Msi hit in.il b'.i'd'n.: sites</p>
        <p>i lb .  . I in pn, 0(1 irom $50.000 to $99,000,</p>
        <p>; e: &amp;gt;,rs &amp;gt; h'r ,it tai'-</p>
        <p>3 OFFICE SUITES AVAILABLE. Go s.i location near 0  '*r".' .s" 'IS ' si.iv bar more det.iils</p>
        <p>COMMERCIAL LOT AVAILABLE on 264 ByPass only a S" ' b ' n I 'Omi 'l, im.its $1 7.500.</p>
        <p>RESIDENTIAL BUILDING SITES</p>
        <p>BEAVER DAM - W.iOded lot '40 &amp;lt; 279  $20,000.</p>
        <p>PINEWOOD FOREST - Woocied lot 100 x 214 $15.500.</p>
        <p>LYNNDALE - vVOiien lot too x 160  $34,000</p>
        <p>CHERRY OAKS-Nme Lot Gre.it Location $28.500.</p>
        <p>PARKER S LANDING, RIVER LOTS</p>
        <p>IS -T bedrooc</p>
        <p>12 LOTS app'  I</p>
        <p>$55,000.</p>
        <p>EACH lot = 300 From 3 LOTS'i; p'o ni EACH LOT = n -el $45.000.</p>
        <p>Diana Barwicx Rebecca Buck LOUiSe McArthur Alice Moore jean Eberdt . David Ryhanych I Susie Williams</p>
        <p>hiC" $35,000 to</p>
        <p>va'i"</p>
        <p>ich $30,000,</p>
        <p>' water ii ac'</p>
        <p>756-6364</p>
        <p>757-031 1 753-4539 752-2441 756-8728 756-9018</p>
        <p>Office Manager</p>
        <p>LOTS</p>
        <p>LOCATION</p>
        <p>Oakdale ........</p>
        <p>State Road 1711. post Rosewood .....</p>
        <p>PRICE</p>
        <p>DESCRIPTION</p>
        <p>$ 6,000</p>
        <p>acre</p>
        <p>$ 6,500</p>
        <p>Mobile home lots</p>
        <p>$ 7,500 &amp;amp; up</p>
        <p>1^ acre</p>
        <p>$ 8,000</p>
        <p>acre</p>
        <p>$ 8,000</p>
        <p>V2 acre</p>
        <p>$ 8,500</p>
        <p>Vz acre</p>
        <p>$ 8,500</p>
        <p>V3 acre</p>
        <p>$ 8,500</p>
        <p>acre</p>
        <p>$ 9,000</p>
        <p>V2 acre</p>
        <p>,$10,000</p>
        <p>1.1 acre</p>
        <p>,$12,500^</p>
        <p>acre</p>
        <p>.$12,500</p>
        <p>216 acres</p>
        <p>.$20,000</p>
        <p>5 acres</p>
        <p>.$21,000</p>
        <p>4 acres</p>
        <p>.$25,000</p>
        <p>acre off water</p>
        <p>.$27,500</p>
        <p>1 acre</p>
        <p>.$28,500</p>
        <p>Vs acre</p>
        <p>.$52,000</p>
        <p>4.65 acres ^</p>
        <p>$16,500</p>
        <p>acre</p>
        <p>Most are wooded</p>
        <p>39CLARK-BUUKH REALTORS 355-^000</p>
        <p>wwowrtlow. 3 bftnm, form*) OMna room Mf wt in kIMiWK IXniIim ev gong* piM cwrporf</p>
        <p>arsfessSrTS</p>
        <p>UfllMnHy ItaoHy 3S3-SM. fISO</p>
        <p>hood. Thli honw iMturM Mm* badroonM, ftw IwNts, larg* dm, kHchMt with Mt-ki tmi, and foniMl artM. Solltr h*t mov*d and It r*ady to mH. Op*n Hqum today 2-4. Rtery CattwriM Sgik** at J.|,. Hwrit ft Sw, lnc.7S|-47llor7S4T. ytsVAMbllie lnv*ttm*nt hom* locatad In mo*|l*nt n*M-borhood m Griflon. 3 iMdroom. 2 baMi honw, rofurbltlwd. Prk*d bi Mw ItO't. PiMHW call Jaan Ebwrdt 7SM72I or Alica Moora RaaHy,3SM712.</p>
        <p>oUpNERS will omkitr any raa-tonabl* oftbr on NMt 3 bt&amp;lt;froom townhonw In Windy RIdg*. Call Anita Worthli^ at Aldridgaft SouHwrland7-3S00or3S^1.</p>
        <p>^tA An6 6UlftY can ba yourti 3 badrooms, 2 baHw and an acr* lot. Lika naw condition. Attumabla EHA loan. Only 139,900. UnivtrtMy RaaHy 3Sf-SOM or Glann MIm 7S3-4S04. f2IS</p>
        <p>araa ft oint i tcapadlNm,</p>
        <p>^iblbi: Nettlod In Hw pint country I Baautiful 3 btdroom, 2 bath honw faatum; tunkan graat room wlNi glowing fhrapiaca, bay window ki dining iw floora, icanic land-vn, appaaling to future amcutivat. Aaaumabl* 9W non-ouallflng FHA tatn. Low 40's. Sill JamI* Brown. CENTURY 21 JANET BOWSER ft ASSOCIATES, 3S5-7M0 or 7S2-2M0.</p>
        <p>^fc6#iiiMAL MAklgteb</p>
        <p>CONOO-Rkwgold Towart. IdMl for shidtnt muting. Fully fur-nlthod and convanitnt. 039,900.00. Call AldrlOte ft Southorland at 750 3S00; Kaltwrliw Vmson 7577.</p>
        <p>144 Houwi Hr Salt</p>
        <p>iwai William doatlo</p>
        <p>callage 3 badroetm. I bath, firagiaca. hardwood floors tiMr mat. II Bradlev Gray mim r Univaralty Raalty HI Mil. 1^</p>
        <p>fixr</p>
        <p>, llfCTT IWilTgi artahai to pvrchatt tkt^fami-ly hornet and duplamt hi Itw</p>
        <p>UNKU M HHN </p>
        <p>ihla lovtly Capa Cod In WiifhBvan III. Taka tinw today to leek-you'll ^-botera this om gHt aawyl II Anita Worthington, 6RI. Aldridgo ft Soutlwriand, 7St-3900 or 3SI-</p>
        <p>Ml.</p>
        <p>WBOtK HJDOl' i bt)ira5 Iradittanat ki convanlont and txclutlvt Foratt Hlllt. This honw raflactt Hw finatt In craft-tmanthto and I* ki a pait-llfca l. Y* "</p>
        <p>. 'ou won't tquaan Nw chlldran In Hw 9 larga roomt. Including formal araat, tunny</p>
        <p>dtn.andlaii*racroom. Raduc-ad to 1122300: To Ml, Call Nancy Oudlay, Aldrldgt ft Souttwrland, 7M-3S00, days, or 75t-SS9.ov*nkigt.</p>
        <p>iIBaZeET55B73bd?55S: 2Vhbath honw In family orianttd nalgliborhoad. Ovartitad family room, broakfatt bar, deck, plus numarout other special faaturet. Attumabit loan. Af-terdably pricad at M2400. For your prlvato thowing contact MaMt Savage at CENTURY 21 JANErBOWSER ft ASSOCIATES 355-7000 or 75-3091.</p>
        <p>itivft nitt... ttiis fwv; 1400-F Mfuaro foot honw on a anal hat baauNful view of Pungo RIvar. Quality construc-Hbn. 3 badrooms. 2 baths offers caHwdral calllngt. Watch Hw boats tall Iw from your t I. I7ft000. For dMailt</p>
        <p>call</p>
        <p>Quean, Aldridgo ft Soutlwriand 756-3500; home 757-0034. V</p>
        <p>144 HouMS For Sate</p>
        <p>st&amp;amp;'issssr</p>
        <p>maamvamxi</p>
        <p>***?* kMtil-jN{n&amp;lt;l^ did( evMl fiiofe. FenesrsHome</p>
        <p> for </p>
        <p>iWeiAi MVilMWiWt "i:</p>
        <p>nancbig thru fNm. Brick horned 3 bodroems,. IW bHw. caraert wHh paynwnts aa low aa tW par imnm. Cloalng ' undtr MOft peaaibi* no MymantH^lflad. Call Evans RaaHyl-27Z7.</p>
        <p>Slevo</p>
        <p>iWCTWons ,</p>
        <p>acroH Cbocowinny Bay. En|oy this coNagt wHh sandy baach, 135' plar and boathouM at Rtaora't Baach. 9R.900. Call</p>
        <p>Bavarly Quaan. AtdrMga ft SouHwrland, 7S6-3S00; Iwnw 7S7-034.</p>
        <p>WtteiBWiLiTflltittand you will iovo Mw paynwnts undsr $400/month Pirr. Only $4,900 to astunwl HIgnlti Roal-tors.757-199anyHnw.</p>
        <p>fUiNS VM^I Boon Look-Ing Fori 3 bodroem, iw bath bmk home. Central air. Ckm to hospHal and Industrial Park. Pricad at $45,500. UnlvarsHy RaaHy 3Sft50M or Glann Mlu 750-4514. H4</p>
        <p>-HfB a RIGHt wHh this "Horn* Swaat Horn*" and M ara Hw paymants. If you qualify tor North Carolina Housing or for a FmHA Loan. Ift a classic 3 bedroom, IW bath home dsco-ratad wlHi a contamporary flair. Salat price ktcludM a jwol parfoct for sunbaHiIng (sur-</p>
        <p>porfoct for sunbaHiIng rounded by a privacy fsnca), a stur^ worfcthep (that's wired for pnont, caMo, and alactrlci-ty) and all ma|or appllancet. If Hilt sounds right lor you. lust give us a call at ERWIN REAL-</p>
        <p>at 030-5201.</p>
        <p>144 HouatB Far Sate</p>
        <p>i44ltouaMFerSftte^</p>
        <p>x.'gawgtffe</p>
        <p>MdMSwMwrtand7Si-3S00, AMIIIS v9v*29SV</p>
        <p>iHal wHh aloomkig horiaqod</p>
        <p>UmyiRilTT</p>
        <p>ahrtsiT'S</p>
        <p>bardweed floors, upstairs privata onfronco; two lot*. SftfOO. Ask.for Suo.Ounn_af</p>
        <p>330ft nlSits3SS-2SII.</p>
        <p>wnuv AWiidMiiey</p>
        <p>dMcrlbaa thto rww 3 Mreem ranch undar oonttrudlOT In Plaaaant RIdg* outald* ^ Aydml 21x34 graah^ wHh Hraptoca. two full bafha. FHA ni^VA aperu^ fbr liJo. HlgnH*R*Sftora,7S7-1.</p>
        <p>W6bklMI-WiNTtkVI0[i</p>
        <p>OrawRumbloy.3SS-ni7.</p>
        <p>In this onvonl^ly i#caW nja</p>
        <p>rtrsSi.w.'sw</p>
        <p>deacrlmlmtlng hem* buyar. BaauHful 5 badroom home wHh llvkw roam. Larga kHchan wIMi braiXfiid area vHHi boy win-</p>
        <p>REALTY 3SS-7I7S or Carolyn Erwln3SHI1.</p>
        <p>Rlfclwn with boy-wlndowod broaktosf woo. A griot hpwo</p>
        <p>TSHi QAkAtms bnprooMvt ond imH ofton privocy. protao-stoml docor, Md buin-lM in fhlo thratbodroom.2WbaHiunlt: all opplloncoa furnlohod and pri^ paHo. SSSjno. Call Siw Dunn at Aldridgo and SouHwrland. 7S-3SOO or night* 3SS-2S$I.</p>
        <p>WT LVi Th sunroom portad tar plants and wl^, Ims ipactou* homo hoi il tar mot waos, dsn. 3 bsdroomsj baths, tar ovr 2100 square taot. (}arage and hugq woodN por-</p>
        <p>ln, $49,900. Ask tar Sue Oum at Aldridgo ft SouHwrland, 754-390O;ntohls,3S5-2SM.</p>
        <p>niversiTy AREA-^ thi*</p>
        <p>brick bungotow on a comtr tof with a ciclar drivt. This 2 bedroom, 1 both houso is highlightod by o sunroom. living room, and o dbihw room |ust righi tar candtollf^ ond a new gos hoatkw systam. SS7.900.00 Gll Aldridgo ft SouHwrland at 7S4-3SOO; KaHwrlne Vinson 732-5771.</p>
        <p>im ItAhbl t LIV/IN LYNDALE. Qualify^ bullft roducad to $110,900. Coll Jw dotatls. Overtan ft Powers 353-4500.</p>
        <p>2 BEDROOftlS, Bungalow flroplMO, on nice wooded lot In NwthGreonvlllo. Bolvdraraa. $22jm, Doosibly ownor flMMO-Ooy* 757140. nighf* 75*-^.</p>
        <p>OCSons, Inc. 7584711 200W.Tendi</p>
        <p>Open House Sunday 2-4 119 Osceola Drive</p>
        <p>Beautiful ranch In a super neighbortioodi This la a quality buHt home that features fonnal areas, large den with bullt-ina, three spacious bedrooms, and lots of closet space. Come see what quality really Isl Your host-ms: Mary Catherine Spikes.</p>
        <p>NewLlsUng:</p>
        <p>QdeoH Maintenance tree ranch with three bedrooms, two baths, large kitchen and fenced beck yard with spacious deck. Listing Agent: Jan Cox</p>
        <p>AydemDupiax'Great Inveatmant property. Both sides feature two bedrooms, galley style kitchen, dining atea, and large living room. Both sides ate rented. Listing Agent: Faye Stewart.</p>
        <p>Beautiful contemporary ranch situated on a large country lot overlooking a serene pond. This well built home features formal areas, efficient kitchen with Ml appliances. This large deck and the screened porch face the pond. Quiet living just minutes from town. Usting Agent: Mary Catherine r</p>
        <p>NORTHW0008 is a new subdivision only minutes from Greenville. Come see the spacious wooded lots and enjoy the relaxing atmosphere that is NORTHWOODS.</p>
        <p>Mary Catherine Spikes............ON  CALL.......758-5467</p>
        <p>Mac Harris, General Manager..........355-6078  Fay# Stewart.......................753-2080</p>
        <p>Julian Vainwrlght, Property  Manager755-5818  Jan Cox..........  .830-8311</p>
        <p>Elizabeth Modlin  ...............753-3967  Lib Harrie.........  752-1729</p>
        <p>Roger Davenport ....... 524-5632  Myra Day, Brokerage Manager..........355-6652</p>
        <p>V)</p>
        <p>S'</p>
        <p>..iki</p>
        <p>Si'*</p>
        <p>.UUl Ul .U1</p>
        <p>S</p>
        <p>m</p>
        <p>Homes From ^89,900 to M11,900</p>
        <p>Homesites from $24,000</p>
        <p> Crown Molding    Microwave</p>
        <p> Deluxe Baths    Masonry Fireplaces</p>
        <p> Decks    10 Year Warranty</p>
        <p>10V4 % Financing Available*</p>
        <p>IMIer pays eooeiil polnis and meal eleee by Oaewiber as, tll7</p>
        <p>' rv '  </p>
        <p>Model Open Daily 10 am  6 pm Sunday 1 - 6 pm</p>
        <p>Directions: From Greenville Blvd. go South on 14th Street Extension past Brook Valley exit.</p>
        <p>For more information call 35S-3558</p>
        <p>/</p>
        <p>Typical Financing Example: Sales Price $89,900. Down Payment $9,000. Monthly Payment $724.96 Principal and Interest, plus tax and Insurance. 30 year loan. $80,900 Loan Amount APR 10.91%</p>
        <p>WESTMINSTER HOMES</p>
        <p>\ Wivrfti.H'U'wl liMMm</p>
        <pb facs="00096780_0067" />
        <p>144 Howm l4r Site v uTHoMiriF^^  I4lnvsfmiif  Proptrty  ISO  Land  For  Site  ISO  ijmd  Por  Salt  ISO  Latid  ForSate</p>
        <p>^SYliAVieiili this 3 tMdroom, 2 bath brick ranch featura a tunkan family room with a corner brick fireplace. Alao featuree living room-dlning room combination and convenient to ihopplng. tM,W0.04. Call Aldrldg^ Southerland at 7St-3500; Katherine Vinson 7S2-5771.</p>
        <p>rilBKT r/i bmii 1^;</p>
        <p>located In a quiet weU kept neighborhood. 4l Hlllcrest Orive, Wmierville. 140,900. The 7-3441 or</p>
        <p>EM.kNT CAsri FLOW lils-tory tells a lot for this Greenville Area convenience store. Owner</p>
        <p>Orive, Wbilerville. 040,9 Win^ tmnev. 7S7-3 790-1M0or35007.</p>
        <p>financlna available. Rumbley ^Hy, 35S-2042,- Bill Fell. 244^ 3913.</p>
        <p>3 BCbROOMS, 2 full batlw, one Old. Camelot Sub-dlvislon.</p>
        <p>year old. 6-12M.</p>
        <p>WiiTWbob-Yhls seller will entertain a lease purchase on</p>
        <p>Iav</p>
        <p>TREE. 3 bedroom, in</p>
        <p>this Immaculate home with llv Ing room and greatroom with S fireplace and bullt-lns. Also three bedrooms, 2 baths, eat-ln kitchen, spacious detached</p>
        <p>baths. Immaculate condition, beautifully landscaped lot 005,000. Cal(3SS-2lf0 after 4:30.</p>
        <p>msT Lot for commercial use. Located on 1100 North Greene Street. Charlie Forbes 750-7157 or University Realty</p>
        <p>LAN6:5AMt-ca&amp;gt;^s;&amp;gt;Min 2 tracks-2Vk acres at 09,000each, lust 0 miles from Q7iiS!4|e on</p>
        <p>associates, 351-7100. ilVIk</p>
        <p>a ktkii belwe^i</p>
        <p>wooMand - will perk, secluded Call Morco anytime, 7-S0l9 or</p>
        <p>500</p>
        <p>foot on the river. 3 J aw. perked, ready to go. Secluded. Beautiful. Call tXam anytime.</p>
        <p>751-3007.</p>
        <p>1ifl0AU(i04 TI*kA bel Randwro, ,10 acre pilots tor horse levers er such. Terms. Baaullfully laid euf. Call Morco anytime, /sO-SOIOor 7M-3007.</p>
        <p>and WashlngtonI Loads of road frontagsl Reduced to 040,900.</p>
        <p>5 BEDROOM, 3 bath, over 4W square foet, indoor swimmlnp</p>
        <p>garage, worlnhr^ FHA loan</p>
        <p>^Irldge Southerland, 756-3500, nights</p>
        <p>assumption. 069, Ounn at Aldrld</p>
        <p>Call Sue and</p>
        <p>S)l. Bargain. Owner says sel II Morco anytime, 752-5019 or</p>
        <p>SHNANDOAM-3 bedrooms, m baths, last of 6 units to be sold. Seller will pay up to 01,500 In points and closing. 040,500. Rumbloy Realty, 355-2042; Drew Rumbley 355-7217.</p>
        <p>7M-5019,750-3007.</p>
        <p>ATfENfKir</p>
        <p>ENfkM deveijmirm I residy to go. Chvner sajm Call Morco anytime, 7-</p>
        <p>acres</p>
        <p>sell. _________</p>
        <p>5019 or 750-3007.</p>
        <p>-XeitiiAtALfordevelop^ tmnt. Frontage on Alien Road. Water and sosMT near by. 00,500 per acre. Terms available. Ltoting Broker. Richard Allen, the Raal Estate Center, 355-6666 09756-4553. .</p>
        <p>HIgnlto Realtors, 757-1969.</p>
        <p>~cki, BUkt itim, N.C. Owner financing available. 3 miles fram 1-40; eO miles to Asheyljle Chartolte.^R^</p>
        <p>tors 3%. Stingo, 074-2004-NC; 213-431-7233,</p>
        <p>views.</p>
        <p>Callfomia.</p>
        <p>Th Pally Reflector, Greenville, W.C.  Sunday, November 22.1967 C-23</p>
        <p>1st LaiMlFerSalB</p>
        <p>m AC asede tank. wefT heeh-upiy Hghl. Lecatod south</p>
        <p>hoMi-up lor Hghi. Lecatod south ofGreenv1{teeffo(43onWllmar Road. MM. 2t4-29Mer 34441103. i3T0reTOiiX57itigFT act* 073M; 5 acres for only 030J00. Hlgnfto Realtors, 75/-</p>
        <p> Hlgnfto</p>
        <p>1900anytime</p>
        <p>ISO Land Por Salt</p>
        <p>113 AdiMSCJumer tnanefng.</p>
        <p>Mut 'l mli northoast of Burroughs Wellceme. Call Carl at</p>
        <p>Darden Realty, 750-1903; dsiSOiM.</p>
        <p>39 ACRES ^Wner may townee</p>
        <p>Clooe to the hsw^l.  _</p>
        <p>tar details OarSn Realty, 750-</p>
        <p>Call Cart</p>
        <p>1903; nighls/washends 3554550.</p>
        <p>tSI</p>
        <p>MobUoHome -</p>
        <p>Subdivision, mobile home</p>
        <p>leto with community water and paved streets. Owner financing available. 756-9400 or 7504310.,</p>
        <p>750-3007.</p>
        <p>355-2500.</p>
        <p>WIUIAMSBURO CHARM and detail near Evanswood In WIntergreen school district. Features master downstairs bedroom, upstairs Includes 3</p>
        <p>148lnvastnint Proparty IfpXRSS^ufCDlNO^</p>
        <p>units, brick, near downtown, folly rented. 7567305.</p>
        <p>STbMt CONDO located on ECU Campus, folly turntshsd. Great Investmant, rental prop-aily for 3-4 students. Call Uni</p>
        <p>versity Realty 3565066 Jolmston356^.</p>
        <p>FOffmiWowNtt 102 E. Baywood Lant</p>
        <p>78B-2299</p>
        <p>Anytime WeehMide; After 4:00 Weebdeye</p>
        <p>150 Land For Sale</p>
        <p>and playroom or 3 Beautiful great</p>
        <p>I greatroom</p>
        <p>with fireplace, large dining</p>
        <p>.......7,508:</p>
        <p>room, garage. Ail for $107,&amp;lt; Call Beverly Queen, Aldridge &amp;amp; Southerland 756-3500; home 757-0634.</p>
        <p>UNBELIEVABLE- 2 bodroomT I bath, screened porch with concrete floor and detached garage. Exterior-stone, on nice lot In</p>
        <p>bdZimi:m.LY WoOOEb,</p>
        <p>sloping lols for your dream honw. Several Ion available.</p>
        <p>$500 DOlvtl bu^ a 3 bedroom, 1V5 bath house In the country. Seller will pay most closing cost. Home Realty 355-4663.</p>
        <p>E-Aivnvi'MIWOMr HI IIIW ive</p>
        <p>subdivision. Owners movli ced I alty3 3567914.1337.</p>
        <p>  ________ Ing-</p>
        <p>prlced In 20's. Call University Realty r</p>
        <p>r 3565046 or Gall Johnston</p>
        <p>Prices start at $20,750. Call for details. MAVIS BUTTS REALTY, 3567653.</p>
        <p>COASTAL</p>
        <p>HOME</p>
        <p>INSPECTIONS</p>
        <p>Get the facts BEFORE you buy!</p>
        <p>637-4081</p>
        <p>New Bern</p>
        <p>0 LOTS WITH community water, pre-perked, located I miles from Greenville on Stan-tonsburg Highway. Priced to sell due to health reasons. Call aflor 5:00,7463339.</p>
        <p>117 ACR for sale or lease. 740*6- frontage on 264 East. 630*6- frontage on Farmvllle East Thoroughfare. Zoned business/industrial. Owner will build to suit tennant. The Real Estate Center, 3554666.</p>
        <p>Weothaven Subdivision, 3 bedroom, 2Vb bath, formal areas, kitchen with breakfast arei sunken den, garage, deck, swimming pool, outside building, privacy fence. $109,900</p>
        <p>lEW USTING</p>
        <p>1300 MMUETR PLACE</p>
        <p>Expect</p>
        <p>the</p>
        <p>sJtiesiBul</p>
        <p>SHERATON VILLAGE</p>
        <p>m</p>
        <p>SHENANDOAH</p>
        <p>DEVELOPMENT</p>
        <p>COMPANY, INC.</p>
        <p>We offer the very best in LOCATION. SIZE, AND PfllCE.1, 2, 3 bedrooms. Some with fireplaces.</p>
        <p>AVAILABLE</p>
        <p>NOW</p>
        <p>CEDAR COURT</p>
        <p>2 bedroom townhouse, carpeted, all appliances, washer/dryer hookups.</p>
        <p>756-6209</p>
        <p>Tueksr Estateilf you would enjoy a home located in a cul-de-sac with lots of trees and a private back yard, then youve found iti! This is an extremely well-built extra insulated 5 bedroom home with 2Vi baths, a kitchen with hand made cabinetry, a built in microwave, $30 a yard carpet, 2 pc molding, hardwood floors in foyer and dining room, detached garage and more. Listing agent: ^aroljfnErwlr^35S^16^</p>
        <p>42 EASTWOOD</p>
        <p>Ra New and Just for you I Tradition and quality combined to make this home perfect for your family. Youll love the huge eat-in kitchen, oversized master bedroom, IVi baths, spacious living room, and H even has a deck off the back. Located in well established family neighborhood. Listing agent: Carolyn Erwin 3S6B016</p>
        <p>ON CALL</p>
        <p>ERWN</p>
        <p>9 Listing Agent</p>
        <p>For October</p>
        <p>Sandra Walston 758-5056</p>
        <p>REALH</p>
        <p>JimBurtiens</p>
        <p>NonolficHours  Oi/f SelUtig Greenville''</p>
        <p>3219 Landmark Street - 355-7878</p>
        <p>*REDUCEO $2,000 RT. 2, BOX 118AB</p>
        <p>CONVENIENCE and affordable prices. Quality construction by Van Rack, Inc. Convenient location on Landrr.ark Street behind the Sheraton Inn with builder paying up to $1,200 In closing expenses and up to 3 discount points makes this your best buy in Greenville. Call today or visit our model unit open every Sunday 2-5 pm. Host Don Joyner. $45,600-$56,000.</p>
        <p>OFFICE HOURS: 201 c. arllngton boulevard  Moo^rt,</p>
        <p>756-3000 The Home Sellersr sJ!i..2-s</p>
        <p>That's right its just been reduced!! For 961,900 you can enjoy the comforts of country living in this charming ranch If you act now. This lovely home features 3 bedrooms, 2 baths, spacious living room, kitchen4lining room combination and approximately 1440 sq. ft. of living space. Call ua today for  special showing.</p>
        <p>^SE/OPTK)N PEED DRIVE</p>
        <p>Something Spedsill Huge master bedroom. 2 full ceramic tile baths, stairwell open to 2nd floor, living room with vaulted ceiling and fireplace, 2 more bedrooms upstairs and even and unfinished room</p>
        <p>to grow into. Brand new and ready to move on In. Calluati</p>
        <p>I ua today for more detalla.</p>
        <p>Carolyn Erwin 355-6016</p>
        <p>Jim Burtiana 355-S887</p>
        <p>Sandra Walston 758-5056</p>
        <p>8304281</p>
        <p>DUFFUS REALTY.1NC.&amp;amp;</p>
        <p>HiMIMMMMMMMMMHMHMHMMMMHMHKiMHMMMMMMMIHMMHMMHMMMMMMHMMaiMMPHHMiiHHHnMHIMiMHi</p>
        <p>IVIEIVABEFIPELO</p>
        <p>FEATURING REAL CHARM ENJOY THE COZINESS of this bright downtown area bungalow. Carpeting, formal dining room, 3 bedroom, 2 baths. PLUS, french doors, convenient location. Remodeled, interior painted, new carpet, fireplace. 139,900.</p>
        <p>2 STORY COMFORT</p>
        <p>VVORlO LEADER IN PELOCATION</p>
        <p>CONGENIAL SHENANDOAH H(IE highlighting comfort. Carpeting, eat-in kitchen, 2 bedrooms, IVi baths, thermal giasi easy4re Ing, patio. A Must To See, We Invite You To Ckxnparel. Much</p>
        <p>SEE THIS HONE. HI</p>
        <p>PLUS, convenient</p>
        <p>BUOGET-ABIUTY</p>
        <p>2 story Traditional. City water, 3 bedrooms.</p>
        <p>bedrooms, 2 baths. Fireplace, garage, wesiminisier Built, Warranty. $59,950.</p>
        <p>CORNAL A COMFY DEUGHT IN THE CHARM of this attractive Rolling Meadows ranch.</p>
        <p>room, eat-in kltchan, 3 bedroom, 2 E-300, Custom Oak Cabineti 4</p>
        <p>CeUIng Fans. i</p>
        <p>FIRST HONE FLAIR NKXROLLOiWOOD CONTEMPORARY with owner benefits. Centrd</p>
        <p>I, high ceilings. Fireplace, Possible 4th Bedroom. Call Nowl Priced at $21,500.</p>
        <p>COMFORTABLE LIVING FRIENDLY AYDEN home promising happy days. French doors, formal dining roogi, 2 bedroom, comer lot, fencing, storm windows. ALSO, pmt^^near shops. Fireplace, possible 3rd bedroom or study.</p>
        <p>SNAU IS BEAUTIFUL mvmNG VILLAGE GROVE cottage offerino such value. Trae4ined street, carpeting, comer lot, storm windows, 2 bedrooms, PLUS, near recreation. Fireplace, vinyl siding. This is a real buy. Priced at 136,500.  TOWNHOMES</p>
        <p>BUY ONE OF THESE great townhomes. Wonderful for couple, singles or for your student. 2 bedrooms, 1W baths, livtng room, dining aisi modem kitchen, patio. Only 139,500.</p>
        <p>A LITTLE WONDR '</p>
        <p>CAROUNA HEIGHTS cottage designed for livlno. Gas heat, carpeting, eat-in kitchen, 2 bedroom, PLUS, near bus-recrealion. Fireplace. A great starter home. Ideal lor Savvy Buyer. Priced at 559,900.</p>
        <p>cel $41,900.</p>
        <p>CANALFRONT BEAUTY PLEASANTLY COZY Leechvllle beach house that's spruce 6 trim. Canal/rWer views. Carpeting, screened porch, modem kitchen, 2 bedroom boathouse. Treat yourself to a vacation homel. $43,500.</p>
        <p>AFFORDABLE HONE CORDIAL REGENCY HOUSE CONDOS home loaded with extrai Rehabbed. Central air, kitchen appliances included, 2 bedrooms, PLUS, near shops~bus. Located Across The Street From The University. $43,500.</p>
        <p>WARMLY LIVABLE CONGENIAL SIMPSON AREA ranch packed with values. Space for expansion, modem kitchen, 2 bedrooms, easy-care landscaping, storm windows. Farmers Home Approved. Good Value At This Pricel Priced at $42,900.</p>
        <p>TINY BUT TEMPTING WELCOMING SWEETBRIAR RANCH with charming ways. Eat-in</p>
        <p>Brand new. Central air, carpeting, greatroo bathi thermal Matoniy Fireplace, I CeillniB Fans. $61,000.</p>
        <p>FIRSTHONEF NKX ROLUNWOOD CONTEMPORAR air, carpeting, greHroom, waik-ln closets, modem kitchen, 2 bedfoom, 2 bath^^k). Fireplace, Loft Arei Private Courtyard, Clustar Home.</p>
        <p>On Call This Weekend Francis Harris ' Realtor</p>
        <p>Office Open 1-5 PM Snnday During Nob Office Houn ease Call 756-5659</p>
        <p>HANDLES FAMILY NEEDS DELIGHT IN THE COMFORT of this rewarding CoghHI ranch. Ouiel street, great family arei hardwood floors, patio, storm windows, 3 bedroom, 2 baths. Fireplace w/Gas Logs, Nice Area Next To Collage Court. $61300.</p>
        <p>FOR FAMILY LIVING</p>
        <p>$63,500.</p>
        <p>PRICE CUT, MAKE AN OFFERI CONGENIAL ROLUNSWOOD1VI story cedar Contemporary offertog</p>
        <p>easy upkeep. Paddle fans, vMlted flings, a^kyi</p>
        <p>kitchen, 2 bedroom, deck, city water, city utilities, space for expansion.</p>
        <p> ----   ~  -  :ol  F    -------</p>
        <p>greatroom, walk-in closats, built-in microwave, or. $64.000.S1MP80N-MILLBR00K SUBDIVISION $79.900 CASUAL LIVABIUTY</p>
        <p>Discover the warmth of this welcoming ranch. Under construction.Carpeting, formal dining room, walk-in closets, eat-in kitchen, 3 bedrooms, 2 baths, thermal glass, comer lot, deck. Greatroom with maaonary fireplace. Make An Offer.CHERRY OAKS  88S.900RATING HIGH ON CHARM</p>
        <p>See the charms of this Traditional ranch-type. First owner. Paddle fans, greatroom, formal dining room,walk-ln closets. Fireplaoe. Seller Will Pay $2000 Points and/or Closing Coat. Prica-cut o^gortunltjj^^^PRESTIGIOUS EA8THAVEN  $123,000</p>
        <p>GORGEOUS RANCH Elegant prestige haven. Central air, crown mouldings, format dining room, eat-in kitchen, 4 bedrooms, 3 baths. ALSO, large trees, quiet street, screened porch, family room, 2-car garage. Prime woodwork throughout, den w/flreplace and privata view. Just Reduced-Make An Offer.</p>
        <p>Brick Exterior. Good Value At This Pricel Priced at $4S.900.</p>
        <p>. FLASHI PRICE REDUCTIONI AYDEN RANCH with real appeal. Single owner. Great family arei central air, carpeting, eat-in kitchen, 3 bedrooms, 2 bathi pMk&amp;gt;, storm windows. Large Utility Room. Ideal for Savvy Buyer. Priced M $44,900.</p>
        <p>TINY BUT TALENTED RINGGOLD TOWERS residence that boasts (tollar-wise comfort. Single owner. Heat pump, city water, 2 bedrooms, ALSO, near schoois-shops.</p>
        <p>BESTBUY PRKEI CORDIAL SPAaOUSNESS that caters to family life. Ranch. Cantral air, hardwood floors, formal dining room, foyer, family room, eet-ln kitchen, 3 bedrooms, 2 baths. Fireplace, Screened Porch, Double Carport. M900</p>
        <p>FLASHI PRICE REDUCTIONI</p>
        <p>owner. Heat pump, city water, 2 bedrooms, ALSO, near schoois-shoi Ground Floor E Unit. Completely furnished, except linens. $45,000. HIGHUGinNG COMFORT</p>
        <p>ATTRACTIVE ELMHURST 2 story Traditional with homey vtf uei Great h, hardwood f loore, formal dining room, dan, study.</p>
        <p>REGENCY HOUSE CONDOS home with charming ways. Rehabbed. Central air, kitchen appiiancas included, 2 bedrooms, PLUS, nera shops-bus. Furnished. Across from the University. $46,000.</p>
        <p>HOM^ UTTLE HONEY UNIVERSITY BUNGALOW that Includes brick styling. Quiet street, great family arei hardwood floors, family room, extraJarge closeti eat-in kitchen, 3 bedroomi screened porch, storm windows. Fireplace. $48,900.</p>
        <p>FLASHI PRICE REDUCEDI WARMLY UVABLE HARDEE ACRES rench thst'e spick &amp;amp; spwi. Great</p>
        <p>family arei cozy hearth,--------------- _  .  ..</p>
        <p>many bullt-lns, 3 bedrooms, m baths. Hurry before It Is too IBs.</p>
        <p>M.9W..  EVERYONE  FifS INI</p>
        <p>DEUGHT IN THE CHARM of this hospitable Country 2 story farmhouse. Restored, on a full acre. OiMtroom, dsn, aU-ln Idtcton, 3 bedroom, 2 bathi live oak trees, deck. Fireplace In KKclien Aim, Brick</p>
        <p>Exterior.  REDUCnONI</p>
        <p>reare. I room,EVANSWOOD  $94.900CEDAR CONTEMPORARY CONVENIENCE</p>
        <p>Delight in'the comfort of this engaging 2 stoiy. Heat pump, greatroom, thennal glass, p^, 2 bedrooms, 3 baths. PLUS, near shops. Fireplace. Loft Could Be Converted To 3rd Bedroom.</p>
        <p>mouktbHM. formal dbtog room, esHn Utshen, 4 bedroom, 3 b^ PLUS, 2&amp;lt;ar garage, hardwood Hoori family room. Prime itoodwork Throughout, Dsn wfFbwlaM and Prhrete $123,000.</p>
        <p>VERY SHARP CONTEMPORARY BREATHTAKING t STORY. Brick, deftly placed on 3J aeree. 2 flnpliMi central air, bsamad csiiingi crown mouldfngs, wood panMliig, family room wHh wat bar, 5 bsdtooms, 3 bathi glass walls. Doubia Carport. Dog Pan. Four horse bam, tack and hay room.</p>
        <p>family arei central air, paddle fans, electric heat, carpeting, fencing, ............*      At  This  Pricel  Priced</p>
        <p>storm windows, 3 bedroomi 1 Vi baths. Good Value At This I at $48,900.</p>
        <p>ADVANTAGEOUS PRICE CUH SPICK 8 SPAN brick Hiladale ranch that's comfortably cozy. Trea4lned street, fireplace cozlness, central air, gas heat, hardwood floors, fomiM dining room, study, 3 bedrooms. Hurry to see and buy today. $51,000.</p>
        <p>GREAT RANCH</p>
        <p>HARDEE ACRES RANCH offering equity valuei Brick. Qiilel street, great family arei central air, carpeting, greatroom, deck, 3 bedrooms, 1 V baths. Fireplace, garage. An Excellent Value. Priced at $53,000.</p>
        <p>PLEASANT CONTEMPORARY EASY-TO-LOVE Whispering Pines residence with tall-tree shade.</p>
        <p>OWN PERSONALITY ENJOY THE CONVENIENCE OF THIS ATTRACTIVE Camelal ranch. Cantral air, hardwood floors, formal dining room, foyar, dan, eat-in</p>
        <p>kltchan, 3 bedroomi 2 bathi^lreplaca. Very Nk ...........</p>
        <p>Areai $77,900.</p>
        <p>COMFORTABLE CHARM</p>
        <p>$131,000.</p>
        <p>LOVaV TRADITIONAL HONE DISCOVER THE CHARM of this attractive Westhaven VII home. Under</p>
        <p>lice Home WHh AN Forniai</p>
        <p>construction. Carpeting, reaalroom, formal dining room, muHlfurooie room. Fireplace, RiMlMe 4lh bedroom or PUnrroom, unflnlehed 3rd floor.</p>
        <p>LOVELY CONTEMPORARY offera warm hearth. FratkSouajpkwp^</p>
        <p>radvrood. Great family arai elactronic door opanar,cantral air, ceillngi greetroom, sun room, thermal glass, 3 bedroom, 2 DMhs.</p>
        <p>ceillmi I $71,600.</p>
        <p>Freshly decorated, energy efficient. Fireplace charm, heat pump, peting, eat-ln kitchen, 3 (</p>
        <p>carpeting, eat-ln kitchen, 3 bedroom, 2 baths. New carpel and paint. Heatolalor. 153,500.</p>
        <p>RESIDENCE COMFORT ENGAGING KENSINGTON PARK home designed (or living. Flret-owner care. Central sir, 3 bedroom, 2 baths. PLUS, near shope-bus. Excellent One Story Floor Plan, A Must To Seel. $51,900.</p>
        <p>FASTiblOUS UPKEEP CONGENIAL EDWARDS ACRES ranch highlighting comfort. Quiel street, great family arei central air, carpeting, 3 bedroom, IVk bathi Fireplace, House Is Freshly Painted inside... $54,500.</p>
        <p>WARM APPEAL</p>
        <p>ATTRACTIVE COUNTRY PUCE SubOivlslon, ranch provides woodsy lawn. KId-glova care, only one owner. Quiet street, greet family arei heat pump, paddle fans, carpeting, eet-ln kitchen, 3 bedrooms, 2 baths, deck. Fireplace. 156,006.</p>
        <p>PRICE-REDUCnONPRIZEl COLLEGE COURT RANCH-TYPE with pleaNng flair. Hardwood lloore, foyar, 3 bedroom, 1W baths. Fireplace, brick exterior. A FIrat-rale Home Value. Priced at 156,000.</p>
        <p>STORY-BOOK</p>
        <p>HOSPITABU ROUING MEADOWS ranch with price wpeel. Brand new. Quiet itreet, heat pump, carpeting, greatroom, thermal glasi deck, 3 bedroom, 2 baths. FIrtplace, Westminstar BulH Home. Nica Family Arei $57,950.</p>
        <p>PRICE-REDUCTIONPRIZEI KINGSTON PUCE RESIDENCE that Includes brick daaign. First</p>
        <p>CATERS TO FAMILY UFE 8UPER-8HARP ENGLEWOOD ranch radlaling comfy charm. First owner. Central Mr, gas heat, hardwood floors, foyar, dan, pallo, 3 bedrooms, 2 bathi Largs den with fireplace 6 iMng room wHh (ireplece. 078 500</p>
        <p>ENHANCES FAMKY UVmO SIMP80N4IILLBR00K SUBDIVISION ranch with price appeal. Under construction. Central air, carpeting, tormal dining room, walk-in closete, new kitchen, 3 bedrooms, 2 baths, thermal glass. Greatroom with Maaonary fireplace. $71900.</p>
        <p>PRICE CUT, MAKE AN OFFERI FOR EASY CARE see this dwrry Oaks TradHlonal nnch-type. First</p>
        <p>I bedroom or Playroom, unflnlehed 3rd I $iS9,000.</p>
        <p>MARVELOUS FLAIR SPACIOUS BEDFORD 2 story Traditkmri. Just built. Cheery fireplace, central Mr, formal dining room, family room with wet ber, wilk-in cloosti 4 bedroom, 3W baths. ALSO, pantiy, foyer, deck. Rrst floor bedroom.</p>
        <p>MAGNIFICENT ESTATE</p>
        <p>GORGEOLM COU^ 2 eioiy brick Colonial. KId-glora care, artf^</p>
        <p>owner. Formal dining room, walk-ln doaetl many bullt-lne, eat-in kitchen. Flreplaci Seller Will Pay $2000 Polnit andlor Closing Coal.</p>
        <p>owner. Central air, carpeting, kitchen appllancae Included, ewlmmlng</p>
        <p>S9l, 2 bedroom, 2 baths. Condominium. Great for your etudenf 1,000.</p>
        <p>$83900</p>
        <p>EASY-GOING ELEGANCE FOR QUAU1Y CH(^ tht|Miltu^  Williamsburg.  Brand</p>
        <p>new. Great family a^OMfSTmBMh^^ closeti eat-in kitchen, 3 bed^MKHlwhs.B^drlva. Maaonry</p>
        <p>FlrepleceSIMOt^^^^^^ HOItt UVABIUTY</p>
        <p>ENJOY THE OIAIIM of this wtlooming 1W story. Newly constructed. Greetroom, formal dining room, foyar, modem kitchen, 3 bedroom, 216 bathe, deck. Flieplece, Worth Seeing, Worth Owning. PriG04iut bonanzal $87,500.</p>
        <p>INVEST IN VALUE SEE THE CHARMS Of this Brittany Ridge 2 atory TrwHtlonol. New. Great family area, central air, greatroom, formal dining room, 3 bedroome, 2Vi baths. PLUS, carpeting, deck. Fireplace, Masonite Biding. $89.900.</p>
        <p>TRADITIONAL HOME CONVENIENCE CHEERFIA. 2 story wHh winning ways. Under construction, culdj^ lot. Qraal family arai dual coding, carpeting, gredroom, foyer. Brick</p>
        <p>sited on 100 acres. Formal dining room, country kltchan, 6 bedroom, baths, circular drive, terrace, bam, horse (aclHtlas, corraL Separata MaWs Quartars, Large Stable and Pasturei S65O,M0.</p>
        <p>CEDAR COURT MVESTIKNT SEVEN GREAT C0ND0NIN1UN8. Each 2 tredroomi 1W batln living room, dining arei modem kltchan, pdkw, stoves, refrtgardori diah-washer. All seven unlta (or $l59,oo.</p>
        <p>GREENFIELD TERRACE A LOT B NOW Available In Greenfield Tarrace. Just right (or your new home. 17,000.</p>
        <p>GREENWOOD FOREST LOT A LOT IS AVAILABLE on the Medical Schod side of town In pretty Greanwood Forest. Buy and bdld. $ie,IOO.</p>
        <p>GILEAD SHORES NICE LOT In this flna aiei Use and rigiit d way to boat ramp and pier.</p>
        <p>HIGHWAY 90S NORTH BUL0IN6 LOT wHh 130 fod frontaga. Good locdlon for your home. 1,000 square foot minimum. lULOOO.</p>
        <p>CANDUEinCK ESTATES NEAR THE HOSPITAL and In this great aubdMalon, this tot will accommodate that new home that you want to build. $11.950.</p>
        <p>SOUTH SIDE OF TAR RIVER APPROXIMATELY S9J1 ACRES locatad on the Ter RIvar In Ortmadand. Famland both clear and wooded. Has about 3 fed ol</p>
        <p>(rontaga dong the rivar. SlIAOIO.</p>
        <p>LANDf^DEVELOPNEUrr</p>
        <p>NEAR THE MEDICAL DISniCT. Farmland bdh dear and wooded. Fdty-flye acrra at HS.OOf per acre. Great (or rasidentid</p>
        <p>divilQpfnifit.</p>
        <p>PRICE APPUL</p>
        <p>ENOAOINO UNIVERSITY 2 story Cape Cod with tots of warmth. Paddle tani study, woodbuming stove, deck,city utllltlee, 2 bedroom 1% baths. Fireplace, single garage, Alum. Siding. $51.500.</p>
        <p>ENERGY EFFICIENCY DISCOVER THE CONVENIENCE of this cheerful Rdling Meadows ranch. Under construction. Quiel Street, greet lamlly arsi heat pump, , 3 bedrooms, 2 baths. Fireplace, (drag*. Weatmlnlater Built,</p>
        <p>FRIENDLY S STORY offering red comfort. Had pump, g^n^ thetmd gtoaa, pdio, 2 bedroom, 3 bdhe. ALSO, near atop^replece. Loft CouM Be Converted To 3rd Bedroom. Evanswood. $94,900.</p>
        <p>INVITING TRADITIONAL HOME FROPLACE warmth hdghtens this engaging 3 story. Gredroom, dnlng room, foyer, eat-in kitchen, 4 bedroom, 2W bdhi bay wli UntlnWiad 3rd floor. Storraa building. Pries cut, maka an</p>
        <p>fotmd</p>
        <p>indowi</p>
        <p>olfarl</p>
        <p>carpating, 3 bedrooms, 2 I HOWWarrMity. $58,950.</p>
        <p>ENERGY EFFICIENCY HOSPITABLE ROLLING MEADOWS ranch with family vduM. Under</p>
        <p>POSHUVABRJTY CORDIAL WESTHAVEN IR 2 etory WIIII</p>
        <p>wHh energy</p>
        <p>construction. Quiet street, great lamlly trei had pump, carpeting, eat-ln age. Weslmlnlater Built, HOW Warrwity.</p>
        <p>kitchen. Fireplace, garage,</p>
        <p>159.950.</p>
        <p>OFFERING RUL VALUE ROLUNG MEADOWS ranch with energy efficiency. Brand New. Quiet street, great family a^ heat pump, cwpetlng, eeMn_ kitchen, 3</p>
        <p>effldency. Formd dinihg room, (oyer, 4 bedroom, 2H bathe, bay wtmfcnre, privacy wall, doe drive. Fireplaee, Poedbie Liaie with Optton to Buy. 1114.900.</p>
        <p>FEATURING REAL CHARM KITCHEN AMM to (Me dtrwtive FdklMd Hwy. nmch. On Centrd dr, paddle lani hardwood ftoore, famUy mom, JantvA bedroomi 2 bathe, pdlo. ALSO, Panliy, llreptooe. 117.910. DEFliNlTELVir'</p>
        <p>tun aero range. 3</p>
        <p>DEUGHTFUL PRESTIGIOUS EA8THAVEN rtnoh. Centrd dr, orown756-5395201 Commerce Street</p>
        <p>TMm Whltalwral REALTOR. GRl, CRS.........3S8-S998</p>
        <p>CMtwrtawCraach. REALTOR ............385-4884</p>
        <p>SUriay Twclwr. REALTOR, GRl... .^.,   754488S</p>
        <p>LOW Stott, REALTOR........................</p>
        <p>Kir Dwta. REALTOR........................355-4980</p>
        <p>Nary Scwddai. REALTOR.....................351^4898</p>
        <p>Frawto Hama. REALTOR.....................7S4MMS9</p>
        <p>Amw Dwifda. REALTOR, GRl ...........714-8448</p>
        <p>Jack Dwffwi REALTOR. GRl, CRS...............754-5894</p>
        <p>r</p>
        <p>T</p>
        <pb facs="00096780_0068" />
        <p>C-24 Th Day Reflector. Qre6hvlHe, N.C</p>
        <pb facs="00096780_0069" />
        <p>The Dally Reflector, Greenville, N.C.</p>
        <p>Sunday, November 1987  C-25</p>
        <p>Hip</p>
        <p>ojSfoS . iS fi wS</p>
        <p>esiic| m</p>
        <p>i2 o o c _</p>
        <p>I- 3  O 2.C</p>
        <p>Cw 0 &amp;gt;  2;  ^</p>
        <p>U . * c J Q</p>
        <p>(^i  i Q</p>
        <p>S|li|l Silvia</p>
        <p>Hi</p>
        <p>XCC^JTtsCC^C^CC^</p>
        <p>in 'Ft h' h r? w X lC</p>
        <p>fo X r&amp;gt; r&amp;gt; lc cf; tg ic l-5 in</p>
        <p>lilt I I I I I I</p>
        <p>s0^minrtinNcsr5</p>
        <p>inminincMinininm</p>
        <p>r^r&amp;gt;r5r;inxr^rNr^</p>
        <p>3Ssis</p>
        <p>8^</p>
        <p>f?</p>
        <p>0</p>
        <p>js^sypw- .f</p>
        <p>Li.^'</p>
        <p>Wo.</p>
        <p>I!</p>
        <p>ss</p>
        <p>&amp;gt;</p>
        <p>3M</p>
        <p>2t</p>
        <p>U o</p>
        <p>a.</p>
        <p>f f</p>
        <p>1--</p>
        <p>ir ^ ^</p>
        <p>5 X 03</p>
        <p>^ 5 s</p>
        <p>X 0 &amp;lt;</p>
        <p>5 z =</p>
        <p>&amp;lt; &amp;lt; L</p>
        <p>;s ^ 0</p>
        <p>* "</p>
        <p>2  ^</p>
        <p>L J  0 &amp;lt; =;</p>
        <p>^O'XCrNC'CrM'i'O CM m o fc w-o in o M ^</p>
        <p>^XftO^tNwXMCM CM CM in ^</p>
        <p>I I I I I I I I</p>
        <p>sor&amp;gt;i0^mr&amp;gt;-inx</p>
        <p>r&amp;gt; X</p>
        <p>i X in X</p>
        <p>in^inincMinmLnmLn</p>
        <p>hr^h.r^xrNmr^xt^</p>
        <p>= j ^  = ^ &amp;lt; </p>
        <p>^ w &amp;lt; ^ X , * auJz&amp;gt;a:</p>
        <p>xx-tx^a^s</p>
        <p>&amp;lt;&amp;lt;000iiZ-</p>
        <p>m</p>
        <p>CM</p>
        <p>vO</p>
        <p>CM</p>
        <p>o</p>
        <p>X</p>
        <p>CM</p>
        <p>mm</p>
        <p>0^</p>
        <p>X</p>
        <p>r&amp;gt;</p>
        <p>sO</p>
        <p>rt</p>
        <p>rt</p>
        <p>X</p>
        <p>X</p>
        <p>X</p>
        <p>X</p>
        <p>r&amp;gt;</p>
        <p>h</p>
        <p>a</p>
        <p>CM</p>
        <p>m:</p>
        <p>m</p>
        <p>rt</p>
        <p>X</p>
        <p>X</p>
        <p>in</p>
        <p>O</p>
        <p>sO</p>
        <p>1-N</p>
        <p>r&amp;gt;</p>
        <p>9</p>
        <p>'W</p>
        <p>X</p>
        <p>&amp;gt;-&amp;lt;</p>
        <p>1</p>
        <p>X</p>
        <p>in</p>
        <p>m</p>
        <p>si</p>
        <p>CM</p>
        <p>fN</p>
        <p>c</p>
        <p>m</p>
        <p>m</p>
        <p>m</p>
        <p>m</p>
        <p>m</p>
        <p>X</p>
        <p>X</p>
        <p>X</p>
        <p>jy*J</p>
        <p>X</p>
        <p>h*</p>
        <p>X</p>
        <p>X</p>
        <p>fN</p>
        <p>r&amp;gt;</p>
        <p>h-</p>
        <p>X</p>
        <p>r^</p>
        <p>X</p>
        <p>:5 ;-S</p>
        <p> 5 7 H 2 ^2 ^</p>
        <p>' Z  i; it u</p>
        <p>X J  j 5 0 ^ ^ X &amp;lt; =  T V ^</p>
        <p>&amp;lt; 2 w &amp;gt; w  &amp;gt;</p>
        <p>i: ^  ^  2  H</p>
        <p>&amp;lt;oaxi/2&amp;lt;s</p>
        <pb facs="00096780_0070" />
        <p>V</p>
        <p>^C-26 Th Daily Reflector. GreenvIHe. N.C. Sunday, November22,1987</p>
        <p>II  Mobil* Homo Lots Po^ Salo</p>
        <p>;*IS@RrW5$SR</p>
        <p>**90*  Olinter:tyt Mt iim an</p>
        <p>&amp;gt;1* offr. CaHJIg^ wiytlm, 7S3-</p>
        <p>wostrf</p>
        <p>loiamobile . k)t 2bay&amp;gt;h3p. n. Can Morco S019or7aM7.</p>
        <p>152 Uts For Sale</p>
        <p>ilLOiU W In^oG Bradlty Estatas. Wintervillt &amp;gt;^Sdwol Diatrld. WoiM lots. RastrKitlvt covenants apply. Listing Brokar, Rictwrd Aan. Ttw Raat Estala Contar, 3SS^ ,or7S^.</p>
        <p>152 Lots For Sal*</p>
        <p>A?S^ES?*^ivaMab^ prestigious area atnacent to Briarwood. $4S,000. Call Jean-nattaCox Agency, Inc. 75-1323. BAUtl^UL wooded lots In subdivision lust outside of Graanvilla. Call Faya Stewart at J.L. Harris a Sons, Inc. 75*4711 or 753 2010.</p>
        <p>BRITTANY RIDOE Excellent lots available. Get yours new and be rea^ to build by Spring. University Realty 3SS-5: Jean Hopper 7-*142.</p>
        <p>LOT FOR SALE- over 3/4 of an acre In county. Just a few miles out of town In Wlntervllle ScImoI District, Bell Arthur water. 113,000.756-133.</p>
        <p>NEW HOME</p>
        <p>Simpson Area "in the country</p>
        <p>This three bedroom home is situated on a large lot in the country near Simpson. It is the afford-ably priced, well built and attractively decorated home you have been waiting for. Kitchen and dining combination with stained cabinets: color coordinated Miallpaper and carpet all complimeni this lovely brick home. Priced In the $40's.</p>
        <p>^Company</p>
        <p>Gfeenviie. Inc.</p>
        <p>euMsrs. OovaMpars. RaaAws  v</p>
        <p>752-2814</p>
        <p>Jack Gordon...........;. .355-5404</p>
        <p>Winnie Ewans.. ...........752-4224</p>
        <p>152 Lots For Sale</p>
        <p>152 Lots For Sale</p>
        <p>COUNtkY 2-t- ACRES psurtlall woodtd, accMS to Bell Arthu</p>
        <p>water, provisional</p>
        <p> ly</p>
        <p>... Artiujr pwlc test</p>
        <p>r Rumbley</p>
        <p>Drew Rumbley,35S-. COUNTRY  resldsntlal h&amp;gt;ts^ proxlmately 17,000 square feet each, city water and sewer, less than $4,000 each. Rumbley Real-ty, 355 2042 or Bill Fell, 244-213.</p>
        <p>CRAFtwlNbi Residential lots In Wlntervllle. City water and sewer. Curb and guttering. Wlntervllle schools. Choose yours now, call today. Blanche Forbes Realty 75-2l21 or J.C. Bowen 75-7436.</p>
        <p>FIND YOUliiELF lb an ex-cluslve subdivision tor under $20,000. Rumbley Realty, 355-2042 or Janet RIcclarelil, 746-4991.</p>
        <p>gBHaCCrAtkE one acre lots, wooded, less than 5 minutas from Carolina East Mall. For doublewides. (Owner llnanc-).75-5t14or754-4015. aTe lots east of Green-vllle, 2W to 5 acres. Available In I with 1500 square foot minimum. Owner financing avalMile. Heavily wooded ana contoured with hills. Priced between $12,500 and $20,000. Call Jule White, Clark-Branch, 355-3000or 75*4006.</p>
        <p>JEANNETTE COX AGENCY</p>
        <p>REALTOR 756-1322 1S16 Qreenville Blvd.</p>
        <p>IF YOU ARE MOVING TO GREENVILLE CaH 750-11322 or write P.a Box 067, OreenvIHe, N.C. for your free copy of 'Homes For Uring", a monthly pubitoation packed with piclurea, detalla and prices of homos and available locally.</p>
        <p>OF YOU ARE MOVING TO A NEW CITY</p>
        <p>Get your free copy of Homes FOr Using', In the cHy you are going to. Know the reel estate nwrkel before you got there. Your copy Is In our oHIce. Wo can help you buy, sell or trado a homo any place in the nation.</p>
        <p>EdMrardf Builders</p>
        <p>Johnnie</p>
        <p>F.Jr.</p>
        <p>(J.F.)</p>
        <p>OPEN HOUSE</p>
        <p>$UNpAYT-^j&amp;gt;.m.  603  Cedarhurst  Rd.</p>
        <p>WesthavenVr Two year old farmhouse style home. Large (178 x 132) master Buite with ceiling fan, walk-in closet and private bath. Two more bedrooms and another bath (upstairs). Downstairs, greatroom (132'' x 24') with fireplace and ceiling fan, dining room and front entrance hswe hardwood floors, eat-ln kitchen with removable Island, powder room and laundry room with pantry. 12' x 13' deck, fenced yard and attached stor^. Owners must sell quickly!</p>
        <p>^Cg5g0990</p>
        <p>tv</p>
        <p>7</p>
        <p>w:Rollinwood Homes Phase II</p>
        <p>Our new model is spacious and beautifully decorated and beat of all, Its for sale! I Featuring built-in microwave, a corner jacuzzi tub, mirrored walls, spiral staircase and all appliances. Your family will love the large loft overlooking the</p>
        <p>iireatroom and dining room with skylights. Every home eaturea a large courtyard, which offers much privacy, and outside storage. Choose from 2 large bedrooms up to 4 bedroom plans to suit any family ned. Youll love the convenience and maintenance-free lifestyle here. Home under construction and starting at *89,900. Many options available. $2000 in points and/or closing costs paid by seller.CLARK-BRANCH,REALTORSPhone 355-2000 or 750-4511 afternoons or 756-1997 nights1:0910 44X)</p>
        <p>MlTiiOME lot with M. tic tank, wall and etacfric meter. Located near Bells Fork. Price reduced. Call Mary Catharine ^ ^kas at J.L. Harris B Sops, Inc. 750-4711 or 75*5447.  v</p>
        <p>kiAK ^ASmvIlL. large country lots. Call Faye Stawart at J.L. Harris and Sons 750-4711 or 753-2000.</p>
        <p>LASt Lot available on golf course, loins II fairway at Indian Trails Country Club. Super building lon20 x 200. Call Roger DaveivMrt at J.L. Harris &amp;amp; Sons, Inc. 750-4711 or 524-5432. LOt At PAMLICO Plantation; Lovtly woodod lot for $25,000. Call CENTURY 31 JANET BOWSER &amp;amp; ASSOCIATES for more Information, 355-7000.</p>
        <p>REilOfeNTIAL BUILDlkO lots available in Orexelbrook and Forrest Hills. Call Elizabeth Modling at J.L. Harris &amp;amp; Sons, Inc. 75*4711 or 753-3947.</p>
        <p>2.19 ACRES located between Greenville and Kinston. Great sacludod wooded lot. Call University Realty 355-5044 Jean Hopper 754-9142.</p>
        <p>3.0 ACRB lot located between Farmvllle and Saratogooft Hwy</p>
        <p>IMlUhFwStte^</p>
        <p>iV OWkER: IVk acres, vary ^^^fo, highway 43 WVst. Call</p>
        <p>152 Lote For Sal*</p>
        <p>152 Lote For Sale</p>
        <p>Lt Fbk SALE'HOLLY RIDGE Subdlvisian-Restrlcted. 7S*S935 after 4 p.m.</p>
        <p>RAM HORN. Cheap. 3-F scree. Call Morco anytlmo, 752-5019 or 758-3007.</p>
        <p>112 ulAteFdl^</p>
        <p>1 OR 2 ACRES Tracts fwar Aydan GrHton High School. Call 743744.</p>
        <p>244. Price $12JOO. Cali Worley</p>
        <p>________ _ ridge i</p>
        <p>Southerland Raalfors, 7&amp;amp;-3500 nights 795-3232.</p>
        <p>Warren at Aldridt</p>
        <p>$$SAVE$$</p>
        <p>*THOUSANDS**</p>
        <p>Homes, Farms, Condos, Lots, Apt. BIdgs., Mobile Homes, Time-Sharing Units... and ALL types of Investment Properties. AND... any kind of BUSINESS...</p>
        <p>Large or Small...LOCALLY and All Across the U.S.A. and CANADA...</p>
        <p>NO BROKERAGE FEES FREE Info on BUYING or SELLING 756-0380 WILLIAM C. FORBES LOCAL ADVERTISING DIRECTOR</p>
        <p>1905 SOUTH PITT QREENVILLE, N.C. 27034 Coda Number Q-1 IS</p>
        <p>(Auxiliary NATL. *1-800-222-3113 for info to be maliad)</p>
        <p>to ail our frienis in</p>
        <p>GUENViuEMNinncoom</p>
        <p>from the Office and Staff of</p>
        <p>mmsm UALTY</p>
        <p>1607 Charles Blvd. 355-5666</p>
        <p>^AGENT ON DUTY^.. W. Bradley Gr^ 752-3699</p>
        <p>Associates</p>
        <p>NATIONAL</p>
        <p>4507 W. 8th St.</p>
        <p>Company</p>
        <p>HEADQUARTERS</p>
        <p>Cincinnati, OH 45238</p>
        <p>yB-s. BLANCHE FORBES REALTY yB-\.</p>
        <p>%</p>
        <p>BUILDING LOTS AVAILABLE</p>
        <p>Choose your lot today from the many we have available, Winterville school district! Country! Near Hospital! Near shopping! Call now for locations</p>
        <p>BUSINESS OPPORTUNITY</p>
        <p>approximately 2917 square foot building located on a corner lot m Qreenville Call for more 'information today</p>
        <p>CIRCLE THIS AD if you now</p>
        <p>pay rent This 3 bedroom DricK 'anch with carport is wailing fo' you Farmers Horre financing possible 'or qualified buyer SA3.500</p>
        <p>Call Tociay Will Reid Realtor 752-1609</p>
        <p>COUNTRY SUBDIVISION</p>
        <p>features this lovely 3 bedroom, 2 bath brick ranch. Large deck Farmers Home financing possible for qualified buyer $43,500.</p>
        <p>SPACIOUS TOWNHOME 3</p>
        <p>pedroom interior unit features beautiful floor plan Fireplace, patio, 2': baths Excellent condition $56.900</p>
        <p>FAST GROWING AREA fea</p>
        <p>lures this beautiful newly conslrucled 3 nedtoom 2 bath nome. KUvhen wiin nook, dining room fireplace, bnck patio. Energy efficient $63.900 HURRY' HURRY! HURRY$ Don'! let this one shp by Conveniently locaiert 3 bedroom, I'.balh home offers living room, fami', room, enclosed porch, .an 1 . fenced back yard $53,900, CONVENIENTLY LOCATED 2 bedroomi. i'bath - ,;n dominium Fireplace pabo witn pnvacv fence, cen-ai heat-air. and rnuch more Call to see $42,500.</p>
        <p>GO AHEAD and fall in love with this adorable 3 bed room 1'. hath brick</p>
        <p>ranch Paho, carport, sto' age building. Great family area $59,900.</p>
        <p>ENJOY LIFE' Private palio, attractive townhouse, 2 bedrooms, l': baths, living room with fireplace Easy lifestyle $40,900. GRIFTON. Home of the Shad Festival, features this outstanding buy 3 bedrooms, nice built-in cabini-ts hardwood floors, outside stoiage, and im-mediaielv ava.lable BEFORE YOU LOOK anywhere else see what this 3 bedroi'jrfi home has to offer Farmers Home financing possible for qualified buyer $47,900,</p>
        <p>GREAT FAMILY AREA TniS 3 bedroom 2' : balh town-</p>
        <p>house is conveniently located in a quiet area Fire place, patio, end unit $57.500</p>
        <p>INVITING RANCH with brick exterior 3 bedrooms, cape! ing, storm -windows Country location Farmers Home financing possit'le lor qualified b u y r</p>
        <p>$37,500.</p>
        <p>LAUNDRY CENTER Excel lent Business opporlundv Little personal attention required CaH for more m formation</p>
        <p>COUNTRY Appr &amp;gt;. imately 2 48 acre lot mmules 'rom City Call 'or iocath ' $14,500</p>
        <p>VISUALIZE A STRIKING nome on eithe- of Iwo a</p>
        <p>Hiiis App-roximately 1.5 iicres each One features I'l ground pool ACREAGE! Approximately 91 acre f.nrnt located minutes from Greenville Call i-u more mformalion</p>
        <p>WATERFRONT ACREAGE</p>
        <p>Located on North Creek near Bath with approxi-matoly 3 89 -K.res View of Pamht ij (ryrt '01</p>
        <p>BETHEL Corner lot atjproxi mately 150 X15'j Zoned Ft 6 Call 10' loi.,ation $12.000</p>
        <p>ACREAGE SOUTH of</p>
        <p>Gmenvil's- Apf;- 'ximateTy 5 actf'S about 5 miles on High'w-.iy 11 Call for more inforrnation today</p>
        <p>Will RFID KFAI IOK ....... 753-1609 RUDY SCHULTF, KF.ALTOK  756 22,30</p>
        <p>tUAN(.HF fORBiS RF\l.TOR-GRi-CRS, 756-3438 LARRY MOZINGO, SAl.FS ASSOC lATi  756-6953</p>
        <p>OFFICE OPEN MON.-FRI. 9-5, SAT. 9-1, SUN. 1-5 .  2717  S.  Memorial  Dr.  iSl</p>
        <p>756-2121</p>
        <p>EOUAl HOUSINQj opportunity</p>
        <p>Ask About Our Home Warranty Program</p>
        <p>RUMBLE REALTY </p>
        <p>''Where Peoph Go...  Who  Still  Value  Service''</p>
        <p>NEW OFFERING</p>
        <p>LARGE, COMPLETELY REMODELED with new carpet, new paint, new central heat and air, assumable loan and some owner financing possible. Low $70s. Listing Agent: Drew Rumbley.</p>
        <p>LEASE/PURCHASE POSSIBLE on this 3 bedroom, 1Vi bath ranch, carpet less than 2 years young and home la in immaculate condition. Listing Agent: Drew Rumbley.</p>
        <p>FEATURE OF THE WEEK</p>
        <p>UMQUEll That's the best way to describe this brick home located )ust 10 minutes from Greenville. This house should be on your menu. It comes served with 3 bedrooms, living room, den, large fenced yard and carpet throughout. Listing Agent: Janet Ricciarelli</p>
        <p>ONE OWNER. 3 bedroom brick ranch on a well landscaped Vi acre lot. Mid 940'a. Listing Agent: Bill Fell</p>
        <p>A LAKEVIEW, COZY FIREPUCE and this custom built home in the Wlntervllle School district mixed together with you as the main ingredient would make the perfect recipe. A Thanksgiving delight I Ckx)k this one up today I Owner will pay $1,000 In closing cost. Listing Agent: Cindy Hoblltzell</p>
        <p>8HEMI BUS8II Ckiuntry living yet close to Qreen-vllle. Home situated on 214 acres Is like newl Move-in condition. Listing Agent: Janet Ricciarelli</p>
        <p>And there's more-We have info on over 800 Greenville listings!i.</p>
        <pb facs="00096780_0071" />
        <p>JmA</p>
        <p>Qukk moM cSn Awty. SM34 orSW-741.</p>
        <p>Fni8Hi8Bmr</p>
        <p>Soed NmI i anrnmnm m to MVt ThOUMIlM ef</p>
        <p>Er?si!i;tr.rari:</p>
        <p>oomoMMoollWi ttiot yod oro fliw r bilorwt poym^</p>
        <p> fot ttot ominol vM iistf to HMilc mm tiouMhoM Iwyrovtmonti. All tMt and itlll moto menIMy poymont lowor ItMn you aro now makhw. No</p>
        <p>sirrJr!L*s</p>
        <p>.1SS</p>
        <p>Rtsort Proptiiy Por Salt</p>
        <p>Ma m Minan Croak community. tSaaa Mi ranoa from HIM to 180.0W ano tha vlow li</p>
        <p>Cali CENTURY</p>
        <p>II janE^t bowser a</p>
        <p>ASSOCIATES, tor your panonal ilMwlaotodayi Thaoo loto won't iartici3ss-noo.</p>
        <p>UKI AIT6I MAR and K^iGAto-FREE-Calior wnto Tanjlawood Raalty, P.O. Braoay, VA 23911, (M)</p>
        <p>M MOlf ifAFfct. Im macuiata homo, ouMt houM on 5 tract on larga jw. Piar. Oown East Baautort, NC</p>
        <p>IWiVtMaMt^irlp alIlM Ihooa unnaad-wHb a taM action ad. Qill ISUm.</p>
        <p>155</p>
        <p>Rtsort Proptiiy </p>
        <p>-#?#o#|ala</p>
        <p>iMiwraviwgn'iik</p>
        <p>SMfIS AttintMn1lvoitori,thto oMMMtrant condo wM t laM loM at bolow markat valu. 2 w, 2 balhi, fumiihodi ator, waihar, d^. Annitto. ParMr-Byflor. 11 Tipian, 37B or</p>
        <p>MYRTLE</p>
        <p>.. J Mdraom, 2 condo. Contact</p>
        <p>*S:</p>
        <p>balhi</p>
        <p>Asooclatofc</p>
        <p>71X13 or 3S5-7009.</p>
        <p>Contry tes, 3S-</p>
        <p>6gftA0kl iStAtib ftrand now con^porary homo fully Mnlihad has thrao bodrooms, 2 bat^ groah^ with cathadral cMlng, woil^,- many moro ox^. Ask fgr Suo Dotm at AMMn A Soiilharland Roal-</p>
        <p>157</p>
        <p>Townhousts ForSolt</p>
        <p>sa!?sss'.ra</p>
        <p>Cali ^ Ebordt 7S0-S72I or Allco Mooro Raalty, 35M712.</p>
        <p>mok I llbkM</p>
        <p>townhouso, liko now, lovoly docor. Excmtional location.</p>
        <p>nrerr</p>
        <p>Oli i kkbftPoM liat, Hkk's unit Quail RkM. 2000 SRuara toot, boautltoilly daco-ratod, larga patio. Assumablo loan to quaimod b MOS. Cali altor Ap.m&amp;lt;</p>
        <p>buyar. MM</p>
        <p>n.W^.</p>
        <p>WilliAMiikMAil6*-Liko now townhouso wHh two ovtr-stoad badrooms. SimcIous floor plan. Prvalo salting with groat naighborsi Only filim. Call Janat Bowsor, CENTURY 21 JANET BOWSE R A ASSOCIATES, 3S5-7I00 or 750-0.</p>
        <p>WMdy rim  Enjoy tha good lift. Extorlor, pool and wnnls courts malntalnod by 0 atoa- Functional wood</p>
        <p>burning firoplaco sot in wauHtuupiiat room. You won't</p>
        <p>ww</p>
        <p>bodriom, 2% batntKxna In I SMto. Call ERWIN REAL^ 3M-I070 or Jim Burhans SM7.</p>
        <p>157</p>
        <p>Townhousts For Suit</p>
        <p>9DTrr</p>
        <p>thisluxi</p>
        <p>TCiCTti mm Imurlous 2 badroom, 2 bath</p>
        <p>townhoma, localod In Cyprus Crash. Olhor foaturos of tl)ls custom dsslonod homo InchiOM</p>
        <p>eontral vacuum systom, masonary nraplaco with rock oroflla, cattMWOI colling and nirga patio. 0mm will soil or consMlr rant wHh option to buy. Contact us today tor ygur por-sonal showira fm. cSdwoll Bankor, W.O. BloUnt A AsaoclatoS RooHor. 201 E. Arlington BIM. 7SO-30W or SSMOM. gmikilLhTaWittiniya</p>
        <p>townhomas loft In this sAiall compltx, whkh providso a tool-</p>
        <p>lau'iiaRJnsiiSisss:</p>
        <p>thoso brand now homas ora dsstanad tor poqpio on tha go. BMwr pays Il3oo of cost. Uni-</p>
        <p>gwpw</p>
        <p>varsity Roa. Hoppor7SA1</p>
        <p>3SS-SIM: Joan</p>
        <p>badroom unit toaturas boautlful floor plan. FIraplaca, patio, 2V0 baths. Excallant condition. Blandw Forbos Roalty 7S6-2121 orWIIRold792-1M9.</p>
        <p>U1</p>
        <p>Apartments</p>
        <p>ForRtnt</p>
        <p>1 and 2 badroom apoHtnants ap^ proximataly 1 miio from hospital. 1 yaar loaso, no poto. Wlashar/dryor hook-ups, wator and sowar provMad. Call 730-1434, 9:00-3:00. 333-7005 aflor 0:00.</p>
        <p>A PiiRNISHED11 badroom 020 or 2 badroom 1393 won't last. 73M373HOMELOCATORS Foo.</p>
        <p>aPiiYAlacei</p>
        <p>Williamsburg Manor 2 BEDROOM TdWNHOUSE NIca dscor, extra storage. No potoJSA0S02 after 0p.m.</p>
        <p>A iMPl BtbftM apart-ment, carpolad, all electric, air eondltlonod. 420 W. SIh Straat. MIOper month. 73A72I3.</p>
        <p>Anaif hWi 2 badi^. m</p>
        <p>ssr^tX-</p>
        <p>Cantral location, ancas and oxtras. Sorry no chlldran or pats. S301 m-Tln.</p>
        <p>141</p>
        <p>Apertments</p>
        <p>^Rfnl</p>
        <p>mvrmwf kw mtigt.</p>
        <p>Oraat locstlen. Partially tor-nlshod. Two badrooms, washor/dryor hookups. Call 730-1407 aftor7p.m.</p>
        <p>bedrooms, m baths, all appll-ancas, obla hook-up, m mllos from ECU, bus ssrvlco, avail-abla January l. 0310 a month. Cadar Court Apartmonto. Call</p>
        <p>AtflNVlON StilblhTS, 2 badroom units, one laval, ralax-</p>
        <p>ftaroa. Walk, rids bkMio or U bus to campus. Colloga yiaw ApartmantoTt. Jx. ttoiiHs and Som, IncitoaHors, 200W. 10th Shoal. 73A4711.</p>
        <p>wfcsxr</p>
        <p>oon,on V4</p>
        <p>must</p>
        <p>WTOCTRff</p>
        <p>fMlST ffflMMOA#</p>
        <p>IO.Cll7SI-iaiM9^4l00.</p>
        <p>AVAHaiH 6Kmii-1</p>
        <p>Exlramoly nlca, brand now, 2 badroom. 2V3 bath duplex. Almost 1300 squoro toot Mus 3rd story walk up. Appliances in-ciudad, walking oistanca to ECU. 0473 month. Call Brian</p>
        <p>_ _  0473  I</p>
        <p>Jonas/Brokar</p>
        <p>1775.</p>
        <p>73A4440 or 730-</p>
        <p>AV6iii. 02t3 a montii. 2 bedroom duplox, almost now, washor/dryar heekujn.</p>
        <p>AZALEAGARDENS*</p>
        <p>CLEAN AND QUIET one bedroom fumtohad apaiimanto, energy affldant, free wator and sewar, optional washars, dryers, cable TV. Couples or singles only. 0193a nwnth. monthloasa. MOBILE HOME RENTALS -Couples or singles. Apartments and moMla homas In Azalao Gardens near Brook Valley Country Club.</p>
        <p>Contact J.T.arTommyWllllaint 730-7013</p>
        <p> BHOOKSfDE-</p>
        <p>APARTMENTS</p>
        <p>One badroom, fully carpeted, cable availabla. washer/dryer hook-ups. wator fumMiad. 0230 par month. 732-4393 and 730d19|.</p>
        <p>141</p>
        <p>ApBrtmititB</p>
        <p>For RmA .</p>
        <p>_________________lUtooms,</p>
        <p>m baths, avallabio Neusmbor 31, month to manth. 0375. Blanche Forbes Rosily, 730-3131.</p>
        <p>orbas Really, 790-3121</p>
        <p>CAmm^</p>
        <p>HOUSE</p>
        <p>APARTMENTS</p>
        <p>HIGHWAY 43 SOUTH 2 badroom townhousos, all otac-trie, fully carpeted, pool and laundry room, no pets.</p>
        <p>756-3450</p>
        <p>AFTER 5:00 P.M.</p>
        <p>Cherry Court</p>
        <p>. jlous 2 bedroom townhouso wHh IVS baths. Also I bedroom apartments available. TUI are corpelad, with modem kitchen appi lances Including compactor and dtohwasher. ContraTtoat and air. Free basic cable TV, water and sawar. Washer/dryer hook-ups plus laundry room, pool, sauna, tennis court, club MUM 7S2'1SS7</p>
        <p>gERng Ecu 3"bedroom duplex. Central.air and heat, hardwood floors, frosh paint. 0303.734-7400.</p>
        <p>, Y N6 A AlA to Iva? Than we've got a place for youll Spacious 3 badroom, 3to bath duplex In quiet surrounding, convantant to mall and hoe-pltal. Reasonable rant payments. If intarestsdcall ERWIN REALTY 353-7070 Erwbi 3334016.</p>
        <p>bUPLEX FOR RENT nMr hos pital. 3 badroom, groat room, llraplace. Available December 1.0340 per month. 730-5702.</p>
        <p>Carolyn</p>
        <p>FOR RENT-IMMEDIATE</p>
        <p>occwancy-2 bedroom duptax-iof-lf White Hollow Road, |ust oH 264 Bypau off of Sth Street. Fully carpeted, 1 bathroom. Move and rafrlWator furalsh-ad. Elaclric heat and air condl-tlonad. Yard malntalnad by ewnar. Rant 02M&amp;gt; a month. One iMfnh ftfif  M  Mcuftty</p>
        <p>dapooH, 12 month toase. Nopids. Contact BUI Laughinghouse, Bosltc-Sugg Fumlturo Co., Inc., 401 W. iwi Street, Graanvllto. Days 730-2513, night 736P230.</p>
        <p>Carolina East Realty. Inc.</p>
        <p>355-7774  2192 S. Evans St.  Qreanville, NC 27834</p>
        <p> ejRTOC</p>
        <p>EVELYN BULLOCK REALTOR 7S2-4707</p>
        <p>OPEN HOUSE</p>
        <p>Sunday 2-5 P.M.</p>
        <p>BEAUTIFUL HOME on a country lot. 3 bodrooms, 2 baths, a truly lovely greatroom with fireplace, kitchen with breakfast nook and formal dining room. 072.800. OlraelloiM: Take Stantonsburg Road (1200), left at Bell Arthur turnoff (1206), right at store (1216), cross railroad tracks, follow road to stop sign and take left on 1217. House across road from Stoneybrook Subdivision. Hostess: Evelyn Bullock.</p>
        <p>NEW USnNG. Excellent starter home or Investment In University area This 3 tied-room home has  9.5 FHA loan assumption and priced In the I40*s.</p>
        <p>jik</p>
        <p>NEW LISTING at WMstonburg. Immaculate and spacious 3 bedroom, 2 bath brick home on large lot. Just minutes from Farmvllle. Low IBOs.</p>
        <p>HOME ON wooded lot in Ayden. 3 bedrooms, 2 bathe, family room with fireplace, carport and fenced yard. Low tSOa.</p>
        <p>NEW LISTIML Sellers have outgrown this little doll house. Features brick exterior with 3 bedrooms, living room, spacious qat-in kitchen and sunny, carpeted screened-in front porch. $31,900.</p>
        <p>CONTEMPORARY ranch home with deck and privacy fence. Cathedral ceiling In greatroom with skylights, 3 bedrooms, 2 baths, formal dining room. Low $80*a.</p>
        <p>OFFICE SUITE for lease. 4-5 offices with private entrance and bath. Space and price is negotiable.</p>
        <p>0.50 ACRES. With 5 room house and bath. Property borders on 2 state paved roads. Only $94,900.</p>
        <p>MUST ffftt Sellefs already moved from this 3 bedroom home with country kitchen, large fenced backyard and maintenance-free siding. Won't last at only 941,200.</p>
        <p>INVESTORS! Income producing property near university. Site Includes one 4 bedroom, 2 bath brick home. One 2 bedroom, 1 bath brick home. One 51xS0' commercial building and one gigantic workshop wired for 220 volts. Complete property has street access. Owner ready to sell and will consider some financing. Priced to move!</p>
        <p>BEAUTIFUL wooded building lot for your dream house. Only 910,900.</p>
        <p>ATTENTION first time home buyers. Or if you have not owned a home in the past 3 years. NCHF has a program available that allows up to $2,000 credit on your taxes, If you qualify. Stop by the office or call for de-tftHd.</p>
        <p>NEW LISTING. Owners transferring. Winterville. This 7 room, bath home with triple garage will supply all your needs and can be yours for only $43,900.</p>
        <p>NEW LISTINQ. This 10 room country estate offers warmth and elegance with quality youll find In only a custom built home. It has formal and Informal areas and only minutes from Greenville. 904,500.</p>
        <p>A</p>
        <p>WHEN YOU'RE TRYING TO</p>
        <p>your dollors, we con show you how thru</p>
        <p>Morgage Credit Cemificates</p>
        <p>WMch will dkw quoRfied, deierving families, Hke ytw, who ore fn^ to qooMy for home leans, to receive o mhiimuffl of $10v/ inonth back in YOUR woliet  not your landionl's or the IRS si We can show you how to receive a mbrimum ef $100 per month - yes thofs right - at leost $100 per montb back in your paycheck. CoD os for ol the detalsl</p>
        <p>StcMoa II of DovomUro Sqwn it mw opaol Wo kovo MOM vraoM loto owMIo M Ml tor ai</p>
        <p>flppOHIimMllIe Wi CUMVf mrni</p>
        <p>P.S. Alio, wo'd imt Hit to lot yoo know thit tho hrtofwl iwlos m</p>
        <p>evonshirt:</p>
        <p>MAT</p>
        <p>756-8485</p>
        <p>1</p>
        <p>P.O. Box 388 Wlntervllla. N.C. 28590 (919)756-8485</p>
        <p>141</p>
        <p>CYPRESSGARDENS</p>
        <p>ilMdn</p>
        <p>bMii H6IALI f</p>
        <p>SM3 er 2 badraam 93 Mils 732-1373 HOMELCCATCRSFoa.</p>
        <p>EASTBR(X)K AND VILLAGE GREEN APARTMENTS</p>
        <p>One, twa and Itirae badraem opartmanto, toaturlng coMa TV, modorn amltonoas. dean laundry taclllftoc, swimming poeto, fully carpatod.</p>
        <p>Office: 204 Easlbrook Drive</p>
        <p>752-5100</p>
        <p>FAIRLANE FARMS APARTAAENTS</p>
        <p>U&amp;amp; 3 BEDROOMS</p>
        <p>WHh Flrsptoct A Colling Fans S93 Sscurlty Otpotll *6 A 12  i WMto</p>
        <p>AAonth Lasses Washor/Oryar Connocttons Pato Conditional Two Full Baths In two &amp;amp; Ihroa bodrooms. *Nsw apartmonto availabto  'v</p>
        <p>AAONDAY-FRIDAY 9:30-3:30 SATURDAY 12-4 SUNDAY 1-4 ISIOBrWtoCircIo 335-2190</p>
        <p>Located off Hookor Road on Harsathoe Orlva.</p>
        <p>Equal Housing Opportunity</p>
        <p>FARMVILLE 2 badroom apartmanto, rtfrlgarator, stovt, path), cable raady, vary ctoan and nico. 230 a month. 7-^S0</p>
        <p>The Daily Reflectcr, Greenville, N.C.  Sunday, November 22,1987 C-27</p>
        <p>141</p>
        <p>AMiimeflts For Rent</p>
        <p>HffiSWGra</p>
        <p>IMng room, kMetton, duptox. Hoar pump, firaplaoa. l yaar ^ 1h ZfSSt. PtoOM I.736S4P.</p>
        <p>toa vat</p>
        <p>GreeneWay</p>
        <p>Large 3 badraem garden aparten with 7 desato, kitehan appHancas iiahwasliar. central</p>
        <p>  air. Free basic cabto</p>
        <p>TV, wator and sawar. Laundry reams, spacious grounds, ptoMpiiuntf and pool, obundwit</p>
        <p>porCRg^ Pats altowod. Adiaosnt to Graanvllto Country Club. (9293). 7364169.</p>
        <p>AAEDICALAKT</p>
        <p>Apartments... Nearly Brand New..3 badraoms.-Walklng Ototonoa to Hoopltal..WMhar-Dryar Haok-ups..Outslda Starago..Fully Carpatod, Super lnsulatad...lfa pats...Ooposit and yaor's toaia"Call Davis Ra-aity 732-3000 or 736-3904 or 335-2y4or 70-9672._</p>
        <p>141 A^rtmanto</p>
        <p>Rent</p>
        <p>Nhw 2 iSOROOM tewnhomoA carpatod, waihar/diyar hookup range, mfrtoarator, dithwaslwr.</p>
        <p>East I4th Stroot.</p>
        <p>CHIlilf duptox. Appli-f*Jkupo. Noar mall and hOSpMal. 756-2671 or 730-9100.</p>
        <p>141</p>
        <p>,A^rtmtiit9</p>
        <p>Rant</p>
        <p>SYMW6 rotti 2</p>
        <p>bodrooms, availabto immadiato-ly. Subtoaeeuntil AprH 1. ICOoff Dacambar rent. OS^dspoaH. $401 pw month. 1374-E FMrtona Farms. Call 7366110 or 335-3191 (Fotrlana Farms) and ask about sublease.</p>
        <p>NtAh aMNii I bod^</p>
        <p>200 Milt paid or 3 badraem 273. 7-l373HOMELOCATORS Foe.</p>
        <p>NiA itiAlTAL 3 bodr5m townheuoa. Qutot neighborhood. Call 737-0671 aftor 3 p.m.</p>
        <p>NEW I BEDROOM apartmonto: Washar/dryar, cable TV. carpal, aloctric heat, air conditioning, appltoncas. 736-3342.</p>
        <p>KINGS ARAAS</p>
        <p>Largo I badroom apartmonto. Carpeted, modem kHchon appliances. heat pump tor snargy affktont heating and cooling. Laundry faclllttos. 1309 Charlas Boulevard, Offica Apartment 104. Also Availabto Fiimishad Apartmanto.</p>
        <p>752-8915</p>
        <p>NOW RENTING _</p>
        <p>WILLIAMSBURG MANOR</p>
        <p>LXRYAPARMENTS</p>
        <p>Features</p>
        <p> 2 large bedrooms  IVk baths</p>
        <p> Thermopane windows</p>
        <p> E-300 Energy efficient</p>
        <p> Heat Pumps</p>
        <p> Spacious floor plan</p>
        <p> Beautiful individual Williamsburg ' interior</p>
        <p> Patios with privacy fence</p>
        <p> Washer/dryer hookups</p>
        <p> Kitchen appliances</p>
        <p> Custom built cabinets</p>
        <p>CALL 756-7647</p>
        <p>Nl^ts or Weekends 756-8580</p>
        <p>NEW LISTING</p>
        <p>JUST YOUR SIZEI Measured to fit growing families. This country ranch features 3 bedrooms, large master bedroom, 2 baths, foyer, formal dining room, den with door leading to screened porch and nice eat-in kitchen. This home has room for uncrowded living. $89,900. Listing Agent, Jerry Butts, 752-7073 or Mavis Butts Realty, 355-7653.</p>
        <p>OPEN HOUSE 2 Until 4, Sunday</p>
        <p>2502 EAST 4TH STREET - A Bridge Too Far? Crossing over to home ownership seems impossible? Not once you see this 3 bedroom home that comes complete with washer, dryer, refrigerator, dishwasher and stove. Check this one out today. $51.900. Your Hostess: Shiriey Morrison, 756-6343.</p>
        <p>NEW CONSTRUCTION</p>
        <p>WOOMUDGE - More than Just a pretty facel This new home under construction has personality. Features include 3 bedrooms, 2 baths, convenient floor plan. This construction is taking place in a new Wintenrille Subdivision. Check this one out today. 77,400.</p>
        <p>CLEVEWOOD</p>
        <p>NICE NEIGHBORHOOD In the Winterville school district. Warmth of the Holiday season enhanced in the beauty of this 2 story home that Is under constnjctlon on a beautiful wooded comer lot, Features include foyer, greatroom with fireplace, formal dining room, study and kitchen with breakfast nook and bay window. 3 bedrooms and 2Vt baths. Large dBCk. $98,900.</p>
        <p>sr.XiN roNsiu'R(, 1 STATI.S</p>
        <p>WEARY from laboring to find )uat the right family houaa? Rejoice over this new home, ready to occupy and only minutas from tha madical park. 3 bedrooms, master bedroom on first floor, 2 baths, large eat-in kitchen and greatroom with fireplace. Doors from great-room opening to nice deck. $69,900.</p>
        <p>OPEN HOiJSE 2 Until 4. Sundav</p>
        <p>211 MEADE STREET - This house is freshly painted inside and greets you with a bright new look. Living room with fireplace for those cool days ahead, study, country kitchen and 3 bedrooms. This house is in walking distance of East Carolina University. $49,900. Your Hostess, Arline Barnes, 830-0543.</p>
        <p>OPEN HOUSE 2 Until 4. Sunday</p>
        <p>406 SOUTH EASTERN STREET-Put a smile on your face with such agreeable terms on this good buy. Assume this F.H.A. Loan. Just Vz block from East Carolina University. Features include 3 bedrooms, 116 baths, dining room and living room with fireplace. Nice kitchen with stove and refrigerator. $67,500. Your Hostess, Elaine Troiano, 7506346.</p>
        <p>WESTMONT</p>
        <p>COUNTRY SUBDIVISION. A country home close to the hospital is the location for this new construction. This home has 3 bedrooms, 2 ceramic tile baths, greatroom with fireplace, dining room with bay window and deck that can be entered from french doors in master bedroom or dining room. F.H.A. and V.A. approved. Still time to choose your own colors. $64,900.</p>
        <p>NEW CONSTRUCTION</p>
        <p>COUNTRY SUBDIVISION  Smart design makes for smart and stylish living in this new home. This 3 bedroom has 2 baths, greatroom with fireplace, dining room, eat-ln kitchen with bay window. Enjoy the gentle breeze on the front porch or deck of this new home. All this on a wooded corner lot. $94,000.</p>
        <p>Elaine Troiano, Realtor, GRI</p>
        <p>ON CALL</p>
        <p>756-6346</p>
        <p>Arilae Banits, Realtor.........8304)543</p>
        <p>Shirley Morrison, Realtor......756-6343</p>
        <p>Navis Butts, Realtor, GRI, CRS.. 752-7073 Jerry Butts, Broker...........752-7073</p>
        <p>Geraldine AIII||ood,</p>
        <p>Offlce Manager</p>
        <p>fBWU MOUSiq BFFBBIIMtlV</p>
        <pb facs="00096780_0072" />
        <p>Q.28 The Dally Reflector, Greenville, N.C. Sunday, November 22,1987</p>
        <p>U1</p>
        <p>ApartiMnts</p>
        <p>iForl</p>
        <p>Rent</p>
        <p>KINGS ROW APARTMENTS</p>
        <p>On* and two bedroom unfur-nMwd apartnwnts. Fully equip-pad kitdwn, pool, 2 boskettall courts, basic cable TV. 24 hour emergency maintenance. On site management and on site laundry. Now leasing.</p>
        <p>Office hours 9  5:30, Monday -Friday. Located behind Western Steer and Hardee's on East 10th Street.</p>
        <p> 752-3519.</p>
        <p>LaNOMAR|(-I and' 2 bedroom furnished or unfurnished apartments. Heat, air and water furnished. Short term lease available. No pets. Call 7S8-37SI or7554)M9.</p>
        <p>OAKMONT SQUARE APARTMENTS</p>
        <p>Two bedroom townhouse</p>
        <p>apartments. Fully equipped kitchen, pool, community room,</p>
        <p>tennis courts, cable TV. 24 hour  emergency maintenance. Very convenient to Pitt Plaia and University. Now leasing.</p>
        <p>Office hours 9-5:30, Monday-FrMay, 1212 Redbanks Road. 756-4151</p>
        <p>r ONE AND TWO BEDROOM * * apartments for rent Imnsedlate- ly. 752-3311.</p>
        <p>ONE AND TWO bedroom apartments for rent. Smith Insurance and Realty, 752-2754.</p>
        <p>ONE BEDROOM, 201 N. Woodlawn. Heat, hot and cold water, sewer Included, 250. 75641545,7584M35.</p>
        <p>ONE BEDROOM. I both, near</p>
        <p>campus. Rumblw Realty 355- ------ nbl*y355-17.</p>
        <p>2042; Drew Rumbk</p>
        <p>ONE FURNIHEO 3 room apartment, 7564&amp;gt;l74or 752-7212. PETS OK11 bedroom $150 yard or *  -----</p>
        <p>7S2-?^5HM~Li</p>
        <p>sm 200 others. .OCATORSFee.</p>
        <p>RINOOLD TOWERS for rent, efflcloncas, 1 and 2 bedroom apartments, furnished. 752-2065.</p>
        <p>StOPt Cut* 1 bedroom house 150/2 bedroom 265 dishwasher 7S2-1375 HOMELOCATORS Fee.</p>
        <p>STRATFORD ARMS APARTMENTS</p>
        <p>Spacious 1,2 and 3 Bedroom</p>
        <p>200 SecurlW DepM Required CABLE TV,TENNllSURTS,POOL ConvenimtlDShMandECU</p>
        <p>Office hours 9aik. toSp. r Monday through Frioay</p>
        <p>Call us 24 hours a day at</p>
        <p>756-4800</p>
        <p>TWO BEDROOM apartment. 300. 02. M, 106 Willow Street. 75641545 or 75841635.</p>
        <p>TWO BEDROOM m baths, cem tral alr/heat, sun-deck, no pets. Available December 1. 310 month. Call after 6 p.m. 756-7609.</p>
        <p>TWO BEDROOM duplex on one acre lot at Frog Level.</p>
        <p>Call 756^ before</p>
        <p>) Level. 275-300.</p>
        <p> jefore 5 p.m. or</p>
        <p>75676afl*r5p.m.</p>
        <p>161</p>
        <p>Aj^rtments</p>
        <p>For Rent</p>
        <p>HSIN6FR</p>
        <p>THE PROFESSIONAL</p>
        <p>03 BROOKHILL. Shenandoah</p>
        <p>area oH of 264 bypass. Reduced rent for limited time onlyl 2</p>
        <p>bedroom, 1VS bath townhome. Whirlpool appliances, new outside paint, attic and outside storage, washer/dryer hook ups. Pool and tennis court access!</p>
        <p>BROOKHILL. Two bedroom townhomes available. 1VS baths, all energy efficient appliances, oulsid* storage. Pool and tennis court access.</p>
        <p>A9 BROOKHILL. Three</p>
        <p>bath townhome.</p>
        <p>Reduced rent now in effecti Energy efficient appliances.</p>
        <p>washer/dryer hook ups, and e. Outside storage. Pool</p>
        <p>fireplace.________</p>
        <p>and tennis court accessi months lease available.</p>
        <p>I2 E WILLIAMSBURG MANOR. Reduced rent now in effect! 2 bedroom, V/i bath townhome. All appliances, washer/dryer hook-ups, and plenty of storage. Professional neighborhood.</p>
        <p>TWIN OAKS 3 bedroom townhomes available. 2W baths, all appliances, outside storage, private patio. Close to schools and shopping. Pool.</p>
        <p>WILLOUGHBY PARK. Throe</p>
        <p>bedroom apartnwnt available NOWI Designer style flat with 2</p>
        <p>full baths, celling fan, gas .Water</p>
        <p>fireplace, balcony, and basic cable included. Pool and tennis court.</p>
        <p>31 ROLLINWOOO 3 bedroom</p>
        <p>clusterhome available now! Cathedral celling, ceiling fan, fireplace, all applian&amp;lt;s In-cludli......</p>
        <p>ding built In microwave oven.</p>
        <p>disposal, washer/dryer hook ups. All window treatments Included. Attic storage, six month</p>
        <p>lease available.</p>
        <p>srage.</p>
        <p>POOl</p>
        <p>1.</p>
        <p>ups. attk storage 6 month I</p>
        <p>and club house.</p>
        <p>F2S TWIN OAKS. SPECIALI Reduced Rent. 3 bedroom townhome, 2Vk baths, all appliances, outside storage, good neighborhood, near schools and shoM&amp;gt;lng. Pool.</p>
        <p>WILLOUGHBY PARK. 1 bedroom designer apartments. Available January, including all</p>
        <p>appliances, washer/dryer hook ^ fireplace, and celling fi.</p>
        <p>6-A GREENRIDGE. 2 bedroom towrrixius*, 2W baths, all appli</p>
        <p>outside storage. Pets. Avail December.</p>
        <p>REMCOEAST.INC</p>
        <p>(919) 758-6061</p>
        <p>Ask for JoAnn</p>
        <p>HOUSE FOR SALE</p>
        <p>Brick house located at 418 Pittman Drive, two blocks from Memorial Drive. Five rooms, includes family room, one working fireplace and a second chimney for a space heater. Central heating and air. 1,967 square feet including porch areas. 80 x 115 wooded lot, large backyard, double carport. Small amount of traffic, ideal for children.</p>
        <p>CALL MARY COX AT 756^306 OR WOOTEN LAW OFFICE AT 752-3129 FOR APPOINTMENTLOUISE MOSELEY REALTY INC.</p>
        <p>Office 746-2166 Open Saturdays 9 to Noon Sundays Call Louise Moseley 746-3472</p>
        <p>t</p>
        <p>73,500 - BACK ON THE MARKET. Don't let this exceptionally well built brick ranch slip through your fingers. The main features are a huge family room with wood stove insert, 3 bedrooms, IVi baths, living room, covered patio and a 18x28 workshop with water and electricity. 9Vi% APR VA assumable loan.</p>
        <p>77,500 - THE PRIES. Beautiful 1W story home on tree</p>
        <p>studded lot features a great room with fireplace, kitchen 3 bedrooms, 2 baths, screened porch.</p>
        <p>with dining area, There is room lfi</p>
        <p>the upper story for expansion. Owner financing avauane. A must see.</p>
        <p>72,000  COilpRY. Lovely 1 Vt story home on 2 acres with 3 bedrooms, J.'baths, living room, eat-in kitchen, wood deck. 32x37 detached building and much more.</p>
        <p>940,000 FOR 2000 SO. FT. of living space in this 3 bedroom</p>
        <p>older story home. It features foyer, living room, dining room, 2 baths and enclosed back porch. This is a bar-</p>
        <p>^9.000  MMACUUTE MUCK HOME features 3 bedrooms.</p>
        <p>2 baths, central air, carpet and garage. This lovely home is situated on a beautiful landscaped comer lot. Them is nothing to do to this lovely home. You will love It.</p>
        <p>40,500  GARDNERS WHJ. ENJOY this 3 bedroom Brick Home situated on a large lot that has a grape vineyard and fruit tiees. It also features 2 baths, central air, garage, utility building and nice landscaping. Its vacant and ready to move Into.</p>
        <p>&amp;lt;47,000  WM|pmi&amp;lt;OTON HEIGHTS. Attractive 3 bedroom. 114 bjWlck ranch with privacy fence conveniently located. FiliA loan assumption available to qualified</p>
        <p>^M  STARTER HOME AND 100% FmHA financing to qualified buyer. Check out this immaculate Brick 3 bedroom, 2 baths, home equipped with Central Air and features, wall to wall carpet, brick patio, garage. Situated on a comer lot.</p>
        <p>43,000  GIVE YOURSELF MORE ROOM AND COMPLETE THE second story of this cozy 2 bedroom 114 story home. Features large family room, living room, kitchen carport and storage.</p>
        <p>42.000  GETS YOU COUNTRY LIVING in this neat Bungalow located between Qrlton and Ayden. It features</p>
        <p>3 bedrooms, 114 baths, living room, kitchen with dining area and fenced backyard. See to believe.</p>
        <p>.000  WILL GET YOU A MCE BUNGALOW featuring 3 bedrooms, living room, aat-ln kitchen, carpet, utility room, atorage building and large corner lot. Owner will pay some closing costs. This home is vacant. It needs an occupant arid TLC.</p>
        <p>REDUCED TO 31,500  Investors this is a bargain. It features 1 and 2 bedroom apartments. There ia lots of space In this older home In downtown Ayden. Rent one side and live In the other. It's vacant.</p>
        <p>520,100  ROOMY OLDER HOME - ThIa 114 Story home situated on a deep lot has 4 bedrooms, living room, dining room, kitchen and a detached garage with stor^. 510.800  INVESTOR PROPERTY  2 Bedroom Bungalow with eat-ln kitchen and detached garage. Nice deep lot. Presently rented for 185 per month.</p>
        <p>10,000 - BUYS YOU A 2 ACRE COUNTRY RETREAT. It Includes 2 Horse Stalls and Tackroom. Greai lot for a Home or Trailer.</p>
        <p>00500 - BUYS A BEAUTIFUL 0/10 ACRE LOT located on SR 1725 between Helens crossroads and Coxvllla cross roads. Great tor a home or trailer.</p>
        <p>$14,000 to 10,000 - "THE PINES" BEAUTIFUL WOODED LOTS  Choose yours today In this Exclusive-Growing Subdivision. City water, sewer, curb and guitar. Call for details.</p>
        <p>Debra Whnley EJilly WilbOd William (Bill) Harris</p>
        <p>anees, wesiwr/dryer hook ups,        table</p>
        <p>WEST HILLS 2 bedroom flat. Available December. 21S battis, *11 appliances, washer/dryer hook ups, outside storage with patio, convenient to h^ltal. Quiet area.</p>
        <p>746-606C</p>
        <p>758-4476</p>
        <p>746-6634</p>
        <p>161</p>
        <p>AMrtments Fori</p>
        <p>Rent</p>
        <p>mxmxm</p>
        <p>APARTMENTS CLOSE TO CAMPUS 2and3bedroomtownhouses, 114 battis, fully carpeted, central heat and air, washar/dryer hook-ups, dishwasher, stove, refrlgwtor. Draperies Included. Pool, sauna, tennis court, NO PETS. Call 7K-0277.</p>
        <p>WOOD'S EDGE</p>
        <p>Brand new spacious two bedroom duplexes located In a</p>
        <p>quiet residential community in Heritage Village featurlno; Greetroom with cathedral cell</p>
        <p>ing, fireplace, fully equipped kitchen, washer and dryer connections, energy efficient, outside storage room, private encloiedpatloa.</p>
        <p>756-4151</p>
        <p>WOODSIOE. On* bedroom apartment avellabi* December 1. All appliances, water end sewer Included. Quiet area tor the protetslonal or grad studont. Contact Romeo East, Inc. for details, 7SS-6961.</p>
        <p>1 EottoM AAAktMtht at Grean Villa Apartmants-220</p>
        <p>per month^ University Cpndos-2</p>
        <p>MtfrOOIDy</p>
        <p>114 bath townhouse -300 per month. ENIclency apartment on Dickinson Avenue-9210 per month. All require leas* and security depoelt. 2 BEDROOM, TV4 bath townhouse duplex at Groan Ridgo. 325 per month. edroomRaalty, Inc. 756-2675.</p>
        <p>2 BEDROOM, 114 bath townhouse at Village East. 310 per month.</p>
        <p>Duffus Realty, Inc. 796-2675.</p>
        <p>TWO BEDROOiM, Wintervllle, air, water furnished. 260.</p>
        <p>ONE BEDROONL Upstairs, shared bath, Evans Street. 175. TWO BEDROOM, Air, carpet. Colonial Village. 250.</p>
        <p>J.L. Harris and Sons. Inc. Realtors, 200 W. lOlh Street. 75G4711.</p>
        <p> QUAIL RIDGE. 3 bedroom luxury townhome, 214 baths, fireplace, all appliances, gar-</p>
        <p>ba&amp;lt;M disposal, washer/dner hook ups, at/'  many extras, avaiwbta. Pool, tonnis courts.</p>
        <p>161 AMrtimiils Frl</p>
        <p>Rut</p>
        <p>wedgewdodaIimS</p>
        <p>I, tVSbalhtewnhousas.</p>
        <p>Excslltnt loCflton. Carrtor ol kite</p>
        <p>_ jr-dryar tonrriscmirt. 3554302.</p>
        <p>pumps, WhirlpMl kitchen,  hoekups, pool.</p>
        <p>washar-&amp;lt;</p>
        <p>161</p>
        <p>iHi. central location. Im-madtctoly. 7574111.</p>
        <p>ong%atu[alion</p>
        <p>lUta</p>
        <p>Quinn</p>
        <p>Top Producer For The Month Of Octoberl</p>
        <p>BASS REALTY</p>
        <p>2424 S. Charles Street 756-6666</p>
        <p>ui</p>
        <p>am</p>
        <p>... ^  STfc.'SSIS!;</p>
        <p>pnMtASIOS. 755-7410.</p>
        <p>UHlVIWTTVli^rOnlmg</p>
        <p>a rlaannl aaMla</p>
        <p>UI1V oeonMPnf eDwrvff^ni wiifi</p>
        <p>QKtii d VMpr wnvi no imomiip nopals. Call 7I3S5.</p>
        <p>161</p>
        <p>rtmtnts</p>
        <p>RMt</p>
        <p>7100.</p>
        <p>1 AIORM apartment.</p>
        <p>cirpetod, kitchen appllanots,</p>
        <p>csntral haat/ air, 2lo7nB491s.</p>
        <p>This'2,200 square feet home features in-ground pool, bath house, formal dining room, 3 bedrooms, 2Vi baths, den, living room, PLUS much, much more on 2 acres of land. Possible owner financing available. Contact Bill Fell for more info on this $90,900 home. 244-2913 or 355-2042.</p>
        <p>RUMBLEY</p>
        <p>RiALTY</p>
        <p>355-2042</p>
        <p>161</p>
        <p>ApM^ents</p>
        <p>SSSLwew-</p>
        <p>apTmwt^</p>
        <p>.757-1445.</p>
        <p>UNPWIIMIBAFAiyMiHT</p>
        <p>far rent. l bedroom,^ stove,</p>
        <p>refrtairalor. Ilk* new. Call cd-leetiMW-SJ</p>
        <p>l-sm after 4p.m.</p>
        <p>RIVER BLUFF</p>
        <p>2 bedroom townhouses 1 bedroom garden apts.</p>
        <p>758-4015</p>
        <p>NEW CONSTRUCTION -1,800 square feet, 4 bedrooms, 2Vz baths, large wooded lot. Only $78,900.</p>
        <p>QUINN REALTY</p>
        <p>3106 South Memorial Drive 355-6258</p>
        <p>Beautiful New Homes</p>
        <p> 3 Bedrooms  FHAA^A</p>
        <p> 10 Year Homeowners Warranty</p>
        <p>AS LOW AS</p>
        <p>*485</p>
        <p>*</p>
        <p>PER MONTH</p>
        <p>Principal and InterestWESTMINSTER HOMES</p>
        <p>,-\ \V-vfrhii**iisi*r Comp.tiiy</p>
        <p>(i)DUFFUS REALTY, INC. 756-5395</p>
        <p>Typical financing example: Sales price $57.950. Downpayment $2.400. Mortgage Insurance Premium $2.111. First 12 monthly payments $485 per month plus taxes &amp;amp; insurance. Remaining 348 payments vary from $527 to $706 plus taxes &amp;amp; insurance. Annual Percentage Rate 10.61%.</p>
        <p>OPEN HOUSES 2:0(M:00 PM</p>
        <p>3102 Gordon Drive</p>
        <p>Ellsworth</p>
        <p>Suite 3A Parliament Piace 300 E. Ariington Blvd. 355-3613 ANYTIME!</p>
        <p>This tri-level totally unique contemporary is now available. Almost 1900 square feet with 4 bedrooms, 3 baths, 2 fireplaces, huge deck,</p>
        <p>screened porch, oak floors, garage aiTd muchi much more, all on a heavily wooded lo</p>
        <p>Hostess: Linda Gaddis</p>
        <p>r lot. Low Ms.</p>
        <p>Westhaven</p>
        <p>m.1  -</p>
        <p>t</p>
        <p>A wraparound front porch accents this traditional home on Kempton Drive. Excellent floor plan with an unfinished third floor for future expansion. 4 bedrooms, 2V4 baths, large kitchen and breakfast area with cabinets galore, greatroom and formal dining room, plus at.....</p>
        <p>lusadecjJ1420G</p>
        <p>Isdale</p>
        <p>Great atarter home In quiet, established</p>
        <p>VII09I  wiiw M  wvtmwu</p>
        <p>neighborhood, close to shopping. Two bedrooms, 1 bath, living room, sunroom, kitchen with separate eating area, datachad</p>
        <p>r\IIVMvl vssit  wwtweww</p>
        <p>carport plus a spacious yard. 1V4-year old Rudd haat pump and storm windows. All this for Just $39.600. Call Ann Summarlln.</p>
        <p>Come and aaa the apaclal features of this new home In Bedford. Four bedrooms, 3 baths, formal areas, racreation room, custom kitchen with Jennalre range id Corlan</p>
        <p>countertops, double garage, comer lot. Great price for this veal</p>
        <p>Quail Ridge</p>
        <p>This thraa^Mdroom townhouse Is s MUST 8EEI 2V4 baths, dimng room, laundry room,</p>
        <p> ___ Imng  .  .</p>
        <p>greatroomfflraplaca and grastcloth wall, apaclal trim, deck and storage room LIndi----</p>
        <p>.IndaQaddie.</p>
        <p>Tucker Estates Mlnuette Place</p>
        <p>Everything you re looking for describes this home In Tucker Estates. Country-slze kitchen and breakfast room, dining room, spacious greatroom, downstairs master bedroom. 2 or 3 bedrooms upstairs, deck, outside storage, fenced backyard. Many extrasi $124.999. Hostess: Chris Flower</p>
        <p>Woodridge</p>
        <p>Now complete and welting fbr you! Featuring downstairs bedroom, 2 large bedrooms</p>
        <p>upstVrs with specious wk-ln closets, bonus room great for office or nursery, greatroom, kitchen/breakfast room, formV dining room with hardwood floors, deck, I on an extra torga lot. Cioaa to mall in Wlntarvllle School District. CVI Jamas Gibson.</p>
        <p>Lexington Square</p>
        <p>Located nev the downtown Business district, this 2 bedroom, 1V4 bath chsrmer can be yours for less than you think. Unit comes equipped with celling fans, levolor blinds, glass shelves, refrigerator and haa |uat been pVntad Inside. Priced In the 40a. CVI Jamee Qlbaon.</p>
        <p>Tucker Estates</p>
        <p>Williamsburg charm throughout this lovely 3 bedrooms with an addl-</p>
        <p>home featurtnc tional room oh the MBR IdeV for study or nursery. Greatroom, dining room, 2V4 baths and a garage. Large beautifully landscaped comer lot. You'll be Impressed with thie ^lOTMandthe^rlce^a^</p>
        <p>Colindale Court</p>
        <p>Almost 1300 square faat In this Ilka new bay window unit at Colindis Court. Two</p>
        <p>bedrooms, 114 baths, VI appliances, chVrrVI In kitchen and living room. VERY ATTRACTIVE. CVI Linda Qvtdls.</p>
        <p>On</p>
        <p>Call</p>
        <p>This</p>
        <p>Weekend</p>
        <p>James Qlbson 355-2058</p>
        <p>Linda Gaddis 756-3291</p>
        <p> Y</p>
        <p>Ann Summerlin 355-7057</p>
        <p>Chris Flower 752-9696</p>
        <p>i=i</p>
        <p>i</p>
        <p>r  .X,  ..v-t-V, 4,</p>
        <p>L</p>
        <pb facs="00096780_0073" />
        <p>U1</p>
        <p>AMrtments</p>
        <p>Hnt</p>
        <p>Condo(-2</p>
        <p>Viita  month. Univorall</p>
        <p>srs'si^Wc,</p>
        <p>porfmont on Dickinson . Avmut-t210 por month. All ro-: oulroloosoondiocurltydMoslt. rBEDROOM, iVi bath townhouso dupltx at Groen RMm. 1325 por month.</p>
        <p>2 BEDROOM, tW bath t at Vlllapt East. $310</p>
        <p>pormontn</p>
        <p>r BEDROOM, I bath at Cheyonne Court, $275 per month. . 1 BEDROOM, I bath at Choyonho Court, $235 per month. ^ Duffus Realty, Inc. 755-2075. -, 1 BEDROOM furnished or~wr ' furnished apartment near Unl-^ vanity. Short term lease available. }io pets. Call 75a-37Sl or</p>
        <p> ieTFiriiifrrBaroSs</p>
        <p>apartment, $215. Call 751-0491 or ^7M9. '</p>
        <p>. rif69R SiFt merits for - rent. $270 and $m Call 75S-I277</p>
        <p> behmonOAS.</p>
        <p>ilTDDEKTlOTir</p>
        <p>:CAPTAINS QUARTERS. , Reduced rent now In effect! , SlMClous I bedroom apartments</p>
        <p>&amp;gt; near ECU. Dishwasher, stove  and refrigerator. Water and</p>
        <p> sewer Included, washer hook up.</p>
        <p>r LANOSTON PARK. SPECIAL! I First month's rent free. 2</p>
        <p>&amp;gt; bedroom apartment. New f carpet, all appliances, water, ' sewer, and basic cable cable In-' eluded.</p>
        <p>I PIRATES LANDING. Tired of ; sharing a room In the dorm?</p>
        <p>&amp;gt; Come see our private furnished i rooms. Utilities Included. Share</p>
        <p>bathroom and kitchen area. Laundry on site. We offer rea-2 sonable rates and semester S eases. Close to ECU!</p>
        <p> RtOENCY HOUSE. Corner of SHi Id Reads. 2 bedroom, Ik spacious apartments. Laundry i SSlllos on site. Hot water and i sowar Included. Walk across 9 street to campus. SPECIAL:  FIRST MONTif S RENT HALF g PRICE!</p>
        <p>*: CEDAR COURT 2 bedroom townhouses, 1V5 baths. All ap-pllancos, washer/dryer hookups. Private patio, pen.</p>
        <p>REMCO EAST, INC. (919) 758-6061</p>
        <p>Ask for Patti</p>
        <p>170</p>
        <p>Qmdominiunis</p>
        <p>Fur Bant</p>
        <p>msnrmmn</p>
        <p>bedrooms, 2 baths, firaplace, microwave, washer/dryer, pool SeneWo*^ PrtvUegos.</p>
        <p>3 EOkOM, 2Mi bath, canvH covered patio, all mllances. -  "indy  Ridge,</p>
        <p>Pets allowed. Wli a month. 355-3124.</p>
        <p>,$500</p>
        <p>173</p>
        <p>Housgs For Rent ABii5??r Tbedrooin</p>
        <p>place $375, 3 bedroom $450 752-1375HOMELOCATORS </p>
        <p>Fee.</p>
        <p>AVAILABLE IMMEDIATELY Baytree; 3 bedroom, 2 bath brick home. Large family room with fireplace. Carport, storage building, all extras. Lease re-ires no pets. $550 a month;</p>
        <p>AVAILABL DECEMBER t, 3 bedroom house, garage, wooded lot. No pets. New carpet and paint. $455 month. Cali Brian Jones/Broker 750^555 or 750-1775.</p>
        <p>klCK, 3 bedrooms, 2 baihs, dining room, fireplace, room, heat pump, lully carpeted, cloaod garage, no Carolina East ^11. $500 a month. Occupancy Immediately. Call 745-41 after 5p.m.</p>
        <p>CbNVCNlCNf LOCAtiON  Hillsdale; 2badroom home, with ^nances. Call 745-3532 or 247</p>
        <p>COUNTRY SQUIRE, 2 bedroom, 1 bath brick ranch, $375. Call 945-3320 or 752-3290.</p>
        <p>^RNliHfD 3 bedRoom house, 17th fairway. Brook Valley. Central air, 5 or 12 months, 755-2027 nights. HANDYMAN ^lals! 2 bed room $125/3 bedroom $190 pet 752-1375 HOME LOCATORS Fee.</p>
        <p>HUE FOR rent 2300 plus square feet, 3/4 bedrooms, short</p>
        <p>term lease, near ECU. $525. Call 35S5150 after 5 p.m.</p>
        <p>URGE 5 ROOM 2 story IVti bath house, 109 Columbia Avenue. Call Allen, Monday-Friday. 8-5 758-3191.</p>
        <p>RURAL 2 EDROOM, 1 bath clean brick ranch, 114 acres, carport, central heat and air, west of Greenville. Lease, deposit, reterences. 1-823-5055.</p>
        <p>MALL 2 STORY, for rent on East 5th St. Excellent neighborhood. Call Carl at Darden Realty 758-1983 nights and weekends 355-5558.</p>
        <p>STUDENTSI3 bedroom mbath $300 or 4 bedroom 2 baths $450 752-1375 HQMELOCATORS Fee.</p>
        <p>173 Housgs For Rtiit</p>
        <p>bricfc home, Wfietef^ &amp;lt;Mi-washer, heat pump, w%and dryer hook uMamlIyotonled qiAM heighborhoML Comwilent</p>
        <p>as.""*?'</p>
        <p>fHRt AtkoOM, 114 bath brick, central heat, air, washer dry hook-up, large yard, quiet area, $450 plus deposit. 752 1824 after 5:38.757-5051, work.</p>
        <p>tNkit *ibR65M NousE,</p>
        <p>m bath, 18325 per month. Call 757-1455.</p>
        <p>THREE BEDROOM, one bath In Conetoe. Workshop. Available Immediately. Call University Realty 355-5855 or W. Bradley Gray 752-3599.1272.</p>
        <p>TWO BEDROOM two bath flat with toft, with over 1300 square feet. Immaculate, fireplace, private paflo. Located off 254 Bypau In Rolllnwood. Available Immediately. $525 per month. Lease term negotiable. Call Clark Branch Realtors, 355-2000. IWO-ilDfcM, newly decorated, large yd, Pennsylvania Ave., $250/ J, L. Harris and Sons, Inc. Realtors, 200 W. 10th Street. 758-4711._</p>
        <p>TWO BEDROOMS, living room, kitchen and bath, large back yard. Reasonable rent, 255 W. Main Street, WInterville. Call 745-2011.</p>
        <p>2 BEDROOM HOUSE Near ECU campus. Call 441-3890 after 7p.m.</p>
        <p>2 BEDROOM CONOO 1,050</p>
        <p>square feet, all appliances, fireplace, storage. $385 a n Call328-7434ask for West.</p>
        <p>I month.</p>
        <p>3 BEDROOM House 2511 Memorial Drive. Quiet neighborhood, no pets please. Call 755-9841.</p>
        <p>3 BEDROOMS, 1 bath, fully carpeted, large living room, good location and a large yard. $350 and one year lease. 755-5155. 3 BEOROOMI Family area $350 or 3 bedroom $425, others too. 752-1375 HQMELOCATORS Fee. $480 a MONTH, 3 bedroom, 2 bath, garage, deck, refrigerator, range, dishwasher, hea^unsp, Ayden. Call after 5,</p>
        <p>174</p>
        <p>TownhousGS For RghI</p>
        <p>Brookhlll, 3 bedrooms, 2'/^ baths, 1400 square feet, stove, refrlgator, dishwasher, pool and tennis court. $500 per month. 1 yebrs lease and deposit required. Call Clark Branch Realtors at 355-2000.</p>
        <p>174 Towfiliouses For Rent</p>
        <p>174 TowntMNises For Rent</p>
        <p>ildOkWiLt: Lovely 3 bwfroom, 2% hath townhoma. Fireplaca. Accaas to pool and tonnU cou^. $500 ptr montti.</p>
        <p>Duffus Realty, Inc. 755-SS'^</p>
        <p>M bedI^s m m</p>
        <p>tdwnhousa, Pot aM MWrgj^</p>
        <p>Two BBpnoiki, m baih</p>
        <p>fownhoust. Rumblay Realty 355-2042; Draw Rumbtev 3 7217.</p>
        <p>^REE DECEMBER RENTI Two bedroom townhouse, Williamsburg AAanor. $335 par month. 755-5&amp;amp;1.</p>
        <p>2 BE0R008 IVi bafh-ap-pllancdt, diahwaibar, microwava, many extras. Qutef ar, Idaal for proteaaional. $155.755-7480.</p>
        <p>LfxINGtON SQAIE. and unit, privacy, two badrooma, IV4 battia, air. This Is newly dsca-rated. comfortable and cozy tor long winter nigbte. Naeds |uat. the right occupant. Call us for a look.</p>
        <p>WILDWOOD VILLA, College  area, 2 badrooms, m baths, air, $350.</p>
        <p>J.L. Harris and Sons, Inc. Realtors, 200 W. 10th Sfroof. 75a-4711.</p>
        <p>179 Mobile Homes For Rent</p>
        <p>$175 or 3 badroom $225 kids, pete 752-1375 HOMELOCATORS Fn. OOULE WIDE, 3 badrooms, 2 baths, partially furnlshad, maximum 2 children, montti to montti,$275.</p>
        <p>SINDLE WIDE, 2 badrooms, partially furnlshad, maximum 2 chlldran. month to montti, $175. J.L. Harris and Sons, Inc. Real-ten 2M W. lONi Strwet, 7SS-47II.</p>
        <p>TWIN OAKS 3 badrooma, 2VS baths, firaidaoa, 1450 square feet. AvaMabla Immediately. Also, 2 bo(bwoms,1V2 baths. Col-llcd Moon B Associates, 751-5050. *</p>
        <p>2 BD6M, W ifH. Off Hookar Rodd, new paint id carpet, $350 par monfh plus da-poalt. Call ^1971 days, 779-1972 avaninea.</p>
        <p>2 BEDROONL 2 bath flat at BranckanrldM, 1100 square feet. No pete. $395 p' month; lease requlrad. Call 755-9070.</p>
        <p>tel BEDNM, central heat, window air, water furnlshad, couple or singles only, no pete. Leaae/deposlf. $150. Call 1^ 4241.</p>
        <p>1 AND a bedroom AAoblle homes, $130 and up. Also AAoblle home tot for rant. No pets and no children. 7584745.</p>
        <p>CAPE COD By 0</p>
        <p>Court, Belvedere pointments. $82,50</p>
        <p>wner, 108 Darwin . Shown by ap-10. Call 756-9840.</p>
        <p>DOCTORS PARK APARTMENTS</p>
        <p>Energy Efficient</p>
        <p>Prafessiomilv Managed By</p>
        <p>remco east, inc.</p>
        <p>''AcaL ee&amp;gt;!4Te MANAewihivt</p>
        <p>BEASLEY DRIVE ADJACENT TO HOSPITAL</p>
        <p>ONE, TWO.A THREE BEDROOM APARTMENTS</p>
        <p>POOL A CLUBHOUSE</p>
        <p>THEBESrJUSTKEEPS GErriNGBETTER!</p>
        <p>Come See The New Two Bedroom, Two Bath Garden Apartments At</p>
        <p>COUnNEY $8IMK</p>
        <p>Office Open 9-5 Weekdays</p>
        <p>9-5 Saturday  1*5 Sunday</p>
        <p>'Merry Lane Off Arlington Blvd.</p>
        <p>756-5067</p>
        <p>D.G. NICHOLS AGENCY, INC.</p>
        <p>HOME AND MULTI-PURPOSE BUILDING-GARAOE FOR SALE. Located between Hudson's X Roads and Blackjack. Immaculate modular home permanently attached with greatroom with fireplace, dining room, three bedrooms, kitchen, two full baths. In addition theres an 1,800 aquere foot building with additional storage specs ideal for a garage, body shop or business. All situated on a well landscaped 1.5 acre lot backing up to a amall pond. Priced at 995,000.</p>
        <p>123 West Fourth Street Greenville, N.C. 752-4012</p>
        <p>SMAUOPPMI</p>
        <p>m</p>
        <p>sums PFALOR</p>
        <p>At Red Banks &amp;amp; South Charles. THE CHARLES CENTRE. Beginning at $408 per month. Call Carl at Darden Realty 758-1983 nights and weekends 355-6558.</p>
        <p>17f</p>
        <p>MoMIg Homes For Rent</p>
        <p> Park, na palp. Call</p>
        <p>3884ar 755-mo.  &amp;gt;</p>
        <p>ip iEDROdNi, coMral air. mtn, prater couplat. Located at Black Jack. Call 75a-88l5.</p>
        <p>2'6iRi6mATH.ate:in $190 par month. Call</p>
        <p>The OWty Ref tactor. Qrenvtlle.N.C.  Sunday. NOYGmber22.1987  029</p>
        <p>17f</p>
        <p>Mobile Hemea For Rent</p>
        <p>&amp;amp;is</p>
        <p>w gtwnmwne</p>
        <p>badroam wHh appll-M.Marrtod^</p>
        <p>tm immih. 7</p>
        <p>  ..tmparmoRlh.7-</p>
        <p>3e03or7S^714e</p>
        <p>EnjoyT\voBedrooiv\s R)rThe Price Of One!</p>
        <p>2899 E. 5th St. .</p>
        <p>INVERSIIY</p>
        <p>APJUnMENTS</p>
        <p>MODEL OPEN-MON.-FRI. 1-6, SAT. 96 NOV. RENT FREE"-CALL 756-7815</p>
        <p>J.T. or TOMMY WILLim | LIMITED OFFER $275.00</p>
        <p>ALL NEW 24 READY TO RENT</p>
        <p>17</p>
        <p>Mobile Homes Foriteitf "</p>
        <p>mnnm.</p>
        <p>2 IBI6M1 U fawn</p>
        <p>752-1375</p>
        <p>n a bath HOMELO</p>
        <p>LOCATORSFaa</p>
        <p>1M Moble LelsFdr</p>
        <p>Ngmet IliM </p>
        <p>fim- S Mr manlfi. QiM CMMfy iocotnmi. vonfiCT Kin 7-3)apr75B9l23.</p>
        <p>HKMUSMMU NOME SUB, MC.</p>
        <p>ACROSS FROM AIRPORT - 7S2-6068</p>
        <p>Double WIdes Start at $17,995 44 a 80 $15,995  Lota of Extras All Homes Close to Cost</p>
        <p>ALL HOMES ON SALE:</p>
        <p>.  1988  MODELS</p>
        <p>GRIFTON</p>
        <p>m GRIFrmf, TMs beautlfm 2 story home located 2 blocfcs from Indian Trails Country auh, 4 bedroom, 3Mt baths, Hvmg room, dining room, large dan with fireplaca, larM kitchan, brick floor, built-in mterowave, dtehwaslw, range, gwage. Two haal pumps, comer lot, 2642 square feM. 1103.900. Call Qeorge Saieaby Insurance &amp;amp; Realty, 5244191, nightsS24-40eS.</p>
        <p>cotoujeu.</p>
        <p>BANKeRQ</p>
        <p>W.G. BLOUNT &amp;amp;</p>
        <p>I ASSOC. REALTORS</p>
        <p>!ar,r-rrTjar.T,TTL</p>
        <p>Eimect th^Expect The Best</p>
        <p>7/rien ,.jLi epect tnp be ^ m  in 'ewa'"- car. r,e qratify'</p>
        <p>!!iq Ihe .,:nner o*  iv?  oven .i* inr- recent Open</p>
        <p>Hou-je It ClPvewood /,ere C -n v and Joe Ton-^'ewicz Cathy anc Joe have donated the:'- V . o.vave Oven n. tne .-&amp;gt;t Gabriel s Catholic Church for thpi- .r,e The .p..d ol Tham-vqivmq lives. From our tafn'n,- at Cnld.vc-v B.-rnn*- ,v u B:Our;t &amp;amp; Assoc Real</p>
        <p>tors to yoursBEST WISHES FOR THE HOLIDA VS</p>
        <p>Open Houses 2-4pm</p>
        <p>OPEN HOUSE</p>
        <p>OPEN HOUSE</p>
        <p>1 cannot describe I ttiis new bome in Oraylelflb. The 25 s 16 Kitchen Mums  r island, exquisite ceblneliy. 6 ft ceiling mowing A spacious bay aaUng aiaa. Maalar badroom suit* Inciudas gardan tub and aliowai, dining aiM and loada ot ctoaatt. Hardwood Hoois throughout downalaira, 2 luH ataMcaaaa, ftniahad 3id lloor TUta Graanville Blvd to QranavUle Dr in LyimWa, taka thort tali on Martinsboro. taha Quaan snnta to Quponl arcia. Taka itgM look lor signs on Ml. VourHostasa Baity Ba 4150  _</p>
        <p>IpaiOataiumpaMadoltliamtikait Juat Iittada3badmm8il Bath honw on a woodad M. FimUy laom wWi flnsptaca. lonMl dMng roMi dtch and many axlraa. Taka Evana 8L Eat. 1W mMta past Sunahina Sardana, Ctavawpod on Ian. took tor aigna. Hoar Bob Ratoa PMB</p>
        <p>Eiww SL Ext IP *4171</p>
        <p>OTtdaratndttiMl</p>
        <p>toMiadwad.a Fimlower IWl</p>
        <p>aatnmtenwMw wiwrp wMaia</p>
        <p>MPtawwwra telMLTa</p>
        <p>Id wrwrv mm a it aaatd w . tmw</p>
        <p>MdlwaltN. LPdk ter ant. Near W</p>
        <p>OPEN HOUSE</p>
        <p>OPEN HOUSE</p>
        <p>rm</p>
        <p>OPEN HOUSE</p>
        <p>24 pni What do you want In a new home? double gamgeT larga pmtia tot? A fourth bedroom ? Tiled batha? Giant rooma? Oraat nalghboihoad? TMt naw homa has it sll&amp;lt; And bast ot all thia neix homa la flnlahad-ratdy to I movt in Its quality craltsmanship lor lha taking lO'a Brinany Ridga. Taka I Hwy. 33 Etat to Pinawood Cemetery. Turn righl. croea railroad irackt, turn taltal Fast Fart About tmlla on toh Your Host Oraydon Tripp tt 33</p>
        <p>M p.m. - SHERATON WUAGE  Convantencp whI afloKtebte prices. OuNity construction by Vsn Rack, Inc. Convantent to-cion on Landmark Straet bahind lha Sharteon Inn wHh bulkter paying up lo $1,200 in dosing axpanaos and up to 3 discount points makas this your bast buy in Qraanvilte CN today or visit our modai unit open avsry Sunday. 24 P.M. 10S Host: Don Joyiwf.</p>
        <p>Attractive naw listing in popuW Winttrvillt araa caplivatss you trom atir. Unique leatures make this, the home ol your dreams 3 Badroom. Ito baths, deck and laticad in spacKiua back yard awaits your viewing. Call Kenny Fisher lor your prvale ahowing 9tO,SaOt97</p>
        <p>MULTI-FAMH.V</p>
        <p>I CONVIMBNCC. convemance. oonvenienca-ThIa 2 badroom townhouse is lha I answer lo any couples tiatda. IVt baths tnd beaulllully dscoralad Lola ol I axlraa ItW Upton Court in Kanatngton Park Llaling AgarM, David Itogaif fits</p>
        <p>A DtAil A OCALl A OfALi Youva wanted and now you can nava It undoubtadly the beat buy In Rollinwood Wt have a 3 bedroom. 2 baih unit axcaplionally Met and prtoad to tail, tht ownar-invtalor it ready to tall to call ua now and cath In on tbe deal you've baan looking tor give  BMIWoodardarlngatTSeJOOOnowbelorallgalSkway 4181 I DUPUX  Either one or both good loan atiumplion. Good caah How CaH lor I prvala allowing. Stan Chariy7Saotes 8186 (Ma iltganet dtscnbat this luxury 2 badrooma. 2 bath lownhoma loealad In Cypreaa Crtak. other taaluma of this cualom detigned homa Include eantral vacuum systein. matonary tirtpiaca. with rock prolila cathardral ctiF ing and larga patio Owner win sail or coneldat rant with opUon to buy Con-IIEI ut today lor your personal ahowinq 8199 SINGLE FAMILY</p>
        <p>I UHMIMITY ama  II you like oWer hornea and havaoT saan Ihra one you don't know what your're missing Lola ol peopla aay they juti don't make them Hka they uiad to . and ihia home provea that polnl You muti sat to I appreclata CaH Bill Woodard. 81 it</p>
        <p>I 884.800 Otaanwood Fortai Say Goodbye lo rent. You'H tovp this 3 bedroom cedar ranch on a woo&amp;lt;)ad tot bining room, kitchen tnd family room Estrt Mgt parking area, good lor baakatbaH lor the kida. Call now so you don t miss miaono Stan Cherry 8119</p>
        <p>QUKT NfMNBOMIOOO  Greet Start foi lito young lamily, Neal conlairv porary tiylid 3 bedroom, 2 bath ranch Featuring pretty yard with deck and avtn a garage Lots ol houst for an allordabit prica A must see lot lha budget conkclous horn# buyer 881080 CeH Bob Rams #I35 aSLUR WH.L TAKt s tost on lIHs naw 3 badroom. 3 bath heme sHtn doubia garua Cm you btal that ollar? Hkk no ThIa houta it toeoly and tllualad in eonvemenl neighborhood A .essonatoto offer will lake It LltUng Agent Batty Ray 8144</p>
        <p>OUTSTANOMO HOME IN WtATHWaTON HtlQHTt  A hento liM hat bttn tovtd and csrad lor LocMad in lha popular wmtemilto School dtstrtci this } bedroom. IK beih Brick Vanear la truly an outstanding showpiace CaH to day tor your ahowing Bill Woodard 8139</p>
        <p>COUNTRy UVMO AT 118 nMITt On# ol lha beat boyt aroundl See Hus 3 bedroom mnch with over 1,400 aquara teat Ht on a large tot full minutet trom OiaenviHe It's priced "ghi to boot CaU now lor your showing Bm Woodard 8142</p>
        <p>PURCNAaaPOWlN AND WNAT A H08MI TWO Story 3 badroom. 3Vk btlht. hardwood Itoor m kitchen, chnmg room and tovtt Family room wHh hioplaaa Call Stan Charry #188</p>
        <p>im WARMTH of a crackling tire lilla lha open beamed greatroom ol Ihia unique while cadet huma It s t .750 squats laal ol pure chami and IHS on the privacy ol a deep wuoded lot The sunny eat In kHchan la partoct tor tar ly morning collee Whan you tea M, you'H laal like you'va coma home Listing Agent BeityRay 81*1</p>
        <p>Congratulations</p>
        <p>Betsy Roy</p>
        <p>Top PiYMlucor Top Solllaig Aflont Top Listing Agont</p>
        <p>M pm Ooni RfM K Gkm In to Mto osMwftMmme umt to aWl on Hiia M. Thia nema la p8rlMilptBib$iai ama Hnw8bMac H Mtora 3 Ssdmame.</p>
        <p>lasgtl</p>
        <p> aM aw MaM hot Mb to Hto Saca dtcfc.</p>
        <p>DwxxaMd tMM ntob. Rb pdaaa lb taR TMw GrbtrwHto BkW. turn o t4Bi 31 took lorOHkMM Maaa. Yasraail Ai JayMrBWI</p>
        <p>NEWU8HNQ</p>
        <p>owiamHyW</p>
        <p>ffilM FibmnwaaMdaafeHMasatsrytwHcaaaidHwcoffltrwMrlpqotiuaia Hw Wkl master baUi Fkm badWoma. 2W bMlia. bonus room, toundry rdaai. two dwwa naaa, MO Nraptcaa. CaH Stan tdday but sNow iima In cata wa IMtotllihRitoonatfteB</p>
        <p>Ml eiounl, QRVCRS</p>
        <p>Qaoras Sulphan, OfU 7SB-3372</p>
        <p>Wl'Vf PLANTIO TNt SMOI Now you can reap lha twrvaat Naw Oonalnie-lion m Clavawood. tnraa Oadraom. at* btina, many axlraa wid prtoad In Hw tSOs CNI Stan Charry 8181</p>
        <p>Ntw LISTHW in popular WaiTIRVILLa AMA. TMt homp taaluwa 9</p>
        <p>bedroonw. piut larga woikthop ot 2 car daiacnad garage. CsH Kanny Piahai formoradatalls Ptre</p>
        <p>NSM IS THE ORIAT PLACE lor your IMMW ownership 10 begin Wt haw a really atiiaciwo bttofc ranch wiHi 3 badioamt and 2 tuH oafiw H'a on a nica Ua tot and hat a baaullhil yard Located on a qutat siraat batsraan Ivra aw lor thoroughtaraa. thia homa Is raatly convantonl to rnuch ot QmanvMto'a ihopping and anlartalninanl CaH BiH Woodard today and aaa now you otn begin your homo ownership at an allordabto prtoa now. 8M$</p>
        <p>ON TM aOLP COURM. IMS Biook Vaiwy Noma oNart 3 Utga bacmwaw and 3 batha. piut ofttoa, 2 car garage naaamani, ptivaw covarad batk patch and hntnacuiaia manicutad lawn H'a a good HnaalmaM to a piosan naiqbbor-head Tha lima it right to batolar lha hoUdayt. CaH aaHyRak 8172. AMUMAaLE S EW PNA LOAM Avoid aH HMwa apanakta MaMng eoau anB mona mto iMa abaolutaly charming 1 badioam ranch Only I year eW. Uito hama oftora quakty cnnttniclton esirai upgipaad earpeli Hsiuraa atndow iraatmanls and vraH tppomwd kHchan Thato's PWMy mom to Maa about CaN tortoy tor appolnWMnl. Ltoling Agaaf aoley Ray 8t7l MW LtSTMG . Your dream home It availabto now toi OMy 981881 Bdch ihiaa badroom wHh It? bailw, a lancad batkywd tot lha Wtto. and t orktnop lor dad SomelMng lot avaryona CaM LItting Agent Sten CMrry lur your prtveM shuwing 8171</p>
        <p>ONE CAR OMUMl M COdNIRy Checa out this oOly 3 Iwdroom Mick home with llreplece, 1W oMhe. itvtng mom lemtty room aH ors a baaulitui yard CaH Binn Charry new tl73</p>
        <p>CIRCU DM AO POR A REAL DEAL OwM 2.000 tqfuam taat Two alory homa m the ooumry Detached garage only minutes fmm OrsanwUe tlen Cherry ai50</p>
        <p>HEW MOUM m COUNTRV MTmi Hore le t bettor than 1.800 equaia tool house naarmg r^umpleiion H'a laaHy Hwbto wHh a big lamily room and a icrga kitchen wtih a Met deck out back Rock away your uoubWe on the Itont porch el ItM Mtraclkra larmhouta CaM BM Woodard now and pick out your own paratmai floor covattng. wallpapet and palnl ootots aMT 8a88a-T4MFT4;-FE-R It what yaw'k gal with IMa 213 badmam houaa on large oomar lot Nacanlly tefuibithed wtkto and eui with naw apptiancae AH this and a convameni tocalton can be yowe tor MlOM CaH today Da tort IMS one gels away Alto great invaetmanl pioparty ai8D OUNMT AVENUe  klove m immedialelv and lake aavanlags Ol IMt 1 badruuro noma Fealuiaa that inctoda. Hvmg mom wHh hiMiai.e dmwig araa, and toncad m vtid Located neat park CaH Kanny Flihar tor your par-kunal viawina. Only 44.M1 tl75</p>
        <p>brick 3 bedroom home tocued on e comer tat to WtolarvHto trad Lhrtng room, dtolng room, family room wHh firiplaet Cal today Mr lha new tow pdca. CaH Stan Charry ai54 NMf CONtyiMenOH iMi baglnnlng M Wmdaor wut Taduta t story Itoat plan wHh tpia badrooma UnuauN krtchan. iwaraiiad mattat bairvoom wUH whMpQOl tub. dstrbia carport, ataporiia Harad deck tot tnlartttmng and on comer tot. UallngAgant GalMy Ray *T74</p>
        <p>IMS W TOW OPPORTUNmr to txiy a homa thd la wen mamiamaa and to a dtdfMto nalghboihood Thaia art mtny 3 badroom hones on lha owikat but what makaa this home sppeakhg It me price 99180S Pnvacy abound! this home tnd yet you ra wHton imnuMa of Oraamnat. So II you m quWRy mtodad and naad a good home tor your money you must sat tols charming homa. Evaiyn awwatd #178</p>
        <p>lUPfR tTARTM NOar PtaRirta Huee torga badrooms. i bht. nwowood ttoors Oomaa Hh waahai. dryer, lalrlgaiatoi alovt ceikng tona and wm-dow iraatmants Nptilad among INI pinea dn kmetv comer loi LocNNtto Aydan NTa ltoling Agtny Betoy Ray 81S0</p>
        <p>PHUM CNKiTT Ooodl Cofrto 00 out M Otosawuod and warm rOursaM Oy lha Kraptoct to hm oeauuiui two story home i flto squaia toM nd* oal stniction end you oan ctwoea ihS carpel and waltoapat antoln butidar aHow-anca* UMingAgant aianOwify.8181</p>
        <p>gooa VAiua H wHN you gal wW ihto 3 SadtDoni brtot ranch wrih Owtii.. n iMo im 8 emwiad In back pwch tor tooaa toiy doya. CaH today tor mwb dtitiia.OarYltoiHMaonegalawwiEwHynSwward atar  1</p>
        <p>COUNTRY imm wHh ciiy convantonca, caR tor your appototmaM lb Naw lha plana and spacHlci of lha pial under eotwiruolton 3 twdsqpm eawAiy ealNa Bob RNns ills</p>
        <p>at MLfCTWt and laiUa down In tow good m ataumplton only $8,8 08th and yau con tto lha proud ownar ol HM 3 bodioom. tit bato hoRMi OMy 2 yaara old CaH Sian Charry aigj</p>
        <p>COIV I aaHROOM atlck rmmt wito soactous Heing woai tor lha growtod iwrwy Featurse aaMii kilcHan, dtnutg mom toundry mum u\Mly roum, ouF tMtosoraga. a 2 oat carport and your own pecan orahard CaltoriftowMf</p>
        <p>evaiyn atawawl 81tl</p>
        <p>1 toe art ol wring to Wig ehwrntega bwRoom. Ivy faBil NHB HonN 2 Story huiiw The Mtractiea HWrtdr qoMNa of amptoi</p>
        <p>dinini room, toyat. , -  -</p>
        <p>lew) An MMmdanua Of I _____  .</p>
        <p>nctohbottuyod Thia lotoi lOoapacikitodlfbaaup. aabH A umi tn oiTv wim cfliaitw Alte Htra'a lha I</p>
        <p>.  khaaiolaoihwMMalH</p>
        <p>iMt ouwianding latmiKwaa to Cfayidood OualHy buM by MNWa CoAatiae-lion Company Una I S tqaasa laal hauaa la aactodad amaog HM ww and haKMooda th Niord yoar prkmoy ang couniry type shwM Ml oM q8 the moat toncUunaHy convaniaM hoaaaa yea'H aver saa And by Nl meant dusatn BwWoodwd#iS4</p>
        <p>LOTS TO OFFn</p>
        <p>HEW UMTMta  EXCaiiENT LOCATION tor IKN new Iwme you've baan wah hng to budO Now a iha lima to bay or H you prator irwka a aoed toeaap mani tor toe tolart CHhar Mbaatlena of lAW Mte era. toea to aehoaW, shuppmg. chutthea, arta oihar OiaanMRs aoMHtoa Mne# 9i laa Fw moip totorawltoncNUvatytir</p>
        <p>Stan Charry 78S01M</p>
        <p>Al Joynr 355-5654</p>
        <p>Ml Woodard 7SG49M</p>
        <p>BataySay</p>
        <p>7S7-3034</p>
        <p>The Home SelIersT*</p>
        <p>Otfkie Hourv Mon.-Pri. let. 10^ $ua, 1-1</p>
        <p>toi I. Arilngton M$., QreenvMIe 7S|v^ or M$4S$0</p>
        <pb facs="00096780_0074" />
        <p>35S-Z000 Open Houses Today ZS PM,</p>
        <p>LOT 343 LORAN CIRCLE</p>
        <p>CHERRY OAKS</p>
        <p>QUAIL RIDGE</p>
        <p>WILLOUGHBY PARK</p>
        <p>EASTERN PINES</p>
        <p>t</p>
        <p>1</p>
        <p>u</p>
        <p>r. 1 w</p>
        <p>Wm</p>
        <p>ii-y4i</p>
        <p>ROLLINWOOD</p>
        <p>CAMELOT</p>
        <p>THIS NEW 4 bedroom home will be completed soon for your growing family. Beautiful colonial styled 2 story with over 2,100 square feet, double car garage, dual heating system, thermapane windows, Insulated doors, E-300 insulation and more. You can still select your own decor. For more details call or come by today. #114. $114,400. Host: Vic Corey</p>
        <p>YOU GET yesterdays prlM end room galore with 1,524 square feet for $65,000 plus builder pays $1,000 of your closing costs. Three bedrooms 2V baths, dining area, private patio. Similar units already priced higher. Come out today and see for yourself. Contemporary decor. Host: Geep Johnson. Its new, come out today!</p>
        <p>$36,000-$54.000. These new condos are waiting for yOu to decorate. The builder pays your closing costs and offers 1, 2 and 3 bedroom floor plans. Payments are like rent and if you are a first time home buyer and qualify your payment could be reduced by $75.00 to $100.00. Great location off Evans Street Extension. Host: Jule White.</p>
        <p>THIS HOME fills the order. Take out your list and check it out. Brick ranch, 3 bedrooms, 2 baths, double garage, living room, dining room, family room, eat-ln kitchen, mudroom, office, central heat and air, fireplace (riot, to mention all the extras in decor). All this on a wooded lot In the new school district. MM tSOe. #111. See it now! On State Road 1727 between Brittany Ridge and the Eastern Pines Fire Department. Hostess: Janet Hoskins.</p>
        <p>PHASE II in Rolllnwood Homes features some exciting new plans and decors. We invite you to see our new model with almost 1500 square feet. Cathedral ceilings and spacious greatroom. Youll love the Jacuzzi tub and private courtyard. Many options to choose from. Prices start in low 60*a. Hostess: Mary Ward.</p>
        <p>ATTRACTIVE home. Wonderful neighborhood. Good investment! Take a closer look at this ranch styled home located in Camelot. With many features for you to enjoy besides the 3 bedrooms, 2 baths, greatroom with fireplace, completely fenced-in backyard and the spacious double car garage with shop area. Host: John Moye. $74,500.</p>
        <p>New Offerings</p>
        <p>near CHERRY OAKS</p>
        <p>NEAR GREENVILLE</p>
        <p>CLUB PINES</p>
        <p>716LANCELOT</p>
        <p>CAMELOT</p>
        <p>THIS IMMACULATE ranch has many plus features to offer. 3 piece crown molding, wallpaper throughout, solar hot water and heating system, double garage, deck and patio. Outside shop with heat and air plus attached storage and garage (Could be mother-in-law apartment.) Over 2,000 square feet in the main house. Over an acre lot with more land available. Extra landscaping, new roof, freshly painted, all drapes included, teakwood den and more. See what this mini estate has to offer. Available soon when their new homes complete. Dont miss this opportunity. East of Greenville by Cherry Oaks. Youll be impressed. Offered at $169,500. Call Clark-Branch Realtors, 355-2000.</p>
        <p>NICE STARTER home just 10 minutes from Greenville. Large lot with fenced in back yard and patio. Great room, kitchen with convenient dining area, 2 nice size bedrooms, 1 bath. Lovely decor, priced in the mid $40s. Cail Marie Davis at 756-5402.</p>
        <p>ALMOST NEW in Club Pines. This beautiful two story is freshly painted, new screened porch, new storage and workshop. Brick walks, well decorated with large rooms. Nearly 1,800 square feet, 3 bedrooms, 2V^ baths and charm galore. Call today! Offered at $112,500. Call Clark-Branch Realtors, 355-2000.</p>
        <p>$70,900OUALITY workmanship is here. Custom built from top to bottom with chairrail to crown moulding throughout. So well decorated and meticulously maintained you will want to move right in. with 3 bedrooms, 2 baths and a masonry fireplace. Call John Moye, 7560604. #175</p>
        <p>28B DUTCHESS DR. WINDSOR</p>
        <p>LOW $80S Trying to get in Windsor! Well heres your chance. On a half acre lot and excellent floor plan. Front porch and deck, breakfast room in the kitchen, 2 ceramic baths, crown moulding, large greatroom, Its under construction now! #956. Hostess: Connie Davidson.</p>
        <p>I $350,000-DRASTICALLY REDUCED! Everything youve heard about this exclusive area may be true and this ex-I ecutive Georgian style home is new and has all the extras. Baldwin brass accents, Jacuzzi &amp;gt;^tub, double garage, 3 "Z fireplaces, sunroom and of-^ fice, mouldings in this w spacious home built by Ollie ^Harrington. Privately located Ik on 5 wooded acres. Custom built throughout. Call now for a private showing. Holy Ridge. 'r;#117.</p>
        <p>)T$1B6,000-LYNNDALE :JT0WNES. Princeton Plan  which is a 3 bedroom flat with ^ approximately 2,100 square '* feet. It has extras beyond the t extra quality you would ex-t pect. Extra landscaping, fabu-^lous fixtures, gravel entry, walk-in bar, customized kitch-^;en, elegant entry foyer, 2 I*; baths, Jacuzzi but in the master bath, cathedral ceiling. ^ Come out and see what we J; have to offer. Its the best. $179,500  LYNNDALE OOWNES. Elat. Complete and Sready for occupancy with f &amp;gt;ieariy 2,100 square feet. All ^ the amenities you would ex-i^^t plus some extras. This wlhree bedroom ranch offers ^^'rear yard privacy with great ^location off Red Banks Road, r^all now!</p>
        <p>|$142,600-LYNNDALE I CHARM in this 2 story tradi- tional with double garage. Deep wooded lot, nearly 2,000</p>
        <p> square feet plus unfinished % room above garage. Rear deck 2;cookouts this fall. Quality r workmanship with extra trim. You select the decor in this ^energy efficient home. Call now! #112.</p>
        <p> $118,800-VICTORIAN. Now</p>
        <p>4 in Cherry Oaks. 2,175 square</p>
        <p>* feet with double garage. Lots iti,of character in this 4 bedroom, 2 story. Bay win-&amp;gt;*-dows, large greatroom and i breakfast nook. You select the ^decorl Call now! #119. Lot.  #354</p>
        <p>*&amp;gt;$115.500-NEW BRICK</p>
        <p>Williamsburg home is located &amp;gt; in Greenvilles most popular t.'new neighborhood. It has alt F the space you will ever need L for your growing family. With rover 2,000 square feet on a large % of an acre lot. This 'home also features an exceptionally large master bedroom and greatroom area, 2Vt [baths, plus a permanent ; stairway to a third floor attic % with well over 400 square feet for your convenience. You can choose your own colors and ^ decor. #170.</p>
        <p>5 $115,500. ALMOST com- plated. New construction in</p>
        <p>Greenvilles most popular new 2: neighborhood. Featuring over A 2,200 square feet, 3 bedrooms,  214 baths, large greatroom, }T master bedroom downstairs, unique kitchen with island, ! large bonus room upstairs and ^more. All this on a wooded  lot-youll have to see to be-Have! See this home today $ and still select your own color : and decor. #113.63d Windsor.</p>
        <p>$115,000. VERY SPECIAL</p>
        <p>best describes this 1,900 plus square foot ranch. Less than 2 years old, this home has formal areas, a 17 x 19 den, 3 bedrooms, 2Vi baths, custom designed kitchen, double garage, plus a 16 x 20 wired workshop and many other extras such as Anderson windows, custom drapes and a microwave. Call today! Cherry Oaks. #181.</p>
        <p>$106,000. Beautiful brick ranch located in the popular neighborhood of Windsor. Custom built with many extras! Features targe manicured lawn, double car carport with outside storage. Only 6 months old. Must see to appreciate. 163.  .  &amp;gt;</p>
        <p>$105,500*BE THE FIRST</p>
        <p>to see this unique 3 bedroom home in Windsor. Downstairs features a private m suite, and a great ope pon kit Just</p>
        <p>farnilySpPMms a douj garageTT42-l Windsor.</p>
        <p>$104,500'-THIS IS EVENT you will not miss. The builders att to detail and design this a truly un home...country front oversized greatroom, en/work island and double garage, unfj gameroom, upstairs area #993.</p>
        <p>$99,300-SU new with large rooi</p>
        <p>select the decor. _</p>
        <p>square feet. RecelR^land-scaped, walk-in closets and powder room, plenty .of storage and side entry i to kitchen. Could be occupied within 30 days. Lot #17. $91,500-QUAIL Super nice, weli ^V^HIcks model townhom^H Quail Ridge. Lovely fo well equipped kiti built In microwave opens into beautifully landscaped private patio. 3 bedrooms, 2 ceramic tile baths with one bedroom featuring floor to celling bookshelves that can be used as a den #995.</p>
        <p>LOW $90S-INVESTORS!</p>
        <p>Triplex available on a wooded lot in a professional neighborhood. All have 2 bedrooms, 114 baths, private patios and under homeowners association. All units are fully rented with excellent rental history. $90fARE YOU LOOKING for that special traditional ranch? We have the answer In Windsor. Featuring 1,800 plus square feet with formal areas, 3 bedrooms and an impressive greatroom. The kitchen and nook abound with custom designed cabinets and a pretty bay window. #138.</p>
        <p>LOW $80*e. Located In a well established neighborhood. This 3 bedroom, 2 bath home offers many amenities. Formal rooms with crown molding</p>
        <p>and chair rail, den with fireplace that opens onto a private patio, eat-in kitchen. Very nice decor throughout and in mint condition. Carport with lots of storage, large comer lot. #126.</p>
        <p>LOW $80s-FAIRLANE ROAD. Three bedroom brick home with many amenities including formal living room with fireplace, dining room and den, 2 ceramic baths, hardwood floors, new energy efficient gas heat with central humidfier.#125.</p>
        <p>$75.0000LD. BUT MORE FUN. Escape the ordinary, only 15 minutes from Greenville. Youll enjoy living in this original partially restored Colonial home built in 1906. Over 4,000 square feet, 5 bedroom baths, formal -are fireplacesj^ porches.</p>
        <p>lots. 12 hardwoi Excellent on outsi</p>
        <p>1.</p>
        <p>0-LAKE</p>
        <p>Price redu are moving to sell th 2 bath ranch.! ures updated c' Ipaper throughout plus and an oversized Owners will also assist ing costs. 110. ARBOR ng and offers the ion in new consti he $70s. This house ly 1,500 square feet. E full ten year buyer protec-n plan available. Complete lis year and you select the &amp;gt;r. Call for more details. 139.</p>
        <p>LOW $70*e-A FLOOR</p>
        <p>that cant be beat! This venient 2 ^ry Willi</p>
        <p>HIGH $60S43REAT LOCATION and like new condition await your inspection of this 3 bedroom, 2 bath home. Formal living plus a den with built-ins, carport with storage and a gorgeous yard are a few of the amenities of this home. $69,900. PERFECT NATCH you and this beautiful home. Located in a very private cul-de-sac. This home features all formal areas, 3 bedrooms, 2 baths, large screened porch, heated garage-not included in the 1,824 square feet. Situated on a wooded lot-come by today to see it for yourself. Red Oak.</p>
        <p>$68,900-THIS TRADITIONAL ranch is one of the ^best pians and 3 good size ^a n d large tures sunken Lilted ceilings the greatrobm. 'newl Builder will pay 3inta.Xamfij?n out and see immerfield.</p>
        <p>$63.500  LOT 6 FOX-CHASE- Over 1,250 square feet in this new home behind the Carolina East Mall new area. Deep backyard with deck; large kitchen with built-ins, fireplace and built beyond E-300 standards. Come out today and you select the decor. 984.</p>
        <p>$61,900-QUAIL RIDGE.</p>
        <p>Lovely townhome in Quail Ridge. Greatroom features fireplace with adjoining dining room, 3 bedrooms, 214 baths. One bedroom has built-in bookshelves and desk. Jenn-aire..^BHIfeMShly painted ivate patio</p>
        <p>ith Id be ^shop. near f899. rOR REAL-iTso the house a new listing at Quail Ridge. One of the few that have a large formal room with bayw</p>
        <p>you baths room, m. Hardwo' stairs and carpet lust sell, ready for ccupancy. 922. 105 Pinehurst Dr., Sedgefieid. $70,900-4 BEDROOMS in Windy Ridge. Its immaculate with built-ins and rose garden. Over 1,900 square feet backyard privacy and close to the tennis courts. 214 baths and plenty of privacy with formal dining. See this one nowl 135.</p>
        <p>LOW $70s. Walk across the street to the pool and tennis courts from this 3 bedroom, 2 bath flat In Quail Ridge. Greatroom with fireplace and cathedral ceiling, formal dining, well equipped kitchen with new wallpaper. Comer lot with private patio. 968.</p>
        <p>LOW $70VUNUSUAL 114 level home In Quail Ridge. Master bedroom downstairs, large kitchen with nook, living room or study plus greatroom with fireplace. It hw 1,540 square feet. Available in October. Very clean with plenty of backyard and extra large patio. Call nowl Seller will pay up to $2,500 In closing costs and points.</p>
        <p>9V4</p>
        <p>''LOAN..thls beautiful 3 home Is Just waiting for some smart homeowner. Living room with cathedral celling, kitchen with refrigerator, dishwasher, microwave, pantry, fireplace, 2 full baths, call today for your special showing of this new offering. 1^. Rolllnwood.</p>
        <p>MID $60e-UKE HORSES? Yes? 10 acres comes with this 3 bedroom brick home. 1,344 square feet with carport. Located In the city. Fireplace and more. Well kept. Priced to sell I Call now for an appointment. 123.</p>
        <p>MM $60e. THIS PLAN has</p>
        <p>comfort In mind with 1,325 square feet. 3 bedrooms, energy efficient (E-300). WIntergreen School, in sight and you select the decor. 164. Get in on the ground floor. Rosewood.</p>
        <p>$64.900. GET THAT wooded, privacy on a cul-de-sac. This new home has 1,250 square feet on a 120 lot. 3 bedrooms, fireplace, heat-, pump and rear patio. Builder har714% financing available. You select the deicor. Just minutes west of the hospital. 167. PInerldge.</p>
        <p>f,</p>
        <p>Wi _</p>
        <p>arebiglHiimSb.999 LOW $60s is the pri this affordable contemj ranch In Pineridge. It You select the decor,</p>
        <p>1,200 square feet,^VbO, fireplace and fully '</p>
        <p>200' deep lot, wo^V and Just off the Sta^Hlburg</p>
        <p>Road. 165.  _</p>
        <p>$59,900-SINGLEM|E. At tention Veteran^Hs than $5,500 and you iBIF assume the loan on this immaculate 3 bedroom ranch. You are going to love the oversi " greatroom, 2 full baths, p separatuiAgMhop. All t apict|^Hbtlot.160.</p>
        <p>lEENWO RODN^ SADT'HI^^dly reduc trees comes ... veil-kept 1,265 ...Bare foot home. Garage and more. Only 6 years old. Fireplace, woodstove, large comer lot, well located. 5 minutes from shopping. Priced to sell. Wont last long! #988.</p>
        <p>$59,500-COUNT THE EXTRAS! This lovely brick ranch has lots of space with over 1,600 square feet, 3 bedrooms, 2 baths, formal areas, double car carport, outside storage building. Extra large comer lot. Central air. Priced to sell. #145.</p>
        <p>$58,500-1.400 PLUS SQUARE FEET, central air, garage, fenced-in yard and a good neighborhood are what you want. 3 bedroom, 2 bath brick home. 841.</p>
        <p>$ 5 7.900. THREE BEDROOMS and 2 full baths, fireplace and many amenities. All appliances furnished including a built-in microwave. You and the kids will enjoy the large private patio and playground. Priced to sell quickly. Call for your appointment today. Rollinwood. $57.000-REDUCED. MUST SEE this beautiful Rollinwood home with 2 bedrooms, 2 baths and a loft that could be a 3rd bedroom. Excellent condition. All appliances included. Lots of privacy In this</p>
        <p>lovely flat with 1,305 square feet. Enjoy your private courtyard and the pool. #904. $55,400-LOAN ASSUMPTION with payments less than $450 per month. This brick home has ovr 1,320 square feet, fireplace, raised patio, large storage or shop, two full baths, new appliances and heatpump. Close to the hospital in a quiet neighborhood. Call now. 914 fixed rate. $5|ipO-SHES A BRICK ^and very cute! Jiist the fsize for a family and in WIntergreen School Hct. Wearing the latest in 9t and a new paint Job. lull see shes a real lockout. 3 bedrooms, replace and garage. 154,500-FIVE MILES close ^to Greenville on Highway 33 East. Brick ranch on 14 acre lot. Thre^te|M|^s, 2 ceramic  storage</p>
        <p>lOAN</p>
        <p>right! sated less also</p>
        <p>_ baths,</p>
        <p>heaN^^^^^^BQO square feet, dMHIHHge building, and more. Country Place. Harvest Road.</p>
        <p>Mid $50s. WELL MAINTAINED older home. Thi year old hon^ has</p>
        <p>i2,!^Bquare I la^^ront lir.</p>
        <p>H_</p>
        <p>HO'</p>
        <p>Iroom, [fnwood home with 5hly $2,200 down payment. Owner will pay ail closing costs excluding points and prepaids. Features a private courtyard, appliances including microwave and refrigerator, pool. 2 years old. Owner has moved and is willing to sacrifice. #933. $53,900-COUNTRY PLACE 117 COUNTRY ROAD-Off Highway 33. Invest in yourself, instead of your landlord with this affordable home in the country. No city taxes either. 3 bedrooms, 2 large baths, cathedral ceiling, fireplace all on a large wooded lot. #104. $53,500-PRICED TO SEU! Excellent priced 3 bedroom, 214 bath townhouse in Windy Ridge. Newer unit toward back with treed patio. All appliances and more. Vacant and ready for immediate occupancy. This one won't last long. Call now. #990. Windy Ridge. $53,500-103 FLETCHER. If you need to live in the city, but want a quiet neighborhood, dont miss seeing this 3 bedroom, 2 bath home in Twin Oaks. Over 1,200 square feet. It should fit your budget. #888. $52,S00-CAPE COD with over 1,600 square feet of living space. 4 bedrooms (2 up and 2 down), 2 baths, fenced yard, large paneled shop, aluminum siding for low maintenance. 912.</p>
        <p>$52,50(H3REAT LOCATION</p>
        <p>for first time home owner.</p>
        <p>This well maintained 3 bedroom brick is only 5 minutes from the hospital, both malls and downtown. #144.</p>
        <p>$52,000-MINUTES FROM</p>
        <p>Greenville. Attention first time home buyers! Call to see this brick ranch with large fenced in yard and patio. 3 bedrooms, 114 baths, heatpump, fireplace and a garage. Owner is moving out of state and needs to sell. #970.258 Circle Drive. $50,900-REDUCED $2,000. Immaculate 3 bedroom, 114 bath brick ranch with many extras. Its out of the city in Hardee Acres. Compare and save. #864.</p>
        <p>$49,500-YOU WILL fall in love with this beautiful home located Just outside of Winterville. Situated on a wooded lot at the end of a dead end street. Provides maximum privacy. With over</p>
        <p>1.000 square feet, 3 bedrooms, 114 baths, heatpump, carport, above ground pool and surrounding deck. For a quick sell the seller is willing to pay closing costs. #171. Weathington Heights.</p>
        <p>$49,500 THE PRICE of this 3 bedroom home is sure to please, plus the kitchen is designed with lots of cabinets and a convenient breakfast bar. Other amenities are hardwood floors, updated carpet, a carport with storage and a pretty fenced backyard.</p>
        <p>sible loan assumption, briar.</p>
        <p>$49.500-TWIN OAKS.</p>
        <p>Perfect investment or starter home. 2 bedrooms, fireplace on a large corner lot with privacy fence. Fresh paint inside and out. Super buy. Seller pays $1,000 in dosing costs. #889.</p>
        <p>$47,000  213 CIRCLE DRIVIE. Affordable! This comfortable 3 bedroom, brick ranch located Just east of Greenville will fit your payment plan easily. Situated on a nice corner lot, fenced-in rear, garage and more #115. $44,500-ATTENTION FIRST time home buyer! This 2 bedroom, 114 bath townhome, located In Lexington Squares most attractive court, will be Just right for you. Conveniently located to your work and play, this home, with over</p>
        <p>1.000 square feet will afford you the life of easy living. It's clean and ready for you. Call today for more information. #898.</p>
        <p>$44.000-NEED EXTRA ROOM? Need a home over 1,300 square feet, 3 bedrooms and 114 baths, carpott, central air and beautiful fenced in yard? Then this is it. Owner is moving out of town and needs to sell. Located outside of Greenville In nice neighborhood. 302 Allen Drive. #950.</p>
        <p>$44.000-SHERATON VILLAGE. 2 bedroom townhome. Like new with lots of extras. Available immediately. Family room with fireplace, private patio and lots more. This one you must see.</p>
        <p>z</p>
        <p>Residential Lots Available 7,500-^28,500</p>
        <p>wocarmf</p>
        <p>TRarmo.</p>
        <p>StwtMcLawboni</p>
        <p>7S64ia65</p>
        <p>ComNOnUim SSUIN -</p>
        <p>Marie Davis 756-5402</p>
        <p>Rkonda Bailey EHa McGowan 756-8003  355-5439tfiittnwaia</p>
        <pb facs="00096780_0075" />
        <p>gta Daily,Reflector. Greenville. N.C.  Sunday, Novembef22,1987 031</p>
        <p>/1W ' Mobil* Holtids</p>
        <p>bi^l ibr Mf M. attactra iH^rMAvfil*. MS  montli. ,707141 ,</p>
        <p> ---- and  mobilt</p>
        <p>tumaa for rant. Wlntorgraan gM Soult) of Graenville. 355-</p>
        <p>1t1</p>
        <p>Offict Space For Rent</p>
        <p>mtmmna</p>
        <p>offka. UNIItlai fumMwd. SM par montli. 7S7-14M/70-42M</p>
        <p>mcTivr-smcirsKs</p>
        <p>uHot for rant on Com marca Straot. Gaylord Bulldoro, 756-ssso.</p>
        <p>Fl-STANOINO offlca build-Ind with 1JOO tquare foot avail-abb tar MW a month. CallJaan-nottaCox Aooncy, Inc. 7S6-I3a.</p>
        <p>bxAaoncy,</p>
        <p>'ICE tUlteS for 1 iuHa with 4 ottlces.</p>
        <p>R1</p>
        <p>raooptlon room, walk-ln otoraoa, coffoa aroa and bathroom, U01 sqoara taot. 1 suita with 3 of-floot, raooptlon room, walk-in itoraga, coffaO araa and bathroom, t,10 square taat. Call Ollla HarrtngtonTSon BuiWara 70-SOM.</p>
        <p>5FPrcriiSXErP5FTii SW iquara taet and lOW square foot Parliamant Placa. Call 7SB-4333 days: 7SS-S077 nights.</p>
        <p>smcRsmnPoFFiEEs</p>
        <p>Small-Laraa-Raasonable. Call Joaat2-3W.</p>
        <p>Ml iiUbLI 0|l|CE AND (two) throe offlca suites avall-abla In Williamsburg Commons Office Building, 3 Clifton Strsat lust off Arlington. Call</p>
        <p>  lust off Arlln^.</p>
        <p>Joe Moore 75SMI2.</p>
        <p>RBTAii. OR PPICE 20x51 0225 oar month.</p>
        <p>Street, Griffon. Call Mika Phllllpo, 3S5-4110 days, 524-5371 nights.</p>
        <p>spscw#</p>
        <p>Ouaen</p>
        <p>Mika</p>
        <p>1S1 V OfficeSpace ForRent</p>
        <p>SlA Ok-lfW rlk aroumf. ilica now. mm. Alt options and electronics. Low hours. 758-2300 days, 75*1742 nights.  </p>
        <p>dffkfc lUiTtl and Individual rooms avalMb. Including utilities. $7.50 par square foot. Downtown and Arl-in^ Boulevard area. Call Clark Branch Realtors 355-20W. m##lIbr^Wiatar</p>
        <p>$145 par month, ona tar $155 por month; utllltlos Included. Ex-callont tocatton, 3101 South Evans Straat at Graanvilla Boubvard. Call Leasing Pro-fasslonals355-27M.</p>
        <p>yTresiTOTFiirTpsti</p>
        <p>avallabla at Arlington Contra, can be used as one suite or Individual offices. Call 755-MW.</p>
        <p>1M</p>
        <p>Resort Property ForRent,</p>
        <p>mrmrrasss</p>
        <p>condo with iacunl, Christmas week, $275.355-7085.</p>
        <p>115 Rooms For Rent</p>
        <p>PIRATES LANDING</p>
        <p>200W. Eighth street</p>
        <p>Private fumlshad rooms tar rant. Utllttlas Included. Share bath and kitchen; REMCO EAST,7S$Wtl.</p>
        <p>ROOM: prefer female. Next to GroanvHb Utilities, Mumferd Road. Call 70-5805.</p>
        <p>192 Roommate Wanted</p>
        <p>ITIAN MALE to share 2 bedroom townhouse. 7SS-50M or 70-2121,oxt4a6before4:3O.</p>
        <p>tiwnr RWMt</p>
        <p>WAflTED-reasonable rent, accomodation with private bath. Call 94*4125 or 757-1251.</p>
        <p>2JS22IS!!2!2*!^^</p>
        <p>PdMALk ROOM|f% Wontod. $110 a month plus b Utnitleo. bill 75S-5799 or 758-</p>
        <p>4249</p>
        <p>miimeaiiiwsra</p>
        <p>HbiiNUffc WAMfCb W</p>
        <p>your own room. Call Cheotar-after 4.75*4457.</p>
        <p>MWfiMAVBi'Wdtib fo^ 2 ooMemporary homes In Rollln-wood. Uft, fireplaoo, private batti, many extras. Call 3SM17 OT355MM.</p>
        <p>lbMMAf eiitb in a large furnished 3 bedroom, 2 batn house In Belvedare, $2W a month plus shared utilities. 35* 7039.</p>
        <p>*lUMAti"";bbbd, P^</p>
        <p>slonal or serious student only to share 2 bedroom, 1W bath townhouoe, $2 a month includes electricity and water. Call 752-9589attar 5~00p.m.</p>
        <p>TOTSiflimliEFFnta</p>
        <p>fumlshad 19M mobib home wUn big ^vota room and bath, con-ventanf to ECU and Graenvllb. W rent, Vk utllltloo. Call 75*7142.</p>
        <p>194 wanted TO Buy wood timbar. PamlMrlmber</p>
        <p>Company, Inc. 75*8415, nighb. WANTED: Commercial lots In Greinvilto aroa. Call Mid-Atlantic Bulidars 757-1510.</p>
        <p>idAliTIb' fb' BUY Victorian turolture. Call 1-94*7184,-WAdTiO to BV pine har* wood timbar, and land. 74*4444, after 5: W 74*3437.</p>
        <p>19t Wanted To Rent</p>
        <p>or totally furnished small apartment. Near Burroughs yfellcome. Call between 7-9 p.m. 757-0741 or 75*054), *Sp.m.</p>
        <p>CLOSE TO HOSPITAL ON 2 ACRES HORSE STALL AND TACK ROOM</p>
        <p>Winding gravel lane leads to spacious two-story brick traditional home overlooking private lake Home teatures all formal areas, two fireplaces, den. gameroom and four spacious bedrooms, two-car garage. Enjoy the peaceful atmosphere of tnis secluded home built by Olhe Harrington, Offered for only SI59,900,</p>
        <p>756-1322</p>
        <p>OPEN HOUSE SUNDAY 2:00-5:00</p>
        <p>RT.2,WINTERVILLE</p>
        <p>NEW LISTINQ with room to roami Approximately 1945  square feet with greatroom, dining room, eat-in kitchen, master bedroom with whirlpool and double car garage. Offered at $115,000. Your hostess: Mary Chapin</p>
        <p>OIractlons: From Evans Street Extension, Turn left on Fire Tower Road, Turn right first road to the right going towards Windsor Subdivision.</p>
        <p>;'</p>
        <p>An exclusive community of only 27 homes. Offering a wide range of designs that fit every need. Quality construction you can appreciate and enjoy. Landscaping individually designed to compliment the most attractive features of your home. Lamp Posts and underground utilities.</p>
        <p>Call Chapin &amp;amp; Chapin Realty 355-2295.</p>
        <p>'HOME/S WHERE THHEARTIS*</p>
        <p>NEW LISTINQ</p>
        <p>Save almost $3,(XX) In closing costs on this excellent assumption at Lexington Squarel Payments of only $426/month PITI, equity of $S,0(X) and assumption fee of $45.00. Call Darrell now at 355-2556 for appointment.</p>
        <p>OPEN HOUSE TODAY 2-4</p>
        <p>Reduced $5,000 so you can purchase and be In by ChristmasI 4 bedrooms, ZVz baths, formal dining, enormous Recreation room, screened porch, and play house -now only $113,500. Located at 105 Woodhaven in Westhaven Subdivision. Your Hostess; Kristi ClarkI</p>
        <p>WE HAVE TWO TIME haring places for sab at</p>
        <p>Foppartroe. Ona can be assumed with only lOOQfdown wid payments of $607nK&amp;gt;nth or pay $3,300 balance. The second Is avallabla (or $8,000 and Is waek 33.</p>
        <p>OOUBLEWIOE I H ACRE lot In Easiwood oil o( Rhwr Road. FHA-VA approvedl Only $31000. (Ml Kan fordaialb. ^</p>
        <p>COUNTRY HOME  Brick Ranch Ilka new with 3 badrooms lb balhi fonced yard, outside bam 8 priced for quick salel Only $4I,$00.</p>
        <p>UM)SR CONSTRUCTION between Ayden &amp;amp; Qrlfton at Pleasant Rldge Is this proven plan wllh 21x24 graalroom with (irplaci 17x10 b maatar bedroom, and 2 more badrooms, 2 lull baths, wooded lot and FHA-VA approvedl Only 881,800.</p>
        <p>HANDYMANS SPECIAL With 2 acres near</p>
        <p>Ortmealandl UnbellovBbly priced at only 811000. Call Gena for dotalb.</p>
        <p>VETSI Nothing down on this 3 bedroom brick ranch near Farmvllle. Like Newl Only 880,880. Coll SHI for details.</p>
        <p>AS8UMPTI0NI NO CREOiT OR BAD CREINTT As-</p>
        <p>sumo this non-quallfbd ossumptlon (or only $4,900. Three bedroom, 1b bath, ranch In AydenI $41800 call Oarrell nowl</p>
        <p>TWIN OAKS TOWNHOUSE: 16 otops to the pool for summer fun. FIraplaee In the groatroom tor winter nightsi Two badrooms, 1b balha, largo osl-in-kllohon, only o Mook from the by-paool E(XJ oludonlt or protaoslonal poopb will lovo III Only $47,800. Call Darrall for appolntmonl.</p>
        <p>EXCEUENT A88UMPTI0NI For only 815.000 down you can assuma this non-qualiflad loan &amp;amp; move in by ChristmasI 4 bedrooms, lormN areas, 2 baths, den with llreplace, garage and lencod yanti Only 886.000 - call Lon lor do-talbl</p>
        <p>HKM1E REAL10RS</p>
        <p>757-1969 ANYTIME</p>
        <p>(ON DUTY)</p>
        <p>KrlaM Clark 76*7100</p>
        <p>Kan ESwarda 4MII4</p>
        <p>OarrWI HIgnlta S6*&amp;lt;8M Leonard Higntta 7M-1St1</p>
        <p>Qane Sharkonfiaa 74*2401</p>
        <p>BMIMonMord k77$0</p>
        <p>f</p>
        <p>. -If*- . ; , . .  ,  9  .r ' &amp;gt; -</p>
        <p>Homes You Aspire To Own...</p>
        <p>And You Can!</p>
        <p>Take Advantage Of Great Financing And Outstanding Selection.</p>
        <p>  _fv'</p>
        <p>If you havent already discovered the affordable Villas at Treetops, then maybe you should ask your friends. The list of special features is impressive consisting of a greatroom with fireplace, ceiling fans, full appliance package including washer &amp;amp; dryer, patio or deck and modern energy efficient conatruction...and your new home is set in natural wooded surroundings just a short stroll from the swimming pool and tennis court. Your friends already live at Treetops so you better hurry...because homes priced at $46,500 sell fast and we only have a few left! Builder pays up to 2V^ points. ,  __</p>
        <p>TREETOPS TOWNHOMES</p>
        <p>All new Treetops Townhomes will be ready soon! Spacious two bedrooms designs with private baths and walk-in closets; custom crafted greatrooms with over-sized windows, ceiling fans and cozy fireplaces; fully applianced kitchens and generous private patios are some of the standard features in a Treetops Townhome. Set in a wooded background, this is a prestigious community to call home. $59,900 to $66,900. Builder pays up to 216 points and $1,000 closing costs.</p>
        <p>TREETOPS SINGLE F.L.M1LY HOMES</p>
        <p>All these new homes deliver the space and comfort of individual homes, but offer the convenience of townhorne living...a nominal community service fee provides for lawn care and long term maintenance of your home. Theyre perfect for the busy professional or people who dont want the bother of yard work or tedious exterior maintenance. Sell your lawn mower and extension ladder and join U8 at Treetops. Builder pays up to 2 points.</p>
        <p>1507 Birch Place</p>
        <p>*73,900</p>
        <p>108 Winding Branches *81,900</p>
        <p>In the privacy and quiet woods of the Treetops neighborhood youll discover The Gates. At The Gates, we're offering three new exclusive designs. Vaulted ceiling greatrooms, fully equipped kitchens with custom-built cabinets, garages with automatic door openers, ceramic baths with whirlpool spas, expanded decks or patios and efficient gas heating systems are just a few of the nice touches youll find. Visit our Open House today and see all the benefits of owning a new home in Treetops and The Gates.</p>
        <p>Builder pays up to $1,000 Closing Costs</p>
        <p>The Viliager-2 bedrooms, 2 baths..............$75,900</p>
        <p>The Georgetown-2 bed||g|| CMKs, study/BR.. $84,900 But more under construction now!</p>
        <p>The Nantucket-3 bedrooms, 2V baths..........$87,900</p>
        <p>Bayvtew</p>
        <p>WateJn^^wKo^^n the PAMLKX) RIVER Located off N.C. 92 East of Bath.</p>
        <p>Designad for ysar-round snjoyment, Bayview Townes is the best buy on the rlvsr! Just a short drive from Qreenvills...visit us today.</p>
        <p>$$$$AVE With Incredible Off Season Prices Now Only $66,900!</p>
        <p>TREETOPS &amp;amp; THE GATES MODELSOPEN</p>
        <p>Sunday 2-.) p.m. .Mon(lay-Tliiirsday,2-.')i),m,</p>
        <p>Saturday !)-12 Other Hours By .\pp(dntmeiit</p>
        <p>Localed off Ev ans Sli eet !v\ttiisi()ii, South 0 (ilIMMIvil</p>
        <p>EASTWOOD 219 KENT HOAD</p>
        <p>Under construction on a nice wooded lot. Two story traditional offers 3 bedrooms, 2^k baths, greatroom with fireplace plus a study or den.</p>
        <p>&amp;gt;88.200</p>
        <p>IliKKTOPS</p>
        <p>TTT'KEH KSTATKS I Tl ( KEH ESTATES</p>
        <p>.\E\VI.L^TI\(. REIA EDEHE</p>
        <p>I in piMllelout TrMtop,. this 3 bedfoom, ive Mh. onn-ynar old honw l Imniiculel From a iHiae amatroom wlin limplaca to a patio wttn a nahnal vlaw. this horn, will pmtaci trmr financial in-vtalmanl TltnHtgh a nominal nomaownan Mioolalion Ita, Iha aatarlof ol your homa ptua lha groundt am malnlalnad and you own mambarsliip In lha pool and lannia court For an aaav. an|oyabla llfatlylt In a champion nalehborhoad. coma taa Ihli homa. a88.9aa.</p>
        <p>Appealing four bedroom Traditional Is lo-catod on  quleU|ul-^e-|WlVaulted celling grettrop dniwiBpkJ &amp;amp; entertainment afeietNlbaJIfciifWlter bedroom, expansive Mk with seating and an attractive wooded yard. $119.^.</p>
        <p>A TERRIFIC BUY in popular Tucker Estates Is now even better. The owner says SELL and has reduced the price and will pay $1,(X)0 closing costs. Wise buyers will recognize this Investment opportunity, $98.900.</p>
        <p>IMMACULATE Inside and outi Thre* bedrooms, 2 baths, formal areo and cozy den with fireplace plus large deck for outdoor enjoyment. Recently updM-ed with a new root and heatpump. It'a a great find In this popular nalghbor-hood. $79.500.</p>
        <p>OFFICE 752-0025</p>
        <p>TREETOPS/GATES SALES OFFICE 355-5370</p>
        <p>Ban</p>
        <p>&amp;amp;Lane</p>
        <p>R(id EstMe Salles And Devekipmeiit</p>
        <p>Rudy Kuenzi</p>
        <p>Home 756-7324</p>
        <p>Jsnet</p>
        <p>Home 756-9239</p>
        <p>2301 Executive Park Circle, Greenville, NC 27834, (919)752-0025</p>
        <p>Richiri Une</p>
        <p>Hamc752-I|y</p>
        <p>DnidHenUbnl</p>
        <p>Home 7S8&amp;lt;0I80</p>
        <p>DiekKialey Home 757-0673</p>
        <pb facs="00096780_0076" />
        <p>, November 22.1987</p>
        <p>Akiridgc</p>
        <p>Soudicrland</p>
        <p>Realtors</p>
        <p>GOOD NEWS! RATES ARE DOWN AGAIN!</p>
        <p>In the past 30 days mortgage rates have dropped by as much as 1.5% on fixed rate loans. That can mean a savings $85.00 per month on a $75,000 loan! First time buyers may qualify for an effective fixed rate of less than 7.75%</p>
        <p>A P R. Call one of our trained professionals today for free friendly advice on how this may be the best time ever to buy.</p>
        <p>OPEN HOUSES TODAY</p>
        <p>2:00-4:00</p>
        <p>534CRESTUNE TM8 VERSATILE 2,400 square foot brick 2.atory Is perfect for the large family. Spacious rooms include greatroom, dining room, kitchen and 4th bedroom (or den) down, plus 3 bedrooms up. Double carport In back. Good buy at $114,900. Hostess' Susan LIkosar.  '  .</p>
        <p>204 STAFFORDSHIRE BELVEDERE</p>
        <p>TRAOmONAL FLAVOR at a modest price can be yours In this custom built home. Large fonnal areas, den, study, 3 bedrooms, 2Vt baths, screened porch and beautiful hardwood floors. Come preview today and well discuss the assumable lom. Your Host: Ray Spears.  _</p>
        <p>100 LOUIS STREET CHERRY OAKS</p>
        <p>EXPECT THE BEST! This farmhouse Is only 6 months old and in mint condition! Beautiful pine floors. Features huge greatroom with fireplace and formal dining room. Master bedroom downstairs. $114,900 See It today! Hostess: Beverly Queen.</p>
        <p>FRESH ON THE MARKET</p>
        <p>OAKS. Contemporary styling combined with comfortable easy living, this home features large master bedroom and bath. Formal living room, dining room, sunaen greatroom wiin fireplace overlooking fenced and wooded back 3 bedroom, 2 baths. $99,500. Listing Agent: Katherine Vinson.</p>
        <p>BEAUTIFUL OLOBt home on Student Street bedrooms, 114 baths, living room with fireplace, dining room and sun room. Carport. Hardwood floors throughout. Heat pump. Really nice at $97,500. Uating Agent: Dick Evans.</p>
        <p>MunANY RIDOE. You will love the large wraparound porch on this new home. Large greatroom has fireplace, breakfast area with comer cabineta, master bedroom dowitsiairs, two up, 2 baths, back screened porch and deck. $97,900. Listing Agent: Sue Dunn.</p>
        <p>PRICE REDUCTION special featum;</p>
        <p>COUNTRY. Neat three bedroom ranch near Walstonburg features an open floor plan with a spacious family room, kitchen with dining area, garage, IB x 36' Inground swimming pool, private ^ced in yard and a 20 x 24* workshop. Owner Is leaving the area and must sell fast! $00,900. Listing Agent: Jeff Aldridge.</p>
        <p>TANY RIOQE. Tastefully decorated, this three bedroom Williamsburg home features three full baths, corhfortable master suite with huge walk-ln closet greatroom with fireplaM, spacioua kitchen, dining room with bay window and a large lot on a</p>
        <p>New</p>
        <p>Homes</p>
        <p>itirtmgat</p>
        <p>$56,950</p>
        <p>Built by Mutton Homes Marketed by Aideridge &amp;amp; Southerland</p>
        <p>HOURS: Mon-Sitl2-. Sun 2-1</p>
        <p>Cali)55-5786</p>
        <p>WE WROTE THE BOOK O^tUYINO &amp;amp; SBLLINQI Call or Stop by our offico for r complimentary copy of our Homebuyera or Hofbasellnr9 Handbook. Dont think of buying or selling without ill</p>
        <p>m.iw -itwfir VMXIYtmwm kwro w tww iwiiai tma.iiaiiNi i i $Nt</p>
        <p>Sit-</p>
        <p>ivmSmT</p>
        <p>irauoh FiMeh doon mpmN S ewwlihm^ pi and ^</p>
        <p>eiaaiHe MHtSi akaae lilwdmXpi</p>
        <p>WM.INISW</p>
        <p>wNMMiipiriwp I aadBRsR</p>
        <p>iWrtifeMNM pMiiaMw N if NaSy MtM bddMow.mlMN aai Nim msm</p>
        <p>^ fees ksilprkfpndlla aikadli.  ^</p>
        <p>WjWMOOiqilO ira tm rnmmm  Ormwii. WMaoii, kmNMw  i</p>
        <p>conm m hmNWh liadwipiA wWa WB *  j</p>
        <p>i$U3LDU</p>
        <p>priPMilpHn.  '</p>
        <p>limn nwini &amp;gt; unu mw a Ml Hfti rnnmmmii (MMan an dMdaa eaadid M in tMW-MWA   SH  Mhn,  Za  nil  annaiin</p>
        <p>fMnWal Paiwl Awna. Ml tmnd Ntna. I fiMBlieaia I aMaatf BDaMs BVi|ii</p>
        <p>lMWaeaia^&amp;gt;ballia~andaaaiiMhaiai|.</p>
        <p>117AM-NIW eoiWlWCIKW WTaafatiaialia. Nasa way an^</p>
        <p>Md tnih anWra. CaatoM Mana Bwada aNim aHNMi, ananan, auaMM</p>
        <p>t  eMoaayaaraainaalon.  .</p>
        <p>-lyirairr'jr</p>
        <p>BHMMaiaa.lMaawpiaR&amp;gt;aisandiHaalNatpM</p>
        <p>BloilaiaBiii. MMf-wnrNdoo. Omf</p>
        <p>I loam, S badwani, $</p>
        <p>M,&amp;lt;00-YOU WM. nevR KNOWnSal yaa an aiMa|a^ yaaaallBdayieaaaf^MgMl a fadnaai 1 Naiy Nwainaia. UMfaa pawaimd mdeaad thara, laiea ailar badnan,baaallMafpiniila&amp;gt;aaalabMailpanaL  _  .  1</p>
        <p>aaipartanalanly</p>
        <p>i3iP</p>
        <p>/</p>
        <p>...M*-/w^qpfniininn^iaMiiAiaiahadiaenlnliltlndMiiiillnClaSHaiaatlt4</p>
        <p>'^SSa&amp;amp;Jria.rjassar-</p>
        <p>iimso-tiiciwwato</p>
        <p>eOfRSr Mil MMi ipaeaalMSafaan</p>
        <p>SSS&amp;amp;</p>
        <p>iiinii. liBilidaOanalit iBl deaia. A wty ipnliHwir iww</p>
        <p>alyla,Pa^</p>
        <p>MpiaM^ dMaf nan aad nal mam. I RMiNie</p>
        <p>vo OWK OMmw PUCt A Idak naos Mh anr ION ifMin ^</p>
        <p>'^n 1 BIS aana al Had. Tato a eiBd Nal al una ana. Sa mmd nfaortami  alte</p>
        <p>Beie BfekriBofe e$Rr FereiHRSk  ~  I</p>
        <p>MII-WALOroWMtelte  TSyS</p>
        <p>iwNanNapiBLM5iLaadNhato|irdaadaaxl4'a8^^ ,</p>
        <p>H.IOn rillWW?*  a  wn  Cna  Oad.  ly  .painan  JBf  ]</p>
        <p>wnSlTaHteanhMiteaadto fatWylaeHIAlpafc</p>
        <p>yami, liailidaOafaNUBl deaii. A wqnpiMiNr----</p>
        <p>10SlM&amp;gt;YOU CMI toriv taa te Nnh taM Hrlha laaiMM ahnto aod dagamdi. UeM iTltoiSndPU. te 2^ Tndtetote nin h te appar ate iw tenalBii. YaaanalaaallanairappneMal.</p>
        <p>ifrAW-teUMMOM CHMM aad diNI. tef Ufrnm In Wjatedla actel dNWet</p>
        <p>In. IMiln teNdan 2 todnann and pNymon nr 9 tepEtoTu ~</p>
        <p>k Urea 4Mag nam. Qanin.</p>
        <p>MU. te Man</p>
        <p>2</p>
        <p>MW-OfFk POR IM upatatoa^lte^4^ wN aanfal naifitote Jte</p>
        <p>Jrgjg?? ---------*'  -  -  </p>
        <p>"-Ss-juast.'SBawsw.-Bi</p>
        <p>tote,dart.(</p>
        <p>SjM-A uir m A UTTLC N dwi yaall N N te toanatela tona, NM and atea totean; Ito kam NI haia tete</p>
        <p>tMOO-Wt$THAVteN-2iteteNNMhN^|wWdNaaatyaalityiir.teaMlinaa,lte-</p>
        <p>^^lnnaiNHInpNaa,2todMaaia.2Ntote,aNlNatoaapadte^ srte-teWKRPllO  Mnliom Dr.  Wl aate.Nteii$.MJfl&amp;gt;te  **  tete oaaainiatotactod away telad te Cateni^^</p>
        <p>Nteltoiliiiiaai, iteisianai, WBNMtntoawliteaMMiaoalL ISteS-cmURIIIii</p>
        <p>  totewNUniaitoteidwtodiinei tete tete **</p>
        <p>M WmteiteaateiteBliHL</p>
        <p>2WI</p>
        <p> caMiteaMniniaan.</p>
        <p> Baagawiasgg^*!;^</p>
        <p>ifteatedar.</p>
        <p>taiaralaa.</p>
        <p>aai laNNi dato</p>
        <p>auM-fAOnvoOO. laaate aaate Ite toan aa a topa caar M teteaa gnalnan IN kteattentipanaadiaaaya</p>
        <p>- "KF* Otelltetebf</p>
        <p>MAoe-m</p>
        <p>MAMK&amp;gt;</p>
        <p>niiteitoteMdtotesteiiliw liSaaaateateaietetatoite. ^ bMOe-TBW OMtI. topniteiNN 1491 afiin tel aOan Maa biteiNi. 2N bUte iraateteNite&amp;gt;liti.baNteaadteayaiate.  y.  .  .</p>
        <p>17 j90-NElir utmn m $pilaN Xte Rteia cmia. Ont .me afain taaiai bylf!^ ane  toteaitot 1H toteTteikain ate iaptea aad a iaa. Ui|a tete* Mte</p>
        <p>iaaafnabninaN.aalbiNtodtedllMfaiidaiawfa.</p>
        <p>BeBWi rw liBsii etsiei</p>
        <p>ilte--PlMnBISWIU-11PNnii'atelk-TlinabateBai,2^^Napaaaiid pjM, i5SS?SMtoAtetebtebaatoteiaaaaanirMNiaab^</p>
        <p>SBPjaatisSSEs^</p>
        <p>  -----------------</p>
        <p>l7te-N5TMrwat Yaa  Nto te Nit laaMMiad panl aa te aa baM Ui|f pnNMiia toa IbipNaa, bnaktel ana M dowwNba,tocBp,2bilto,bnb--------------</p>
        <p>Nllatenir.</p>
        <p>atoatetenTHai tel</p>
        <p>baaddacb.</p>
        <p>"^iSTigsxssssi'ssxsrjs -'^ssssssx'sssssasaas</p>
        <p>ryaarpaiaal-------</p>
        <p>I7ASS-9TOS - Aa iveipiNaiby al baW aobd bte bwaa. M temi anal te a tete , 2 badnana. dn wNi tepNn, nabain W tepte</p>
        <p>MAOSHtel</p>
        <p>mteeifpal.aadliaaltXS2Nenmdpael..</p>
        <p>iiaNtei&amp;lt;nbNiibtoateda|teNaaadldiaala|tebid|ia. MOP-ONIUM bN* ina bMnW, 2 ba bpna baa anr ilfl ifian M:. ^aiteirtote itotte te iipNat teilte finia, tetotei fiid I</p>
        <p>itelItowHi</p>
        <p>SteitobMtotetoartalteWMtoaitetbaH ILiOi  WmMIY iNMB. 9nnd aa</p>
        <p>end naw aanMniitoa aa a ctoiea caMaeaa N MRaay BMia. NtoatoMt dialpa, in* badnana, teto M briba, pial nan  .,,.friari.lpw*wdn*aadnbinl</p>
        <p>andaMamdNpanti.</p>
        <p>WNlillM.teii</p>
        <p>SAiee-CAiBurT.</p>
        <p>S449S-29S MUK 9ncir: MMite Mea barioain, toa balb buaeitoi. aw MIL toe 0M</p>
        <p>nePL HWteMllwwlte</p>
        <p>24JS0MlMOTACl&amp;gt;OTbnabribtori.2toiiriiaboapiNtetefate*te-f^"* ^^iStepNpaJdNtoabtearihNriia,ii|i NtoiilabMliaidate teto ten ISto-OWNR LOW aai as ei &amp;gt;wil b. I bateiwa. Nn btotoa W bwiitel awa.</p>
        <p>^0Mteik.bMteoaifNii%riteiMN9.Wlbi.|rii|.nnirlri.</p>
        <p>Ltel</p>
        <p>SMS9-tevaNWteteteteteaaiditeatepicatetedbitpit1bSt.toiian NM NetadM tenal anaa, drimnaa badnana, 2N bate aad aiy. itea Inalada aanriwdaml. Miad W,aiaariibN teal</p>
        <p>CJse-tASTWOOB. te MNily miawiai te NMy aaw tedteaal. Uaite ri te aai 2 a</p>
        <p>erial aban N te papaNr aai aaanatate NaaNd aatobbartiaat Plaar pNn laateaa</p>
        <p>TteSsNbaiiritew rite bnia. tete awa oaipri, prial, aaiagtePri-4AVTRBI- iiiriii 9i britoiri llrii N a</p>
        <p>HiiNlntM,NaailriiiaeaipaMaaiaeNri  telW-Ste t te tWNir. iter bean at</p>
        <p>7AIW-4AVTRBI-IM wMi RnplMe</p>
        <p>S2J0S-UNNBWTT. 1MIL Oto Tto partnl bfM te Mtea bm bqriit biNb nnrii telate Mil nani nal tete non W batote, tefl</p>
        <p>I aa a Mili M toarte i</p>
        <p>nnte-9 bribanai, 1 brii teto Hitetete riria, btobia aai ritoy nan. Nto a toJM-ROCjlIteNII tjBllB  ?!  *</p>
        <p>79J(-WOODlWatMaawaeteriN&amp;lt;iowtWaorilipa.ainriaiwaiteaa.TWaaa</p>
        <p>tai baarite 9 badnwn tteWanil oNin aa aacritet.lter pte Ntetep Nrf</p>
        <p>Sarinoni, btotoa W boy taBwod bnridiri no, aai Nnari dfrini man. Ctetoi MiiNaeriiaaldWrW.9aabtatoyl</p>
        <p>47J</p>
        <p>a BOL</p>
        <p>tsnsrJA&amp;amp;iaus.tas'</p>
        <p>7bAI-19 UWteWOOD te tevom IWONNKM. Eieatori bte toM 1^ tete Ncalii acate caar NL Patena 8 bateaaii. 2 bate, teilanaa.&amp;lt;iablnrini</p>
        <p> INw 9 bariom bona m M nete. Lw|a teto rite te tentery aMas te af aateri bato. bNMr te temteba aten prinay MI aann-aliMi. MaSrite|il-.TIiaaaabaia tete pariei. te.</p>
        <p>TMW-UWVBWmr MNA  9W t Eba Ibaat WriMiarii Ni ter badnana, Mae MI bate awpart, eomrM.aannl tari and rir.</p>
        <p>ayjw-WBIIteWLltinribni atete tona aten iarbiiHni,iN tote, ttetew te</p>
        <p>SJN-WNOVNOQI.OHqri</p>
        <p>Ltwatoi</p>
        <p>tapiaaNannnte.</p>
        <p>JW INMTM|imMW.f</p>
        <p>ipateate</p>
        <p> te catee ana, biariite</p>
        <p>ZS</p>
        <p>ite  HOOKte.ftote Ote  Itepi aten teca binnrii, teN nan. an i Write</p>
        <p>inppdwteteiiaiNi</p>
        <p>PRELIMINARY OFFERINGS IN</p>
        <p>Blue Banks Farm</p>
        <p>BigiM Cawaty Udnp juM M* &amp;lt;toa tow te OMMtei CM Sna Ml ate 4 nriM NM na CawHy MmbwW HMpM.</p>
        <p>W*eeSaaeai</p>
        <p>|k, DitiwaawBMNhMaaMMaMtiaa MMMM CM war fk WM. ala M  M awWtNn  WM TW Mm.</p>
        <p>tiwiMiMMMkiaMaMMaMaa TM iiiMian, mm m tejwa  Cmm,.  M  ter    kMiaw  al  Me  la  a  atea-</p>
        <p>It M aa IWIHI lal Ml MWaaMi aMewUNMBBMsa ...___</p>
        <p>ai anaMW aaa tmm  Ma  pmnm  a  ame  naaiaiii</p>
        <p>TMa Is a rare ppartuidty to acquire aoiM of the meal beautl-ful and uidqin tond avaitable hi thia area.</p>
        <p>mmmmasssssi</p>
        <p>&amp;lt;*-i:7r;srRrss^</p>
        <p>iMI1Wa</p>
        <p>'^jr^trs'M'atssusRS</p>
        <p>.....</p>
        <p>42AW-lUiN9lMI bMNOR &amp;gt; 1S2D Oaoawd  bariNnI totebniri batean, IN brikten toan ateippinbatelyHi4ateinNn asjte-TNS MRUm haibwrN haw baa 9 batew^ teas man, i ' ariiii |we aaitewaiNtediaiiton ciadtoa.</p>
        <p>ritet</p>
        <p>i.WI-9HPtHW^^ ytlAte  Mteribn toa bteate Nantoan</p>
        <p>ipariwa btotaa ate ate ana, prima pate ate aaawiin n aabntef I Nateinati.</p>
        <p>rSSOO</p>
        <p>ANBBbtrOf</p>
        <p>TheTravdefSj Realty Netteoric</p>
        <p>BroksrOn Caii</p>
        <p>Sue Dunn 355-2588</p>
        <p>  OfflCB Hours:</p>
        <p>Sat. 9&amp;gt;1 Sun. 1-6</p>
        <p>Anite Worthington</p>
        <p>om</p>
        <p>358^1</p>
        <p>8uo</p>
        <p>98MSM</p>
        <p>IWhoAWrWio</p>
        <p>cRt, CHS, ora "</p>
        <p>780-7071  TBMiOO</p>
        <p>junoWyrlek</p>
        <p>706^710</p>
        <p>Dick Event 750-1119</p>
        <p>BovcrtoyQiMon</p>
        <p>757-0094</p>
        <p>QRI</p>
        <p>ISM700</p>
        <p>Wortoy Wirron ParmefUnd 795-9222</p>
        <p>Roy Spoore</p>
        <p>7SM962</p>
        <p>SueanUtotor</p>
        <p>759-7914</p>
        <p>Kothartno VIneon 752-8771</p>
        <p>Shari Cartar 78M891</p>
        <p>Tarry Hathaway  iJ*'*!?!</p>
        <p>958-89I7  OWCBMontgwrtiilf I y-toririjfl kiliriteiiitetaaoaaaiBaiiaBiB</p>
        <p>lai</p>
        <pb facs="00096780_0077" />
        <p>Mrnm</p>
        <p>,.V.  '^</p>
        <p>THEDAHY ^ &amp;gt; -</p>
        <p>REFLECTOR</p>
        <p>'\3rMnvHle, N.C. ^ Sunday, Novmber 22,1087&amp;gt;  ^</p>
        <p> ."f'iir</p>
        <p>.  &amp;gt;'.,</p>
        <p>FORT TOUR  Jeremiah Armstrong, age nine, stands at some distance from a group of soldiers touring the fort at Fort Branch, a Civil War riverbank fort near the vUlage of HamUton in Martin County. Tlie tour was part of a Civil</p>
        <p>War reenactment held ttiere. Armstrong was a lieutenants aide for the 26th N.C. Troops.</p>
        <p>r'm</p>
        <p>*i&amp;lt;v</p>
        <p>IN THE CMP^ Memlrs  the 53rd Pennsylvania Volunteers sit in camp Ulking about the days activities during the two day events at Fort Branch. UR to right are Joe Bass, Roy Bennett, and A1 Larkins.</p>
        <p>Text By Jerry Raynor  Photos By Cliff Hollis</p>
        <p> - 'V    ---Re-Enaefmenfs Of MUifory Ufe In Camp In The Woods Atop A River Bluff.</p>
        <p>.j"A Civil War Celebration At Historic Fort Branch</p>
        <p>' \</p>
        <p>Saturday and Sundav, November 14 and 15, was a special weekend for Martin County residents proud of their major vil War site; for Civil War buffs coming in from widely scattered locales; for young people excited about seeing a page from history past colorfuDy broupt visuaUy to life, and for the soldiers themselves, Union and Confederate, who donned authentic uniforms and lived military Ufe as closely as possible to what it was a century and a</p>
        <p>CHECK BAYONETS - Union soldiers check bayonets as part of the preparations being made for a battle re-</p>
        <p>i</p>
        <p>enactment Mgagement later that day against Confederate foct. '  '</p>
        <p>KnownoRksaUy^ttefintHistor- ic Hamilton and Fort Branch Re-enactment (^ebration, the event is one jbat spommrs {dan to stage as an amraal occasion.</p>
        <p>The celebration was centered mainly at a tree-enclosed open area at Fort Branch, where the earthworks ramparts are still visilde on a bluff overlooldng the Roanoke River about three miles east of the historic village of Hamilti.</p>
        <p>It was 1^, in this cleared spa^ adjacent to the ramparts, that men in the uniforms of Confederate and Uni( siddiars turned out fw drills, periled Me in the rouf^ in tents.</p>
        <p>They cleaned weapons, discussed tactics with each other and with visitors, relaxed with clay pipes of tobacco. Men representing both sides came as frienos, not as foes. Re-oiactment persimnel, men dedicated to the late 20th century art of miUtary re-enactments, discussed the fine points of battle planning and tactics, the merits of weapons and ^p-ment. On occaon, the melodies of mid-19th century songs were heard. More frequently there was the sound</p>
        <p>er^!^ ing inspected.</p>
        <p> thrn^igh</p>
        <p>venirs and proce^from a contem-pora^ southffn pork feast, a pig picking.</p>
        <p>In downtown historic Hamilton, visitms had the oroortunity to tour some of the village s fine old buildings, to attend a memorial service at an early tovm cemetery, and to dance to the UW^ of  Regiment</p>
        <p>String Band.</p>
        <p>All in aU, this first venture was a success, with more than 3,000 visitors showing up.</p>
        <p>Aside from the varied pleasures afforded, the celebration served as a means of raising funds to continue restoration of the fragile earthworks</p>
        <p>The Nov. 14-15 weekend celebration at the rural riverside locale of Fort Branch in Martin County revived f(Hul memories of those who ^rew up in tlw Poplar Point Community east of Hamilton in which the Civil War fwt is located.</p>
        <p>For long years, until the dramatic discovery, ownership controversy and eventual removal of Civil War cannon from the turbulent Roanoke River in the summer of 1977, the existence of the fort was little known except to locals and Mficials M the N.C. Division of Archives and History.</p>
        <p>Intte centiury plus span of time between the end (tf the Civil War and the</p>
        <p>___  ^  aUa  IvMAUfvk  HionAh  MtnfitfhA/l  fi</p>
        <p>RELAXING - Charlie Ginn, a re-enactment participant, relaxes with a clay pipe smoke.</p>
        <p>.M</p>
        <p>lainedapiace frequently, it</p>
        <p>I favorite spotmr community fishermen to park, to clamber</p>
        <p>i&amp;gt;The c^e of cleared ground was ideal as a picnic site for student groups from the nearest high s^l. Oak City. On dark or moonlight autumn or spring nights, outdoor fires for weiner roasts threw flidmring shadows against the backdrop of tail pines and sturdy beech trees. Teenager students m the 1930s, 40s and SOs, seated around the bonfires, exchanged tales of what they imagined it was like being a soldier carrying out guard duty in the camp; or</p>
        <p>how it might be miserable in the summer because of mosquitoes and bone-c^ in wmter months when rain or snow felL</p>
        <p>-------  U---J     .yjQgg  QyiJ llJjgly</p>
        <p>sung by soldiers at the fort m the days of ine uvu war - songs such as Be-^ ----- -  -  -  -  -  theBat-</p>
        <p>InvariMy, the atmos^re fostered the sin^ of songs ung by soldiers at tte fort in the days of the uvu Wars&amp;lt; ieve Me H All Those Endearing Young Charms,** **Swanee F ibUc*andTentingTonight.**</p>
        <p>I if ghosts of soldiers buried out-</p>
        <p>The more iinanative youngsters---------  ^  ^</p>
        <p>side the camp of sdiich ouy one grave yet has a gravestone - might be</p>
        <p>......        *  '  ^ spoke of the</p>
        <p>I the hunting</p>
        <p>stching from the possiMUUes of older</p>
        <p> grave yet has a grave) hi|^ grounds or the nnmarts. toe even l w ....jr^osts ^ Indians said to nave once roamed and fishing grounds of the forests and the muddy Roanofea River.</p>
        <p>Women and M delighted in the pink beauty of late April flowering of mountain laurd that grows in abudanoe within the fort - reportedly indigenous due to the particular geological site unusual to eastern North Carolina.  ^</p>
        <p>The Fort Branch site has long been known locally as Rainbow Banks. From the vantage point on top of the bluff, the curve of the Roanoke flowing eastward can be viewed. Across the river, the flat OMnse of the low grounds,a denfaty foresM swamp on the Bertie County aide of the river at a much kwtydm^nn than flmhiiK, is dart  &amp;gt;</p>
        <p>Today, ie situation has changed. While visitors with a serious purpose are still welcaiyie to visit the Fort Branch site, efforts to nneerve the fragile earthworks have made it necessary to dlsoourage the kitid of random visitation that provailed in past years. (Anyone wishing to vis|t are to call 793-3611 ffufke arrangemints),  ki</p>
        <p>,, 11fort property,jpiivtoty&amp;lt;wned by Henry and Naw^Vinstow, has been I,, offered to tb state. Sbtoltols ha^</p>
        <p>* when restoration has heen extensively planned and</p>
        <p>a the property toa more ad-</p>
        <p>FIELD COLOR *- Confederate soldier IHck Armstrong itads with gnn in hand watting for hutrncUon during early morning drills. Confederate and Union troops held drUb In preparation for skirmbhes at Fort Branch later</p>
        <p>vanced stage of readiness.</p>
        <p>/ The recovered cannon, housed in a buUding at the ^te erecb^ by the Winslows, contains ie cannon and other artifacb raised in 1977. The pie&amp;lt;</p>
        <p>DRILL PRACTICE - Denny Best stands with rifle at ready daring drill  -----------    ------------ Federal lilvate</p>
        <p>thatday,</p>
        <p>Winslows contains the cannon and other arutacts raiseu m vin. ine pieces ukill PKAtritK  uenny uesi sunos wiu ruie ai re; underwent a long period of supervbed rsstoration in downtown Hamilton and  practice at Fort Branch near Hamttton. He was portraying a</p>
        <p>aronowonpermanentloanfromthSstalilotlispeopteofMartinOounty.  daring the Civil War re^nactnont held there last weekend. </p>
        <p>...... </p>
        <p>. ri    .</p>
        <pb facs="00096780_0078" />
        <p>D.2 The Dally Reflector. Greenville, N.C. Sunday. N&amp;lt;wmt&amp;gt;r22.1987</p>
        <p>Special Aquarium Exhibit</p>
        <p>171</p>
        <p>PINE KNOLL SHORES - Threatened and endangered sea turtles will be featured in a new exhibit opening today at the North Carolina Aquarium at Pine Knoll Shores, five mues east of Atlantic Beach.</p>
        <p>Titled **The Loggerhead Oi the exhibit has made . by a $22,500 contribution by the Carolinas Chapter (tf Safari Club In-ternatiwial, based in Charlotte.</p>
        <p>Hie aquariums have long been involved with turtles along the Nrnth Carolina coast - monitoring nesfinffi, responding to strandings, its i^bilitation efforts, countless . education programs and tag and ^release programs, said N.C. Deartment of Administration Secretary Jim Lofton. Hiis new exhibit win be the first of its kind to provide the public a closemp look at these</p>
        <p>: TOOTHY BABIES  These baby American crocodiles are a proud additon ;to the existing zoologici coilectimi of minre than 3,300 animals at Tampa, iFloridas Busch Gardens.</p>
        <p>A Review</p>
        <p>A Trillin Collection</p>
        <p>The states three aquariums are located on Roanoke Island, Fort Fisher and Pine Knoll Siores.</p>
        <p>The Safari Club and the aquariums share similar goals, said Paul Thompson of the Safari dub. We are delighted to assist in promoting our mutual i interests - the promotion of fellowship among those who love the outdoors and the sport of hunting, the conservation of wildlife and emicatiQoal efforts relating to our natural herit Hie exhibit at include live hatchlings aquariums. Visito' portunity to see a cut-away view of a turtle nest showing hatchlings emerging from the sand and to feel tte skin and shdl of a mounted 300-pound turtle. An assembled skeleton m a five-foot turtle will show the internal anatomy of these large sea creatures.</p>
        <p>Established in 1976, the aquariums were designed to promote awareness, understanding and ap-</p>
        <p>Sreciation for North Carolinas iverse coastal resources. Hiey are the most-visited state-maintained facilities and have logged more than (me million visiUffs since January of</p>
        <p>Knoll Shores sea turtles, adults in have the op-</p>
        <p>^ IF YOU CANT SAY SOMETHING ^CE. By Calvin Trillin. Hcknor &amp;amp; ^Us. 257 Pages. $16.95.</p>
        <p>i</p>
        <p>t Ever lie awake nights wondering ;where all the chicken a la king went?</p>
        <p>- Calvin Trillin has. Ever since it icame to him that, There was a time r- in the 1950s say  when the whole country seemed to be</p>
        <p>m</p>
        <p>chicken a la king. He doesnt wonder any more because he has postulated a theory. It goes that the</p>
        <p> Annual Sale ' Of Art At ECU</p>
        <p>r The annual School of Art Student Chitotmas itoow and sale will be held in Jenkins Fine Art Center on Dec. 3, 4 and 5. Thursday and Friday hours are 8 a.m. to 7 p.m. and on Saturday !rom9a.m.to2p.m.</p>
        <p>Student groups represented in the show/sale wUl inclum the Ceramics QiM, Disign Associates, Craftsmen East, and Art Education and Scidpture Groups.</p>
        <p>Works to be available encompass pottery, sculpture, weaving, T-shirts, cards, jewelry, and other handcrafted objects.</p>
        <p>For most normal children, hearing is most acute at about age 10. It takes about 30 to 40 years bef(e any noticeable change occurs. Higher-pitched sounds fade first. But many peofde in their 70s and beyond retain the abili^ to hear conversation at a normalpitch.</p>
        <p>Beautiful CLEANING . in your HOME or BUSINESS</p>
        <p>governmoit has the chicken a la ^ stored somewhere  in huge silos, maybe, or in those salt caves in Kansas where they keep surplus rutabagas and old Army moniing reports or Nehru jackets. Ive bren wondering few a l(mg time where all the Ncmru jackets went.</p>
        <p>With a mind that works like Trillins turning out the ^licious essays gathered together in If You Cant, etc., even the most humorless reader wUl wipe the lai tears friHn his jaundiced eyes as happily turns these pages with a song In ms heart. '</p>
        <p>Not an idle phrase, since music is dear to Trillin s heart as he explains in Doing My Talent, a nostalgic sigh for the days when a person could earn respect and maybe even renown for, say, playing the William Tell Overture on his teeth. Which ought to he easy for a man who claims I can whistle and hum at the same time. Its not a trick; its a talent.</p>
        <p>Trillin also, as readers of his mrevious Ixxrics know, has a talent f(n: food and, as such, admits, I was relieved to find there were still some pigeons left in the squares of San Francisco; it had occuired to me that since my previous visit, every last one of them might have been snatched up, smoked, and thrown on a bed ofraiticchio.</p>
        <p>Only nice things can be said of this Trillin collection.</p>
        <p>PHH. THOMAS AP Books Editor</p>
        <p>They are men year-round Mondays urough Imdays fnmi 9 a.m. to 5 p.m. and on Saturdays and Sundays from 1 to^p.m. Beghming Jan. 2, the aqpiariums will expand Saturday hours to 9 a.m. to 5 p.m. Admission is free.</p>
        <p>Flag Design Competition</p>
        <p>WASmNGTON, N.C. - The Pint Washington Association and the Beaufort County Arts Council are cosponsoring a contest for an original flag dreign for the dty of Washington.</p>
        <p>Deadline for submitting entries is Jan. 15,1988. The winning entiy wUl receive a first prize of $300, with $100 each awarded to the two runner-ups.</p>
        <p>Flag designs will be judged by the Washington City Council and representatives of the N.C. Arts Council.</p>
        <p>Entries must be submitted on il-lustation board or beaverboard. The design should measure at least eight inches by 12 inches. Tliere is no limit on the number of entries per person, and the contest is open to peo^ both in and out of Beaufort County.</p>
        <p>For more information, call 946-2504 or97&amp;amp;6893.</p>
        <p>The hollow, nectar-sucking tongue of the hawkmoth is the longest in the insect world ~ im to 10 inches, says National Geograpbic World.</p>
        <p>CARPET</p>
        <p>Deop cleaning, dry-foam method revives original beauty. Dirt is removed.</p>
        <p>FURNITURE</p>
        <p>Beauty restored using dry-foam. Embedded dirt and hidr stains removed. Safe for delicate fabrics.</p>
        <p>WALLS</p>
        <p>And ceiiings. Paint and washabie waii cover irigs iook like new.</p>
        <p>Complato ctMntng using Istnous VON SCHRADER xlraclors. No muss. No o&amp;lt;&amp;gt;or. Uts ssmo day. Satisfaction guaranleod. tor Itaa ostlmata.</p>
        <p>Dons A Pius Cleaning Services</p>
        <p>Old Creek Rd., Qreenville</p>
        <p>758-4437</p>
        <p>Open House</p>
        <p>and</p>
        <p>Jewelry Show</p>
        <p>Sunday, Nov. 22 from 1:00-6:00</p>
        <p>0 special shmuiMg oi ^andotafited Stenfiuig St&amp;amp;/en ^luefoy. baui(iu( gt^ts. teikesiimeats, and a ohauimg jok 0 (jHeeOanta (&amp;gt;g ?om Ciakk. Come log and have a st{) oi kot mufified cuku and join the iun.</p>
        <p>No purchaM nocassary. You do not hava to ba pra-sant to win.  ^</p>
        <p>fandalfs</p>
        <p>distxfver (be npgic!</p>
        <p>Open Dally til 9 pm Sunday 1:30-5:30</p>
        <p>Iff *</p>
        <p>PCHPOURM</p>
        <p>POTS</p>
        <p>$088</p>
        <p>/lip</p>
        <p>Of 4</p>
        <p>SlinllarTollliiMMIon</p>
        <p>...I</p>
        <p>$100</p>
        <p>WOOD SHAPES</p>
        <p>AND</p>
        <p>EXCEI5IOR a'if/7'</p>
        <p>Wreaths</p>
        <p>WOODEN wows</p>
        <p>33* 44* 66*</p>
        <p>LARGE LEHERS</p>
        <p>37^/sfi</p>
        <p>SMALL LEHERS</p>
        <p>BEARS WITH HEART CHILDREN WITH HEART* WITH PEG FOR HANGER</p>
        <p>IBa__</p>
        <p>CHALKBOARDS</p>
        <p>2x2....................37*</p>
        <p>3x3....................57*</p>
        <p>'4x4....................66*</p>
        <p>4x5....................77*</p>
        <p>4x5  .........  88*</p>
        <p>Witt</p>
        <p>&amp;gt; - RUG BEATERS</p>
        <p>FORWAU</p>
        <p>DECOR</p>
        <p>4-INCH</p>
        <p>WIRE HEART</p>
        <p>PerRuHttng</p>
        <p>66^</p>
        <p>CANDLE CUP REGULAR SIZE</p>
        <p>23*</p>
        <p>* MINI-CANDIE SIZE</p>
        <p>5.M</p>
        <p>(22&amp;lt; EACH)</p>
        <p>00</p>
        <p>PLASTIC</p>
        <p>PAINT</p>
        <p>DOTTERTOOL</p>
        <p>FOR INSTANT COUNTRY DESIGNS</p>
        <p>MOQWING BYES 28*</p>
        <p>PK6.</p>
        <p>00</p>
        <p>SIWAUSS* LARGE 88*</p>
        <p>FOLK ART PAINT</p>
        <p>$]15</p>
        <p>ARTBT BRUSHES DISCOUNT PRICED</p>
        <p>THE</p>
        <p>607 OrMiwilto Blvd.  (Beside FamiFrMh)</p>
        <p>OpmiEvreyOtyTUIPM SundtylHIIPM ,</p>
        <pb facs="00096780_0079" />
        <p>V</p>
        <p>s.i-V I J%-</p>
        <p>Aa % r</p>
        <p>WEAVING ART - After five years in exile, a returning refugee builds a new house, employing the ancient art of weaving cane and thatch in Nobila, Guatemala. The returning Mayan Indians are finding the guerilla war and violence they fled has left deep changes on their highland homelands and their tradition-bound way of life. (AP Laserphoto),</p>
        <p>Book News</p>
        <p>FROM SHEPPARD MEMORIAL LIBRARY</p>
        <p>BySUSANNEH.LONG</p>
        <p>Sheppard Memorial Library Childrmis Room offers a non-fiction section for those adults who care for or work with children. Updating the parent-interest collection are a number of books addressing specific chudreanng circumstances, including the double role experience of working outside the home and nurturing children.</p>
        <p>The Nurturing Father, by Kyle D. Pruett, M.D., is a timely book dealing with a modem parent phenomenon, the fathmr who is directly and intensely involved in his childrens day-to-day lives in a shared or leading role as caregiver. Information in this book challenges long-held assumptiims about roles of primary caregiving mother and come-and-go father, proving that fathers have a profoundly nurturing effect on the lives of their chddren.</p>
        <p>Many of the men involved in clinical child psychiatrist Pruetts study were stay-at-home fathers, raising children or playmg a majw role in childrearing while mothers went to work outside the hoiiie. Pruett shows that where fathers assume a grater share of the traditional mothers role of car^ving, benefits for the children are great.</p>
        <p>Active father involvement correlates positively with the childs greater self-esteem, sexual identity, cognitive growth, and social relatedness. The males usual playful rouglihouse style encourages curiosity and fosters fiie childs sense of mastery over the outside world. 'The Nurturing Father supports those men who have begun to face their roles in todays changing family structure.</p>
        <p>Meeting many of the small crises of parenting with warm, sympathetic advice is Eda LeShan, author of When Your Child Drives You Qrazy. l^han examines thoroughly the anxiety-producing situations of childreai^, addii^ for interest anecdotes from her years spent as motho*, teacher, and child-raising authority.</p>
        <p>Most appreciated is LeShans campaign against parental guilt as an unnecessary burden lugged around by so many of todays working or super-conscientious parents, who have best intentions but veiv little free time.</p>
        <p>She counsels parents in the art of reading behavior, spotting a hidden agenda in the anxieties of childhood, where so often Uie real reasw fw a problem or upset is concealed. LeShans practical and personal style is enjoyable as she tells how to cope with the tnals and find time for the delights of raising a child.</p>
        <p>Potry Competition Listed</p>
        <p>FAYETTEVILLE - Writers Ink Guild in conjunction with the Fayetteville Museum of Art is sponsoring the ninth annual Fields of Earth poetry competition.</p>
        <p>ca</p>
        <p>Poetry</p>
        <p>will be juried in five  love, nature, religious/ ^ itional, humor and open. The maximum number of poems allowed by eadh contestant is tturee in each of the five categories. Poems are not to exceed 24 lines and must be original</p>
        <p>for entries is Dec. 15. Winn^ .will be notified and asked to read their winning entries at a symposium at the Fayetteville Museum of Art on two Sundays, Feb. 7 and 14,</p>
        <p>For more details, including entry fees, write to: Sam SUva, Coordinator, c/o Writers Ink Guild, P.O. Box 53841, Haymount Station, Fayetteville, N.C., 28302.</p>
        <p>Thoi^itfully ialRr</p>
        <p>Hame</p>
        <p>Something special for those special places in your home is what youll find at Selections. From the elegance of aciylic, brass, pewter and silver to unique clocks and prints, youll discover that each item at Selections is hand chosen for your discriminating tastes.</p>
        <p>Selections is careful to choose only the most unique and exquisite accessories. For something thoughtfully special for your home, or for a gift for someone that holds a special place in your heart, come see us.</p>
        <p>Bridal Registry Now Available</p>
        <p>nLJ'</p>
        <p>lOICNS</p>
        <p>I J Fine Accessories For The Home</p>
        <p>Moa.-Frl. 9 .m.-S p.m. Sat. 10 a.m.-2 p.m.</p>
        <p>1805 Charles Boulevard, 756-7218</p>
        <p>SHOPEZE</p>
        <p>. a.</p>
        <p>BUYERS MARKET-MEMORIAL DRIVE</p>
        <p>FIRST OF THi WIEK BONUS "CASH" SAVINGS  </p>
        <p>PLUS EVERYDAY LOW PRICES IN ALL OUR DEPARTMENTS NOVEMBER 22-WE GLADLY ACCEPT WIC VOUCHERS A USDA FOOD STAMPS. NOVEMBER 25, 1917 QUANTITY RIGHTS RESERVED. NONE SOLD TO DEALERS.</p>
        <p>GRADE "A"</p>
        <p>SELF-BASTING</p>
        <p>TURKEYS</p>
        <p>I</p>
        <p>lS-22 LB. A Q AVfRAGE   #  LB.</p>
        <p>LIMIT I WITH S10.00 ORDER</p>
        <p>59</p>
        <p>12-18 LB. ^ ^ ^ AVERAGE  "  lb.</p>
        <p>smSkId ham . ......99*</p>
        <p>SMOKED HAM *1.09</p>
        <p>NY SAIY 01D FASHKWm"</p>
        <p>CORN HAMS...  MMullU. I</p>
        <p>WHOUKANIiTCin</p>
        <p>COUNTRY HAMS. D. r m</p>
        <p>GMK "A"</p>
        <p>TURKEY BREAST</p>
        <p>SWAIINIT</p>
        <p>AViMN</p>
        <p>SUCED BACON</p>
        <p>1A0Z. .... KG.</p>
        <p>*1.65 *1.09. *1.29</p>
        <p>**W. alao hav. Buttarbail Uirtwya, ducfca, hma, fraah hama, oyat and othar Hams to fill your holiday OMda.  '  __</p>
        <p>BOUNTY</p>
        <p>TOWELS</p>
        <p>ALL COLORS 1 ROLL</p>
        <p>mnmummk</p>
        <p>CREAM CHEESE</p>
        <p>AUBfmCROaiR</p>
        <p>CAKE MIX...</p>
        <p>POCAHONTAS GOLDEN WHOLE KOHEL A CREAM CORK tCUTGREEHBEAHS... .1602.</p>
        <p>RETNOLK</p>
        <p>WRAP</p>
        <p>9^ 69</p>
        <p>...... 19 02.  m</p>
        <p>3/n,oo _ 59*</p>
        <p>MARTINDALE</p>
        <p>YAMS</p>
        <p>79</p>
        <p>inRAVOR</p>
        <p>aifr</p>
        <p>raODLANO</p>
        <p>aUNBERRT SAUCE</p>
        <p>JEIUEO</p>
        <p>   .300 CAN</p>
        <p>MUMMY PIAM ASaFBMIG</p>
        <p>*1.09 49*</p>
        <p>FLOUR. ............79*</p>
        <p>iiMiv I wmi $10.00 onn,</p>
        <p>MMCANHINO  C  "I  1  fl</p>
        <p>ns FROSTINGS........*1.19</p>
        <p>AUMXHCRYSYAl  _  .  ^  ^  ^</p>
        <p>sipts a 2/*l .00</p>
        <p>PiPSi, DIET &amp;amp;  AA&amp;lt;</p>
        <p>BROCCOLI..........I*"" ^1 29</p>
        <p>SWEET POTATOES.... 4  00</p>
        <p>COLLARDS............ ..49</p>
        <p>CRANBERRIES . '1^ 99</p>
        <p>COCONUTS.............49</p>
        <p>ORANGES  .......M.19</p>
        <p>CELERY................39</p>
        <p>),</p>
        <p>LESUEUR</p>
        <p>17 oz.</p>
        <p>LANOO'LAIES</p>
        <p>BUHER.......</p>
        <p>OCEAN SKAY</p>
        <p>CRANBERRY SAUCE</p>
        <p>lAKirS ANGU HAII</p>
        <p>COCONUT</p>
        <p>PEAS</p>
        <p>59*</p>
        <p>M.99 59 99</p>
        <p>WHOUOIjaUD   300  CAN</p>
        <p>14 02.</p>
        <p>STOVE TOP STUFFING</p>
        <p>CNKXEN A CORNMiAO      6 02.</p>
        <p>CKlSCO</p>
        <p>89</p>
        <p>SHORTENING</p>
        <p>sq.99</p>
        <p>LIMIT I WITH SIO 00 ORDER</p>
        <p>MAMA Vi%</p>
        <p>LOWFAT MILK.....</p>
        <p>on MONTE</p>
        <p>PINtAPPLE SYRUP &amp;amp; JUICE PACK..........</p>
        <p>J/99*</p>
        <p>nj9</p>
        <p>79*</p>
        <p>BROWN N' SERVE</p>
        <p>ROUS.</p>
        <p>COOL WHIP</p>
        <p>pRRin</p>
        <p>PIE SHELLS</p>
        <p>Treat yourself to Sunday lunch at the Foodland Deli. Sunday Specials are Baked Ham or Turkey &amp;amp; Dressing. Served with 2 vegetables, rolls, small tea or coffee. $2.95. Serving me: 11:00a.M. to 3:00 P.M. 12 Piece Bucket of Chicken, $6.89, dinner roll Included. We will be open until 1:00 WeNI. on Thonktglvlno Doy</p>
        <pb facs="00096780_0080" />
        <p>S.V - 'iV</p>
        <p>PER MARKETS, IN</p>
        <p>'^Whn Shapphig ls;A Pleasure"</p>
        <p>' Wf RtMTW TIm Right tp UmH CkMntltlM.'  ,,</p>
        <p>'IKhXeSiifrPobdSlMn^  'ifi222252J5SSr</p>
        <p>WEDNESDAY,,CAg&amp;lt;&amp;gt;UN4 SELF-BASTING</p>
        <p>OR SHANK</p>
        <p>SMOKED</p>
        <p>, NANIS</p>
        <p>k $ f09</p>
        <p>IWASHINGTON STATE EXTRA FANa</p>
        <p>1 ^</p>
        <p>LARGE FRESH</p>
        <p>CRISP CELERY</p>
        <p>39^</p>
        <p>BUNCH m . .1</p>
        <p>FRESH</p>
        <p>CRANBERRIES</p>
        <p>12 0Z.BAG</p>
        <p>091</p>
        <p>.nus</p>
        <p>I YOUR CllSti</p>
        <p>&amp;gt;i</p>
        <p>PARADE</p>
        <p>.'H- VJ</p>
        <p>IP,' '.J</p>
        <p>: :ll</p>
        <p>k t-1</p>
        <p>H A </p>
        <p> 'v:y,|</p>
        <p>; MGRADEA</p>
        <p>fRESH TURKEYS</p>
        <p>t # </p>
        <p>BHF'    .  i-i</p>
        <p>i'-r</p>
        <p>r</p>
        <p>(10 LBS. AND. UP)</p>
        <p>PEPSI, ' DKTPEPSI MOUNTAIN DEW</p>
        <p>LITER</p>
        <p>V.</p>
        <p>LIMIT</p>
        <p>{  A</p>
        <p>IT *</p>
        <p>CAROLINA DAIRIES</p>
        <p>BiTnRMLK .........liOAiTT</p>
        <p>KRAFT  UB.  IRQC</p>
        <p>PARKAY MARRARME.........-</p>
        <p>KRAFT PHttKDELPHIA  QftC</p>
        <p>CREAM CHEESE............... oz. 99</p>
        <p>MERICO  ^</p>
        <p>BUTTER4AE4IUT BKCMTS.. .*.5 ok. MIOQ</p>
        <p>SUNNYSIDE GOLDEN NUGGET'  M B?C</p>
        <p>WMBO BROWN fUUS..........^</p>
        <p>BROOKFIEUIBIIflER........., .w*. ifCRANBEMY SAa</p>
        <p>(LIMIT 3)</p>
        <p>HARRIS' MADERITE</p>
        <p>BROWN AND &amp;gt;f$1 SERVE ROLLS ...I I</p>
        <p>STOVETOP</p>
        <p>TURKEY</p>
        <p>STBFFHIO</p>
        <p>    6 OZ.</p>
        <p>90</p>
        <p>WHEAT TNMS. lEim OBOANS. TRKCNTS OR MTZ MIS........</p>
        <p>16 OZ.</p>
        <p>PREMIUM</p>
        <p>NABISCO SALE</p>
        <p>I</p>
        <p>S|39</p>
        <p>W</p>
        <p>$129</p>
        <p>I '</p>
        <p>SALIRRS</p>
        <p>REOUUR.</p>
        <p>LOW SALT OR  UNSALTID 16 OZ.</p>
        <p>ONESEMPS OR PIZZA MPS   sUOZ.</p>
        <pb facs="00096780_0081" />
        <p>1</p>
        <p>tonOittftnvIH. N.O.  Sunday, November 22 1987 Q-S</p>
        <p>^MPPPi l^ORf 9N\,</p>
        <p>" V ,;H  ;  .</p>
        <p>AU</p>
        <p>XOU</p>
        <p>.r 4</p>
        <p>ROUS.</p>
        <p>llalr.K BUTTIRFLAKi ROLLS ( a.) OR</p>
        <p>'f'</p>
        <p>HALF r CAKES  b iayhi</p>
        <p>(OERMAN CHOCOUn, CARROT CAM WITH CREAM biCE CAKE WITH CARAMEL BUTTERCREME ICING)</p>
        <p>- 4 * ' , .</p>
        <p>HI</p>
        <p>9*.</p>
        <p>Si</p>
        <p>HOLE OR SHANK HALF^i</p>
        <p>com urn</p>
        <p>29</p>
        <p>LB.</p>
        <p>mES</p>
        <p>LB.39</p>
        <p>:^CAL SWEET</p>
        <p>POTATOES</p>
        <p>|IH.</p>
        <p>'for</p>
        <p>n</p>
        <p>lAUniRPOSfYBIAWONMHIS</p>
        <p>3LB</p>
        <p>BAG</p>
        <p>59</p>
        <p>M MADE nnM!</p>
        <p>POCAHONTAf</p>
        <p>WHOLE SWEI POTATOES</p>
        <p>CRISCO</p>
        <p>SHORTENING</p>
        <p>
        </p>
        <p>UMIT1</p>
        <p>MT. OLIVE</p>
        <p>SALAD</p>
        <p>CUBES  ...</p>
        <p>$119</p>
        <p>MYNOLDS WRAP</p>
        <p>3T.S'IX1RA HEAVY DUYY</p>
        <p>
        </p>
        <p>94</p>
        <p>37.5'</p>
        <p>HEAVY DUTY</p>
        <p>
        </p>
        <p>99</p>
        <p>2S'</p>
        <p>STANDARD FOIL</p>
        <p>
        </p>
        <p>2fil</p>
        <p>00</p>
        <p>E OR SHANK HALF</p>
        <p>PEANUT CITY ONMTRYHAMS</p>
        <p>59</p>
        <p>LB.</p>
        <p>SLKEOlt</p>
        <p>B mmtamm</p>
        <p>$|79 </p>
        <p>ALL 6 PACKS</p>
        <p>HERSHEY'S</p>
        <p>10 PACK</p>
        <p>REESE CUPS</p>
        <p>WmooJir</p>
        <p>2 LITER</p>
        <p>99</p>
        <p>BANQKT PWVKM OR NUIICE PKS.woz</p>
        <p>AU OALUNIHAVORS</p>
        <p>99</p>
        <p>AU ^ OALUNIHAVORS  C  JiAD</p>
        <p>RREYERS AU NATBRAL KE CREAM.. 9ARADERR0CC0US9EARS.. ..iqoz.3P1</p>
        <p>9ARABE PM SKLLS........  .iface2P1^</p>
        <p>PARADE WMPPED nPPRW... ro&amp;lt;2P1^ PET RnZ DEEP MSR PR SROLS... .iPAdl99* PR WNM WIHPPED lOPPMD..... .roz.59*</p>
        <p>3^5=-</p>
        <pb facs="00096780_0082" />
        <p>Varied Items In Octdber Issue Of</p>
        <p>By:PEGGYHOWE N.C. Department Of Coltnral Resources RALEIGH - The October issue of The North Carolina Historical Review offers articles about fwople mid evmits from three centuries of the Tar Heel states hisUnry.</p>
        <p>North Carolina played an important role in the wntinig and ratification of the United States Constitution. In time for the bicentennial celebra</p>
        <p>tion of the adoption of the document, Louis W. Potts, associate professor of history at the University of Missouri-KansasCity, has written the prize-winning Hugh Williamson: The Poor Bmms Franklin and the National Domain."</p>
        <p>Williamson was one of North Carolinas three signers of the Constitution and a successful politician, physician, scientist and en</p>
        <p>trepreneur. In his account of Williamsons career, Potts challenges the claim of Forrest McDonald, well-known and controversial schtdar of economic history, that Williamson was a kind of a poor mans Bayamin Franklin who never had opportunity to move in fast enough company to become a rich inanTFranklin/</p>
        <p>Potts argues that as an enlightened</p>
        <p>and ^enterprising pubuc servant, Williamson was a key figure in shaping the federal government and the expansion the new American Republic.  ^</p>
        <p>^Hugh Williamson; The Poor Mans Franklin and the National</p>
        <p>Domain is the winner of the prize awarded by the editors of the North Carolina Historical Review for the</p>
        <p>ON HIS WAY -- SanU and four of his reindeer are coming to Greenville for a visit on Tuesday and Wednesday. At 3:30 p.m. Tuesday, they will arrive in front of Carolina East Mall, where they will remain until 8:30 p.m. They will also be at the mall from 10 a.m. to4 p.m. on Wednesday. The reindeer come from the herd at Operation Santa</p>
        <p>aaus near Redmond, Ore. The average reindeer bull weighs 500 pounds, and the cows range from 250 to 300 pounds. While at Carolina East Mall, Santa will visit children and young and old alike can visit the reindeer in front of the mall.</p>
        <p>A R0fletor Review</p>
        <p>A Book Of Wit, Candor</p>
        <p>. FRIED GREEN TOMATOES AT THE WHISTLE STOP CAFE. By Fannie Flaf^. Random House. 404 Pages. $17.95.</p>
        <p>Youll like the people you meet at Fannie Flaggs Whistle Stop Cafe. Theyre real folks, not cardboard cutouts or literary devices to move aliHig a story line.</p>
        <p>Fried Green Tomatoes at the Whistle Stop Cafe spans a period from 1929 to the present. The cafe, located in a small town near Birmingham, Ala., is owned by Ruth Jamison and Idgie Threadgoode.</p>
        <p>Ruth and Idgie are what some peo-me would call real characters. ^y have their own opinions and attitudes about life. They dont take ordos from anyone, m&amp;gt;t even the local Ku Klux Klan. And hoboes never go hungry; theres always an odd job and a hot meal for anyone who comes knocking at their door.</p>
        <p>Ruth and Id^ have a son (Ruths . child from a failed marriage), Buddy</p>
        <p>Threadgoode Jr., named in honor of Idgies dead brother. Everyone in town calls the boy Stump, the name Idgie gave lum after he lost his arm in a train accidcmt. (Ruth said it w^ a mean thhig to call the boy, but Idgie said it was better to call him Stump to his face than to have people caU him that name behind his back. And Idgie was ri^t.)</p>
        <p>The life and times of Idgie and Ruth and the Whistle Stop Cafe are told by Mrs. Oeo Threadgoode, an 86-year-old resident of the Rose Tor-race nursing home in Birmingham.</p>
        <p>The story is so vividly told that her friend, Evelyn Couch, and the reader come to feel that they actually lived in Whistle Stop and had Ruth and Idgie as friends.</p>
        <p>Fried Green Tomatoes ... is author-actress Flaggs second novel. She writes with witjnonesty and candor.</p>
        <p>CAROL DEEGAN</p>
        <p>Associated Press</p>
        <p>Writers To Meet Tuesday</p>
        <p>The second meeting in November of members of the Greenville Writers Qub will be held at 8 p.m. Tuesday at the home of Helen Parks, 1609 Oaklawn.</p>
        <p>Those planning to attend can meet at 7:30 p.m. at Krispy Kreme Dougnut East Tenth Street, to share rides or get directions to the Parte home.</p>
        <p>The chib is opoi without charge to aqy interested writer. Fiction, nonfiction and poetry are read and critiqued at the meetings.</p>
        <p>The club meets twice monthly at 8 p.m. on the second and fourth Tuesdays of each month, except on the fourth Tuesday of December.</p>
        <p>Although Princeton University student David Stuart is only 21, he has already bera absorbed in the mystery of Maya glyphs for 12 years and is a leding auttunity of Mayan culture, according to National Geographic.</p>
        <p>best scholarly article dealing with NcHTth Carolina in the age of the ratification of the Constitution.</p>
        <p> The moral power of feminism is the subj^t of The Sw(ffd of tiie ^irit: the Moral Reform in North Carolina, 1883-1933, by Anastatia Sims, assistant professor of history at Georgia Southern College.</p>
        <p>EstobUshed in North ^lina in 1883, the Womans Christian Temperance Uni(m (WCTU) was the first major nondenominational female voluntary association in the state, and it remained the largest womens organization for 20 years.</p>
        <p>Sims explains how the union arose as the exponent of the Inherent moral suporiority of the female Sex and an advocate for the prohibition of alcohol and other reforms. She dem-(Mistrates that the WCTU ixrovided Tar Heel w(nen with invaluable lessons in the power of feminine morabty.</p>
        <p>It was the War against sin, she maintains, that forced them out of the sanctuary of the home and into the poUtical arena, where they have ever since remained.</p>
        <p>A number of pho^apbs, pint-and documents illustrate the ar-!. These include a rare postcard view ^ the hatchet-wielding Carrie Nation, the most famous and violent (rf the female temperence activists, as she addresses a crowd in Salisbury in 1907.</p>
        <p> The October. 1987, Review also</p>
        <p>contains the second part of Crises in</p>
        <p>University Governance: The Laun- - -ching of liike University, 1925-1935, CTltjhert F. Dunten, professor of  lustoryatDukeUniversity.</p>
        <p>This final segment discusses the years from 1930 to 1935 and recounts events of one of Duke Universitys' most troubled periods. During that era the institution faced the problems of the Great Depression, inadequate endowment, threats to academic freedom and a dangerously divided system of governance.</p>
        <p>Despite such obstacles, however,</p>
        <p>Duke managed to make great strides toward becoming a mawr research university, and m 1938 it became a monber tite Ammican Association of Universities, the elite organization, of American research universities.</p>
        <p> The North Carolina Historical Review is published quarterly by the Historical Publications Section of</p>
        <p>the N.C. Division of Archives and Ifistory, Department of (]!ultural Resources. An annual subscriptimi costs $20 and includes a years</p>
        <p>subscription (six issues) to Carolina</p>
        <p>C!(Hnments, a bimwitiily commentary a^ut historical activities throughout the state and the po-grams of the Division of Archives and History.</p>
        <p>To subsoibe, send a check payable to the Department of Cultural Resources to the Historical Publications Section (N), Division of Archives and History, 109 E. Jones St., Raleigh, 27611.</p>
        <p>Members of the N.C. Literary and Historical Association receive the North Carolina Historical Review as boiefit membership. For in^ formation on how to join the Associa-ticm, cmitact Jeffrey J. Crow, N.C. Literary aiHl Historical Association, 109 E. Jimes St., Raleigh, 27611; or telephone 733-7442.</p>
        <p>a</p>
        <p>West End Seafood Market</p>
        <p>We specialize in all types of seafood:</p>
        <p>Fish  Shrimp  Oysters  Scallops  Crabs^</p>
        <p>Now Receiving.:</p>
        <p>aSLrs.*?**</p>
        <p>(Steamed Free)</p>
        <p>Also Taking Ordors For Thanksgiving Oysters</p>
        <p>756-6631</p>
        <p>2107 Dickinson Avs. (Next to Piggiy Wiggly)</p>
        <p>FIVE WINNERS... The five winners of the most recent Kash &amp;amp; Karry Gas Game Drawing were presented with their checks in Kinston last Friday. Each received $1,000. They are: Angela Eubanks, Ed Smith, James Earl Boney, W.T. Partan, and Judy Smith. Watch for the announcement of next months winners to be drawn 2 p.m., Friday. December 4,1987, at Kash &amp;amp; Karry #14 In New Bern.</p>
        <p>CONGRATULATIONS TO THESE WINNERS!!!</p>
        <p>\ \ I 11  </p>
        <p>Kash &amp;amp; Karry No. 6</p>
        <p>Judy Smith 311 Gardenia St Greenville, N.C.</p>
        <p>Kash &amp;amp; Karry No. 3</p>
        <p>W.T. Partan 317 Joseph St Greenville. N.C.</p>
        <p>Kash &amp;amp; Karry No. 20</p>
        <p>Angela Eubanks Rt. S, Box 399A Kinston, N.C.</p>
        <p>SALE</p>
        <p>BREYIRS</p>
        <p>PLAY THE QAS GAME - WATCH FOR NEXT MONTHS DRAWING YOU JUST MIGHT BE A WINNER</p>
        <p>5,000.00</p>
        <p>Montlily Drawing</p>
        <p>Np Purchase Necessary (See Game Card For Details)</p>
        <p>You Dont Have To Be Present To Win.</p>
        <p>*777-GRAND PRIZE</p>
        <p>4 Two-Litar Drinks &amp;amp; Chanca To Win $5,000 Plus 3 Gas Game Cards</p>
        <p>*3 OF A KIND</p>
        <p>1 Two-LHor Drink Plus 3 Qas Qame Cards</p>
        <p>*2 OF A KIND(LtffttoRlght)</p>
        <p>16 oz. Fountain Drink Pius 2 Qas Qame Cards</p>
        <p>ALL GAS GAME PLAYERS RECEIVE A CARD</p>
        <p>CREAM</p>
        <p>ALL LAVORS</p>
        <p> CoHect seven of these coupons and qualify for a monthly $5000 Orand Priie drawing.</p>
        <p> Coupons valid at any participating Gas Game merchant</p>
        <p> Rules of the Game available at all participating Gas Game merchants.</p>
        <p>Good Anytime</p>
        <p>HALF</p>
        <p>GALLON</p>
        <p>Qas Qame Only At 15 Kash &amp;amp; Karry Locations &amp;amp; 1 Hatcheli Oil Co. Location, Tarboro, N.C.</p>
        <pb facs="00096780_0083" />
        <p>Crossword By eugene sheffer</p>
        <p>ACROSS</p>
        <p>1 Cereal choice</p>
        <p>SStoiy line</p>
        <p>9 Dogs dog?</p>
        <p>12 Leslie Caron movie</p>
        <p>13 Hitchcock film</p>
        <p>14 Bullfight encouragement</p>
        <p>15 Wide-eyed</p>
        <p>16 Brainstorm</p>
        <p>17 Corral</p>
        <p>18 Word after mud or blood</p>
        <p>19 Buddhist branch</p>
        <p>20 Barbershop call</p>
        <p>21 Common article</p>
        <p>23 Yale player</p>
        <p>25 Got a C, perhaps</p>
        <p>28 Rabble</p>
        <p>32 Islands greeting</p>
        <p>33 Slate source</p>
        <p>34 White</p>
        <p>wntpr</p>
        <p>36 Teapot</p>
        <p>37 Bread choice</p>
        <p>38 Tax collectors</p>
        <p>39 Bon mot</p>
        <p>42 Guitar part</p>
        <p>44 Laugh</p>
        <p>48 Blvd.s kin</p>
        <p>49 Grime</p>
        <p>50 The Terrible</p>
        <p>51 Commingle</p>
        <p>52 Different</p>
        <p>53 Forest &amp;gt;lant</p>
        <p>55 Coffee source</p>
        <p>56 Shade giver DOWN</p>
        <p>1 Spill the beans</p>
        <p>2 Latvian capital</p>
        <p>3 Oodles</p>
        <p>4 Bedtime wear</p>
        <p>5 Valuable</p>
        <p>6 Mine find</p>
        <p>7 Kitchen gadget</p>
        <p>8 Oolong</p>
        <p>9 Vatican VIP</p>
        <p>10 TVs Trebek</p>
        <p>pi</p>
        <p>54 Foxy Solution time: 23 mine</p>
        <p>QIICT^</p>
        <p>acirandiRwra agag</p>
        <p>mm Hissnra ciuna cioQDiH Hn</p>
        <p>anfio</p>
        <p>BDHB</p>
        <p>aBEG aHBB GBQ</p>
        <p>@gaia HBHO-ilS</p>
        <p>Yesterdays answer 11-21</p>
        <p>11 Left </p>
        <p>20 Late work period 22 Impetuous 24 CD pilfer</p>
        <p>25</p>
        <p>26 Chicken  king</p>
        <p>27 Soak up</p>
        <p>29 Make lace</p>
        <p>30 </p>
        <p>Shook</p>
        <p>Up-</p>
        <p>31 Equine command</p>
        <p>35 In second childhood</p>
        <p>36 Mew sayer</p>
        <p>39 Traffic snarls</p>
        <p>40 Diabolical</p>
        <p>41 Voluptuous</p>
        <p>43 Stellar bear</p>
        <p>45 State</p>
        <p>46 Tortoises opponent</p>
        <p>47 Actress Bancroft</p>
        <p>49 Society</p>
        <p>girl</p>
        <p>Horoscope___</p>
        <p>FORECAST FOR SUNDAY Nov. 22 ARIES (March 21 to April 19); Carefully consider your cr^it and car^ situations this morning. This is not a good day to ask favws of mends or im-</p>
        <p>**TAURlS*( April 20 to May 20): Consider the possibility of getting into a n^ and possibly quite lucrative busiiMSS venture. Be cautious of a new acquam-</p>
        <p>^^MINI (May 21 to June 21): Relent your usual stubborness and do what your mate wants today, even though you may not especiaUy enjoy the actm-</p>
        <p>^^MOON CHILDREN (June 22 to July 21): A pubUc mattCT is not workii out as youd like, but take this situation in stride and everything will work out fine GVCDtUdllV</p>
        <p>LEO (Jiily 22 to August 21); Set up a better budgrt to follow at home. Discu^ how you can make a product move faster with a clever business associate tonight.</p>
        <p>VIRGO (August 22 to September 22): Cut conversations wdth c^woreers down to a minimum. If youT mate seems upset this evening, be kind and supportive. Drive careMy.    ^ A </p>
        <p>LIBRA (September 23 to October 22): Be sure your hoine is m go( cnnch-tion, then enjoy an inexpensive entertainment with fnends. Be tactful with</p>
        <p>friends and family.  .  , k -</p>
        <p>SCORPIO (October 23 to November 21); Postpone a httle tnp you ve been planning and work on some necessary home repairs instead. Avoid any argu-</p>
        <p>*sAGITT^iuS (November 22 to December 2U: Safeguard y^ property and possessions during tiie day. Set up a more realistic budget, but make allowances for entertainment.  </p>
        <p>CAPRICORN (December 22 to January 20): You may feel imtable and stifled becuase these are not working as rapidly as you would like. Keep a measured pace and youU be fine.  * * j</p>
        <p>AQUARIUS (January 21 to February 19): You must use more tect and wisdom when planning your day because youre worried about something. Be</p>
        <p>kind to friend.  l  * i *</p>
        <p>PISCES (February 20 to March 20): Attempt to remove obstacles from your path rather than trying to hurdle them. A nosy friend could cause you much trouble this evening.</p>
        <p>(c) 1987, The McNaught Syndicate Inc.</p>
        <p>From The Carroll Rightcr Institute</p>
        <p>FORECAST FOR MONDAY Nov. 23</p>
        <p>ARIES (March 21 to April 19) : If you display your talents to those who are in power, youll get ie recognition you deserve. Approach difficulties fr^ a newan^le.</p>
        <p>TAURUS (April 20 to May 20): Get in touch with successful persons, and follow the advice they give you. Plan a short trip which can bring you many benefits.</p>
        <p>GEMINI (May 21 to June 21): Study up on new business methods which can yeild better profits. Try to find a way to help your mate out of the doldrums tonight.</p>
        <p>MOON CHILDREN (June 22 to July 21): Try to be around prominent pwple you know. They can be of great help now and in the future to your business prospects.</p>
        <p>LEO (July 22 to August 21); If you assume an enthusiastic approach to your work, youll get the approval you need. This can also bring you quick advancement.</p>
        <p>VIRGO (August 22 to September 22): Go out for some amusements with your mate this evening, but han^e a new project which seems very promising early in Uie morning.</p>
        <p>LIBRA (September 23 to October 22): Its a good day to make those im-provments at home which will bring more harmony there. Have friends in for dinner.</p>
        <p>SCORPIO (October 23 to November 21); Study your daily responsibilities and see how they can become more pleasant and profitable to you. Finish up erands youve put off.</p>
        <p>SAGITTARIUS (November 22 to December 21): Dont be so cnventional in hanging practical affairs that youll lose out monetarily. Get advice from a financial expert.</p>
        <p>CAPRICORN (December 22 to January 20): Achieving your personal goals should be uppermost in your mind, so decide on how you can best pursue them. Drive carefully.</p>
        <p>AQUARIUS (January 21 to February 19): If you inform superiors of your ambitions, they can help you attain them. Handle civic and credit maters wisely and without delay.</p>
        <p>PISCES (February 20 to March 20): Youre in a mood for making changes, and this is a good day to do so at home or at work. New contacts will be of help to you.</p>
        <p>(c)1987, The McNaught Syndicate Inc.</p>
        <p>Bridge</p>
        <p>By CHARLES COREN AND OMAR SHARIF</p>
        <p>DRASTIC CURE FOR CRISIS</p>
        <p>CBYPTOQUIP</p>
        <p>11-21</p>
        <p>APPOYA, J DPPU HJT,</p>
        <p>DPC HJAAKYU JTU CEYX</p>
        <p>QKGYU EJ2ZKQX YGYA</p>
        <p>A J O C Y A .</p>
        <p>Yesterdays Cryptoquip: WHY DID ELECTRIC UGHTING COME EASILY TO SMART EDISON? EASY COME, EASY GLOW.</p>
        <p>Todays Cryptoquip clue: A equals R</p>
        <p>Both vulnerable. South deals. NORTH # 10 9 4 2 9 A8 0 KJ9 Q652 WEST  EAST</p>
        <p>OK  0 AS</p>
        <p>9KQ10 52  99763</p>
        <p>0 10 753  0A864</p>
        <p>0973  0 10 84</p>
        <p>SOUTH 0 QJ7653 9 J4 0 Q2 O AKJ The bidding:</p>
        <p>Sooth  West  North  East</p>
        <p>1 0  Pass  3 0  Pass</p>
        <p>4 0  Pass  Pass  Pass</p>
        <p>Opening lead: King of 9 You dont want to take an odds-against line if there is any alternative available. But iiriien nothing else will work, any chance is better than none at all.</p>
        <p>With his red-suit honors of doubtful value, South briefly considered passing his partners three-spade limit raise. However, he correctly judged his sixth spade as being worth taking a shot at game.</p>
        <p>With any lead other than a heart, declarer would have had an easy timehe could have set up a diamond in dummy for a heart discard. The lead of the king of hearts, however, meant South was in dire danger of losing two trump tricks and a trick in each red suit; by the time he</p>
        <p>had the diamond trick set up, the defenders would have the ability to win four tricks.</p>
        <p>Since declarer could not touch trumps without going down, there was just one chanceclubs had to break 3-3 if declarer was to have any hope of avoiding a heart loser. So declarer took the ace of hearts and immediately cashed the ace-king of clubs. He continued by over</p>
        <p>taking the jack of clubs with dummys queen, and when both defenders followed, the contract suddenly became an odds-on favorite.</p>
        <p>The tables good club was led, and the defenders were caught in an unusual coup. If East did not ruff, declarer would discard his heart and West would have to ruff with his trump winner for the defenders first trick; the aces of trumps and diamonds would then be the only other tricks they could get. But East ruffing with the eight proved no bet</p>
        <p>ter. Declarer still pitched his heart. When he regained the lead he could lead a trump, and now the defenders two high trumps crashed on the same trick!</p>
        <p>Available for a limited time as a special offer is a two-for-oae package of DOUBLES booklets. For yoor copies send $3 to GOREN DOUBLES, care this newspaper, P.O. Box 4426, Orlando, Fla. 32802-4426. Make checks payable to Newspaperbooks.</p>
        <p>Need Help Cleaning Your Closets? Sell Unwanted Items Fast! Call Classified 752-6166twrrwHWMUui</p>
        <p>tvE oEQoeo ro RGccmtm QO FDR m ACCELERPriED /VIU5IC OOR6E!</p>
        <p>400 (VIEAM ukb the kind OF music 400 HEAR ON</p>
        <p>car radios ?</p>
        <p>400 WHAT...LET'S forget I EUER BROGMT ITOP.^</p>
        <p>eOT ANY COOK BOOKS</p>
        <p>ear one }</p>
        <p>HoroFF</p>
        <p>TMeFRESSi,</p>
        <p>"OMEriUNPfSgD Afipone WAYS TO STUFFA TURKEY " ....^2,95.</p>
        <p>A</p>
        <p>"TAKE A 16-FOJND^ BOWLING ball AND...</p>
        <p>J</p>
        <p>y</p>
        <p>A BUCK AND A half akdit^^Rs.</p>
        <p>MANVrt</p>
        <p>rtuumAmmn</p>
        <p>HELLO? THIS IS MARCIE..MAY I SPEAK TO CHARLES, aEASE?</p>
        <p>HE JUST CALLEP FROM THE H0SPlTAL..HI65TPP06 HURT HIMSELF PLAYIN6 H0CKEY..U)HAT'SAP06 P0IN6PLAYIN6 HOCKEY?</p>
        <pb facs="00096780_0084" />
        <p>Sunday. November 22.1987</p>
        <p>A HERO  David Praised by the Israeiite Women painted in 1623 is one of the works of art in an exhibition, Saints and Heroes now on view at the North Carolina</p>
        <p>Museum of Art. Raleigh, through the summer of 1988. (Photo courtesy NCMA)</p>
        <p>Saints And Heroes Show</p>
        <p>By SHARON BROOM N.C. Museum of Art RALEIGHSix individuals whose courage and deeds have placed them among the most nipular sub^ts in art are featured in the exhibition Saints and Heroes" at the North Carolina Museum of Art. The exhibition will be on view in the Mary Duke Biddle Education Gallery through the summer of 1988.</p>
        <p>Hercules, (Jueen Esther, King David, St. Jerome, St. Joan of Arc and Martin Luther are all represented in major windis of art in the museums collection. To augment these, the exhibition also includes works (HI loan from other collections around the country.</p>
        <p>For the ancient Greeks and Romans, Hercules was a model of great courage and strength, illustrated by his completing a series of nearly impossible tasks called the Twelve Labors. In a marble sculpture from the museums collection, a second century Roman copy after a Greek original, Hercules is seen with a club and a lion-skin cape, both references to his remarkable feats. Another work from the museum, by Antonio Canova (1757-1822), is a bronze sculpture of Hercules and Uchas.</p>
        <p>A Greek vessel called an amphora, from the sixth century B.C., illustrates one of the 12 labors, in which Hercules killed the Nemean Lion. Another of the labors, in which the hero killed the Hydra, a manyheaded water serpent, is depicted in a bronze sculpture attributed to Adriaen de Vries (c. 1560-1626). This work has been lent by the Cleveland Museum of Art.</p>
        <p>In April, this sculpture will be replaced by a German oronze of Hercules from the early 17th century, on loan from the Allen Memorial Art Museum at Oberlin College in Oberlin,Ohio.</p>
        <p>The Old Testament story of Queen Esther has been a favorite subject of artists. Along with Jan Lievensz nie. Feast of Esther" (c. 1625), a painting from the museums collection, the mdiibiti( includes Esther Kneeling Before Ahasuerus by the 17th-century artist Claude Vignon, lent by Bob Jones University.'</p>
        <p>Also on view will be two objects connected with Purim, the Jewish holiday which celebrates Esthers rescue of th Jews. These are a silver</p>
        <p>Case for an Esther Scroll," lent by Mrs. Margaret K. Norden of Pittsburgh, and a Silver Salver for Purim Use," lent by the Jewish Museum in New York City.</p>
        <p>The life of another Old Testament hero, King David, is illustrated by two works from the museums collec-(Hi: David Praised by the Israelite Women" (1623), a painting by Hendrick ter Bruggen, and David Dancing Before the Ark, a 17th-century German sculpture in silver.</p>
        <p>Also on \Hew will be an 18th-century European Spice Container" from the Jewish Museum and a small br(Hize, David with the Head of Goliath, based on a design by the 15th-century Italian scidptor Donatello, from the Arthur M. Sackler Collection. Two 15th-centi^ manuscript illuminations showing King Davids Vision of the Lord" have been lent to the exhibition by the Ackland Art Museum and will be seen in November through December ami January through March, respectively. Beginning in April, visitors will see a Rembrandt etching of David in Prayer, made in 1906 from an original plate. This work is on loan from Capt. and Mrs. John L. Humber aond Capt. and Mrs. Marcel B. Humber.</p>
        <p>St. Jerome, a fourth-century theologian, is often depicted in art as a penitent in the wilderness, where he endured temptations and torments, or as a scholar in his study. He is almost always shown with a lion, referring to the legend that he removed a thorn from the paw of the great beast and won its loyalty. In the exhibition, Jerome is ^n in two 15th-century paintinffi: 'The Penitent St. Jerome oy Jacopo del Sellaio, lent by the John and Mable Riling Museum of Art in Sarasota, Fla., and St. Jerome in His Study by Stefan Lochner, from the museums collection. TTie exhibition also includes two early 16th-century editions of Vitae Patrum" (Lives of the Fathers), a work attributed to Jerome from the William R. Perkins Library, Duke University; each of these ^ be on view for five months.</p>
        <p>French heroine Joan of Arc was only 16 in 1428 when she was called by (^ to lead a French army against the English invaders. Captured by the English, she was convicted of</p>
        <p>heresy and burned at the stake at age 19. The many representations of Joan in art focus on W piety, innocence and courage.</p>
        <p>In the exhibition, a 17th-century Flemish work from the museums collection shows Joan in armor, kneeling in prayer. The painting is attribu^ to a follower of Rubens. Also included is a small bronze sculpture from the clay working models for a life-size equestrian monument now in New York City. Created about 1915 by the American artist Anna Vaughan Hyatt Huntington, it shows Joan mounted on a war iKHTse, ho* sword lifted toward tlK heaven. This work has been lent by the Archer M. Huntington Art Gallery, University of Texas, Austin.</p>
        <p>Visitors will also see i^otographs from Sera[rfdc Dial(^ (1944), a dance based on Joans life choreographed by Martha Graham, and stilte from two films; Carl Theodor Dreyers The Passion of Joan of Arc (1928) and Victor Flemings Joan of Arc (1948), which starred Ingrid Bergman.</p>
        <p>The life of Martin Luther is illustrated by two paintings and a rare edition of his writii^. Martin Luther (1483-1546) and Philipp Melanchthon (1497-1560), from the museums collection, shows Luther and a fellow religious reformer. It was painted in 1558 by Lucas Cranach the Younger. From the collection of Bob Jones University, a 16th-century German Minting, Allegory on the Fall and Redem^ion of Man,^ illustrates Luthers teachings.</p>
        <p>It is attributed to a follower of Lucas CraMch the Elder. Also on view will be a 1566 Frankfurt edition of Luthers Thesaurus Explica-tionum, with a woodcut portrait of the author as its frontspiece. This woit is (HI loan from the William R. Perkins Library, Duke University.</p>
        <p>Saints and Heroes is made 9le in part by the Z. Smith olds E(iucation Fund. It is accompanied by a gallery ^de, a recorded tour and booklets which repeat tte exhibition wall labels in large type and in Braille, all free.</p>
        <p>Museum hours are 9 a.m. to 5 p.m. Tuesdaj^ through Saturdays, unitl 9 p.m. Fridays, noon to 5 p.m. Sundays, closed Mondays. There is no admission fee. For information, call 833-1935.</p>
        <p>uUowogftam Special</p>
        <p>Lauretta Riggs of **Eastern Monogram Service will be in our retail store on the day after Thanksgiving. Take advantage of this one time opportunity to have Lauretta personalize any regu* lar price purchase from our store with a beautiful monogram at no extra charge.</p>
        <p>Choose from a colorful selection of totes, backpacks, travel luggage, dive bags, snow ski bags, and other recreational carry alls.</p>
        <p>8:00 AM - 9:00 PM Nov. 27th Only</p>
        <p>Parrott Canvas Co. Inc.</p>
        <p>West End Circle</p>
        <p>756-4011</p>
        <p>NunruirsTiiiiiEioPUTiiouR</p>
        <p>MONEY nnOABUIECHIPBANK.</p>
        <p>For 18 &amp;lt;nsecutive months, Bank VWuaon, a firm that evaluates banks for financial safety and soundness, has ranked First Citizens Bank the soundest of the 150 largest banks in America. That means the soundest for savings.The soundest for CDs.The soundest for everything. So instead of putting your money into the stock market, maybe youd be better off putting some stock into what the experts are saying about us.</p>
        <p>FIRST</p>
        <p>CITIZENS</p>
        <p>BANK</p>
        <p>Member FDIC</p>
        <pb facs="00096780_0085" />
        <p>Greenville Museiinn Of Ait Remains Fully Operative</p>
        <p>PAINTINGS STOLEN - A total of 29 pieces of art were taken from an art gallery in Coral Gables, Fla. at gunpoint on Nov. 13. An armed man tied up employees and the owner the gallery with sash cmrd and took the paintings with an estimated value of more than a million dollars. An unnamed Picasso painting, shown hwe, was among three Picasso w(Nrks taken. (AP Laser-photo)  ^</p>
        <p>New ECU Art Group To Meet On Tuesday</p>
        <p>The Art Enthusiasts of East Carolina University established its new board of directors and official name change from Friends of Art to Art Enthusiasts at its initial organizational meeting last week.</p>
        <p>Reflecting the broad based constituency of the membership, the new board consists of members from several eastern North Carolina communities; They are Nancy Jenkins, the Rev, Dan Earnhardt, Dr. Harry Adams, Richard Cox, Mrs. Richard Eakin, Patricia Fuller, Jean Darden, Joe Clark, Enid White and Fayne Graham.</p>
        <p>Also on the board are Carmen Albea, Adele Callaway, Stacy Brody, Marilyn Lancet, Paida Blumenfeld, Perry Nesbitt, Michael Ehlbeck, Art</p>
        <p>By JERRY RAYNOR ReflectorStaffWrtter</p>
        <p>'*Hie word we want to get to the public is that we are continuiDg our programs, our exhibitimis. We most d^tely are not closed, said Rebecca Becky Young, interim direcUw of the Greenville Musmim of Art</p>
        <p>Mrs. Young, who has long been associated with the museum m several capacities, was appointed interim director by the museums board of trustees immediately after the resignation of director Mary Anne Pennington at the end of October.</p>
        <p>With one exception, we are operating in the same fashion as in the past. We are not standing still while the search is being made for a new director, Mrs. Young said.</p>
        <p>The one exception of an activity</p>
        <p>lhat has been put for the time being on the back bumer'ts that of the weekly art histoiy classes that Blary Anne so effectively presented.</p>
        <p>*"I1ie board has under consideration finding the right person, with the proper training and motivation to fill 1 to b^ these inforative and</p>
        <p>and display of items from the permanent collection, the museum conducts a docent training program, the museum in the schools program with material takoi on the Arts Van to classroimis, offers the guest lecturer program, tours (rf the museum fw sd^l dldren and other groups, and art classes, and publishes a monthly newsletter,</p>
        <p>As soon as renovation is completed to the carriage house behind the main musaon tmilding, we once more will be offering our programs for children.</p>
        <p>And of course, Mrs. Young said, I am familiariring myself with the paperwork invirii^ in grants, those already in the mill and those due to beap^for.</p>
        <p>A native of Greene County, Mrs. Young is married to Ahoskie native Dr. James E Young, director of institutional development at Pitt Community College.</p>
        <p>We met vdiUe studying at East Carolina University, and together fell in love with Greenville,^ Mrs. Young said. She holds degrees in English and education counseling, and for a time was chairman of the language arts {s^am at West Craven Hi^ Schod, VanceboD. The couple has two daughters.</p>
        <p>Mrs. Young has been active in church, school. Democratic and musuem activities in Greenville, and is president of the Greenville Museum of Art Docents.</p>
        <p>REBECCABECKYYOUNG</p>
        <p>Mexican Market Life In Full Colors</p>
        <p>Haney, Phil Phillips and Kay Woolard, all from Greenville; Sharon Kanter of Kinston, Lou Proctor of New Bern, Pat Stronach of Wilson and William R. Roberson Jr. of Bath.</p>
        <p>The next board of directors meeting will be Tuesday at 4 p.m. in room 1327 on the third floor of the Jenkins Fine Art Center.</p>
        <p>The agenda includes election of officers and changes in the by-laws to reflect the organizations commitment to outreach and service to nei^boring communities.</p>
        <p>Tiie December 5th Art Auction, planned as the first major fund raiser, will also be discussed.</p>
        <p>For further information about the Art Enthusiasts of East Carolina University call Perry Nesbitt, gallery director at East Carolina University, at 757-6336.</p>
        <p>By CARL MANNING Associated Press Writer</p>
        <p>CUERNAVACA, Mexico (AP) -Dai^ling in a giant net high above the ffiuit and vegetable vendors, the artist in his paint-spattered coveralls carefidly adds a few strokes to what he hopes will become the worlds lareest mural.</p>
        <p>The images are bold and bright. Splashes of reds, yellows and greens in a primitive style reflect the daily life oelow in the citys Municipal Market, a collection of 4,000 vendors under a huge, arched concrete roof.</p>
        <p>For the artist, Jose Silverio Saiz Zorrilla, it is a dream that has been with him since he first walked through the market with a group of friend in 1979, looked up and saw the ceiling. To him, it was a canvas waith^forabrush.</p>
        <p>My dream is to tell the story of the</p>
        <p>nle, for the people. But it can not 9ne without the hel( pie, Zorrilla said as he dabbed paint to the latest of six panels lining one side of the market near downtown Cuernavaca, a fast-growing city 45 miles s(Hithwest of Mmdco City.</p>
        <p>Om of the first problems he had to overcome was the simple mechanics of how to paint a ceiling without</p>
        <p>disrupting the market below with scaffolding. His solution was to erect a giant net to hai^ like a hammock, fasten it to the ceihng with hooks and then lie in it while pamting.</p>
        <p>It took me five years to come up with the idea, which I got by watching them, said Zorrilla, pointing to spiders weaving a web 100 feet above the shoppers.</p>
        <p>The work draws praise from its most constant watchers, the vendors.</p>
        <p>Its very beautiful and gives the market prestige. People come to look and of course to buy. Thats good for us, said Emiliano Medina, who has been selling onions and peppers in the marketfor 20 years.</p>
        <p>Zorrilla started work in 1984 on the planned 38,000-s()uare-foot mural, and hopes to have it completed by the year 2000. The design for each panel first is drawn on paper, then divided into squares and pamted on the ceil-</p>
        <p>Ip of the p^ dabbed paint So</p>
        <p>far, however, he has only been able to complete about 7,200 square feet, working only when he has money to buy paint. The rest of the time, he spends on his smaller paintings or refining his ideas about the giant mural.</p>
        <p>When we have the paint, we can</p>
        <p>work and when we do not have it, we cannot work. It is that simple, he said with a shrug of his broad shoulders.  ;</p>
        <p>Zorrilla first planned to paint a giant border around a centerpiece</p>
        <p>of Mexico ani More^ state, whose capital is Cuernavaca. But after a time, he realized it was too big a project, even for a man with grand visions.</p>
        <p>Now, he said, he plans to complete what will be a border of connecting panels around the outer edge, with each panel measuring about 45 feet by 15 feet. Then, he hopes, artists from throughout the Western Hemisphere will come and each paint a section of the center.</p>
        <p>They would paint their impressions of their world, a collection of the politics and social structure of the Americas, by people of different countries. Truly, it would international, he said.</p>
        <p>The latest panel is nearly finished after four months of work by Zorrilla and his assistant, Humberto Lopez, 40.</p>
        <p>He is as important as me, the artist said. It is my creation, but he helps make it a reality.</p>
        <p>Like the other panels, it shows an aspect of the nuutet life below. In this case, it is the fish vendors, with a giant scale weighing a fish and rows of soft drink bottles in the background.</p>
        <p>Each panel stands as a separate work of art, but together there is a sense of continuity representative of the market.</p>
        <p>Among the images are a ^t serpents head and corn - both intricate )arts of Mexicos ancient Indian leritage, fruit vendors, a woman buying vegetables, soft drink and tortilla vendors and meat sellers.</p>
        <p>Both men devote all their time to their project with me Me d(</p>
        <p>from public donations or smaller paintings in the same style. A two-foot by three-foot painting on wood and framed sells for about $50 which Lopez says is enough to buy paint for two weeks woric.</p>
        <p>Zorrilla has also done a series of 24 erotic paintings that are on sale in the trendy art shops in the Pacific resort of Acapulco, where the asking price is $1,000.</p>
        <p>Its for the crazy people, but they have money, he said.New Show For Francis Speight</p>
        <p>PHUADEIfHU - An exUbitioD of paintings by Greenville artist</p>
        <p>at the  Corner  Jallery  in</p>
        <p>Philadelp^.</p>
        <p>The exnibitim has been assembled and organized by the Taggert and Joregenson Gallery of Washington, D.C., which last year had a major exhibition of Speights work on the occasion of his 90th birthday.</p>
        <p>Dr. Speight, now 91, is considered the dean of North Carolina artists. He and his artist wife, Sarah Blakeslee, have both had woik exhibited in Greenville, throughout North Candina, and naticmwide over a span of many years.</p>
        <p>The exhibit of Speights paintings at the gallery in Philadelphia will be on view through Dec. 9.East Gallery Show</p>
        <p>Eighteen artists will be their work in an exhibit, A crafted Holiday, opening today at East Gallery, 646 Arlin^ Boulevard.</p>
        <p>A reception, open to the public, will take place from 2 to 5 p.m. this afternoon.</p>
        <p>Artists in five categories are displaying examples of their work. These are:</p>
        <p> Paintings  Gaye Fisher, Mary Ellen Golden, Joanie Kennedy, Janet Adkins, Pat Bowers, Kip Gerard, Jadi Lewis, Billie Corder and Ann</p>
        <p>Nancy Sanford.</p>
        <p> Pottery  N(m Czuchra, David Camden, Skip Schlitzkus, Thomas Clarkson.</p>
        <p> Glass  Ellen Dumas, Nourot Studio, Cohn Stone.</p>
        <p>Woodcarving - Stephen Sanford.GMA Trip Set</p>
        <p>The Greenville Museum of Art is sponsoring a Christmas tour of historic Bath as a museum benefit. The trip will take place Dec. 9.</p>
        <p>Cost (rf the trip per individual will be $10, which includes tour tickets, a box lunch with beverage served at Yvonne Deytons home In Bath, and transportation. A time for afternoon shopm ^ ^ included in the itinerary.</p>
        <p>The tour vtrill leave the Greenville museum at 8:45 a.m. with a return at 3:30 p.m.</p>
        <p>Deadline for making reservations is Dec. 1. Payment for the trip must be in band by Dec. 2 to reserve spaces. For more details and to make reservations, call 758-1946.</p>
        <p>Coordinators of this benefit tour are Yvonne Deyton and Peggy Stevens, trustees of the museum.</p>
        <pb facs="00096780_0086" />
        <p>KICKS OFF NEW RELEASE  Tony Bennett sings at New Yorks Radio City Music Hall recently in a performance which kicked off the release of his new CBS album, "Bennett-Berlin. (AP Laserphotoby Ed Bailey)</p>
        <p>Events At St Andrews</p>
        <p>LAURINBURG - Current ac-tivites at St. Andrews Presbyterian CoU^e in Laurinburg include new publications by St. Andrews Press, a show of etching, plans fw an early December mamgal feast and a new program for playwrights.</p>
        <p>:  Publications by the St. Andrews Press include the Nov. 6 release of a new book by Stephen Smith and the upcoming release of short stories by Ruth Moose.</p>
        <p>: Smiths Honeysuckle Shower and ^r Parables, the author said, are interrelated arables that entertwine fiiroughout me book. They can be dead as a novel, or as sej^ate para-</p>
        <p>E. Oriignally from Easton, Md., th is an English instructor at dhills Community College near Pinehurst.</p>
        <p>The new book by Ruth Moose, scheduled fw November, is titled ^fThe Wreath Ribtxm Quilt. Author of numerous stories and poems about the lives and feelings of women in the South, Moose has published over 300</p>
        <p>hibit of award-winning etchings by Anita Jones StanUm. The show, Retrospective 1972-87 - In Memory of Susie and Blackie, is a memorial to her two dogs who both died recently. Stanton lives in Gibson.</p>
        <p>Gallery hours are 9 a.m. to 5 p.m. Mondays through FYidays.</p>
        <p> On Dec. 2 and 3, a madrigal feast will be held in the Belk Main Louise on campus. The evening will include a five-course meal with members of St. Andrews Chorale in the role of rogues and wenches to serve and entertain the guests. The principal event will be a Mummers Play. Deadline for reservations is Nov. 27. For details and reservations, call 27&amp;amp;0563.</p>
        <p>;puc</p>
        <p>po^ in Atlantic Monthly, Redbook, phio Review, South Carolina Review</p>
        <p>^ other piulications. She is refem-</p>
        <p> r ------ </p>
        <p>librarian at Pfeiffer College in Misenheimer.</p>
        <p>;  Currently on view in the Vardell Hall Gallery at St. Andrews is an ex-</p>
        <p> The theater department at Saint Andrews is inaugurating a new program designed to encourage budding playwrights. In coloration with the colleges Fortner Writers Forum and Monday Night in the Arts, a series of public script readings will be held di^ the spring 1988 term. Anyone with a script, one-act or full len^, can submit it to: Janice Burgess, Theater Department, St. Andrews College, Laurinburg, N.C., 28352. Scripts msut be submitted by Jan. 11,1988.</p>
        <p>Statewide Events Listed</p>
        <p>Duck Stamp Program Show Continued</p>
        <p>BEAUFORT  The exhibit, The Duck Stamp Pri^am: Fiftieth Anniversary, (Ml view at the North Carolina Maritime Museum, 315 Front Street, Beaufort, has been granted an extension to have the show up through Jan. 17, 1988. The museum is open weekdays from 9 a.m. to 5 p.m., Saturdays from 10 k.m. to 5 p.m. and Sundays from 2 to 5 p.m. The museum will close Nov. Dec. 24-27 and Jan. 1. For more details, call 728-7317.</p>
        <p>TRAVEL EQUALS JOBS</p>
        <p>NEW YORK (AP) - Travel spending in America directly generated 5.2 million jobs in 1986, paying nearly $58 billion in salaries and producing over 3 billion in federal, state and local tax revenue, reports Travel Agent magazine.</p>
        <p>If viewed as a single retail industry, the travel-tourism sector is the third largest retail industry in business receipts, after automotive</p>
        <p>Free Chamber Recital At ECU Monday</p>
        <p>A free recital by the Instrumental Ensemble of East Carolina</p>
        <p>Chamber</p>
        <p>University will be presented at 9 p.m. ........J. Fletcher' </p>
        <p>Monday in the A.J. Fletcher Recital Hall on campus.</p>
        <p>All the performers are music ma-jore in the School of Music, ECU, exea;^ inanist Alise Wetherington, a lo(^ musician and an ECU alumnus.</p>
        <p>The program will open with three</p>
        <p>Fall Chorale Concert</p>
        <p>The FaU Concert of the ECU Universi^ Chorale, directed by Rhonda neming, will be presented for the public free of charge tonight at 7:30 D.m. in the A.J. Fletcher Recital Hall of the ECU School of Music.</p>
        <p>The program will feature sacred and secular works ranging from William Byrds Ave verum corpus and Brahms Brausten alle Berge to traditi(Mial tunes, spirituals and show tunes, including Aura Lee, AH the Things You Are, and Plenty Good Room.</p>
        <p>Ihe 76 men and women who com-</p>
        <p>textiles, sports medicine, special education, interior desiffn, psychology, counselor eduation, math, English, criminal justice and</p>
        <p>pre-med, as well as music majors.</p>
        <p>Two smaller groups from the Chorale, the Mens Ensemble directed by Ed Pierce, and the Mixed Ensemble, directed by Janna BroMlell, will perform sections of the program.</p>
        <p>Brendell is also assistant director of the Chorale.</p>
        <p>pise ^ Univmity Chorale come</p>
        <p>all areas of the university, representing business, elementary education, theater arts, clothing and</p>
        <p>Soloists Lori McLelland, soprano, and Angela Bums, mezzo-soprano, will be featured in Andrew Uoycl Webbers Pie Jesu. Piano accompanist is Sandi Sullivan, and choreographer is Michelle Bach.</p>
        <p>Percussion Concert</p>
        <p>The East Carolina University Percussion Ensemble, directed by faculty member Mark Ford, will present a free concert Monday, at 7 p.m. in the A.J. Fletcher Recital Hall of the ECU School of Music.</p>
        <p>The p^ormance will feature a wide variety of compositions from to classical percussion. Uhuru Ted Frazeur and Pulse by [enry Cowell will open the concert. Ragtime Robin, transcribed for xylo^ne and marimba ensemble follows.</p>
        <p>The featured work of the evening will be Dancing by David Kechley of Wilmington. The closing selections will be director Mark Fords Head</p>
        <p>Members of the Percussion Ensemble are ECU music students Scott Allen, Dan Davis, Dean Gott-schalk, Clark Harrell, Chris Holliday, Nick Holland, Glen Lilly, Chris</p>
        <p>Moore, Hal Sargent, Sco^ Sells, e, Doug</p>
        <p>Talk and jazz transcription of Dave Grushins ^Mountain Dance.</p>
        <p>Russell Sledge, Doug Walker, and Gary Westbrook with Klee Liles on bass guitar and Jim Gilliam, piano.</p>
        <p>Last year the ensemble made its third invitational appe^nce for the North Carolina Music Educators Conference in Winston-Salem.</p>
        <p>One of the School of Musics select touring groups, they have performed in hi^ schools tturoughout North Carolina and surrounding states as well as at convmtions in ^</p>
        <p>D.C., Tennessee, Virginia, Cante, and Georgia.</p>
        <p>New Plays Being Sought</p>
        <p>MARS HILL - The Southern Ap-palachian Repertory Theater (SART) is looking for new plays. As part of this search, SAR'T has announced the sevoith annual Southern Appalachian Playwrights Conference to be held Jan. 29,30 and 31, 1968.</p>
        <p>Deadline for receipt of scripts to be considered is no later than Jan. 1, 1968. They are to be sent to: James W. Thomas, Southern Appalachian Repertory Theater, P.O. Box 53, Mars Hill, N.C., 28754.</p>
        <p>Up to six playwrights will be</p>
        <p>selected and invited to attend the (XMiferoice to be held on the campus of Mars HUl Collie, 20 miles norm of Asheville.</p>
        <p>To (lualify for consideration, a playwnght is to  have had at least one major play produced by a recogni^ professional, college/ university, or community theater; have had at least one major play published by a recognized publishing company; or subnut an example of his work, which may be the script of</p>
        <p>or</p>
        <p>ms worx, wmcn may ne me scnpt a play previously producecf pubiisned, or a play-in-progress.</p>
        <p>Playhouse Auditions Set</p>
        <p>The East Carolina Playhouse will The La</p>
        <p>Campaign To Save Old Baldy Lighthouse</p>
        <p> BALD HEAD ISLAND - The N.C. General Assembly has appropriated $4,000 to launch a public fund drive for the preservation of Old Baldy, the historic lighthouse on Bald Head Island. The original lighthouse, built in 1792, had to be pulled down because of water encroachment. It was replaced in 1817 by the current structure. At this point in time the drive for funds is for archaeological and architectural studies for preservation in order to stabilize the lighthouse, and not for restoration. For more details, write to: Bald Head Island, P.O. Drawer 10999, Bald Head Island, N.C., 28461.</p>
        <p>hold open auditions for The Lark on Nov. 30 and Dec. 1 from 7:30 to 10 p.m. each of the two evoiings. Aud-nons will be in room 206 in the Messi(dt Thater Arts Center on the East Carolina University campus. The Lark, by Jean Anouilh and</p>
        <p>Acuff Ailing</p>
        <p>adapted by Lilliam Heilman, is the of the French maiden-soldier</p>
        <p>dealers and food stores.</p>
        <p>According to the publication, travel industry sales in 1986 outpaced the gross national product in both real and nominal dollar terms, and employment added 360,000 jobs in the industry for ie year.</p>
        <p>Overall travel prices fell for the first time in the 17-year history of the travel price index published by the U.S. Travel Data Center.</p>
        <p>sUMy</p>
        <p>Joan of Arc, her trial and her death by burning at the stake.</p>
        <p>Roles are avialable for about 30 men and women over the age of 16.</p>
        <p>Scripts are in the Reserve Room of J(&amp;gt;yner Library. Actors are asked to pr^tare a scene or monologue of their choice to audition, or th^ may read a scene of their choice with the state manager.</p>
        <p>Rehearsi^ will b^ in January and will be in the evenings ami on</p>
        <p>NASHVnXE, Tenn. (AP) - Roy Acuff, the kii^ of country music,^ was under doctors orders when he stayed home and missed a formal dinner for fellow Grand Ole Opry star</p>
        <p>BSinnie Pearl, a s^esman says Acuff, 64, was iati{</p>
        <p>Caspian seals migrate from the Caspian Seas northern ice in winter and go south to deep, cool water in summer.</p>
        <p>selections to be Horn Kimberle</p>
        <p>ns to be played by the French Ensemble, comprised of rle Dosher, Paul Francis, Kimberly KeUy, Cheryle Naberhause and Amanda Wise. Hie compositions</p>
        <p>are: Hermann Jeurissons Der Prinz Louis Ferdinand von Pniessen March; Rudolph Mayers Little Pieces consiste of four short pieces, and Lowell E. Shaws Fripperies.</p>
        <p>brass (juintet James Barnard and Michael Stewart, trumpets; Kimberle Dosher, Fnrch horn; Matthew Minick, trombone, and Michael BeU,tuba.</p>
        <p>with Lynn Michael Canale</p>
        <p>A string (uartet comprised of Steve Vuteas and Alex Pappas, violinists, Laura Staubes, viola and Katherine Jetter, cello, will perform Mozarts Quartet in D Bfajor, K. 575.</p>
        <p>A saxophone quartet Booth, John CrabiU.Mic and Kim Turner will play two pieces - the Bach Prelude and Fugue in E minor arranged by Dale W. Eymann and Lennie Heads</p>
        <p>and</p>
        <p>lUp.</p>
        <p>Niehaus</p>
        <p>Next on the program will be the</p>
        <p>George Wain arrangement of Karg;Elerts Trio in D</p>
        <p>Next on the program will be Duet-tino. Opus 36^ by Francois Doppler, based on Hun^urian motifs, with Thomas Mease and Samuel Combs, flutes and Alisa, Wetherington, piano.</p>
        <p>or featuring a clarinet trio -Tod Adcte, ^ph Walton and An</p>
        <p>drew Miskavage.</p>
        <p>This will be followed by an anony-mous composition, Die rlie</p>
        <p>Bankelsangeriieder featurii^ a</p>
        <p>The recital will conclude with a performance of the James A. Canter composition, Siamang Suite in three irts, featuring Todd Brewer and Gw Buck, euphoniums, and Davis Clark and Stephen Purifoy, tubes.</p>
        <p>Tuesday Is Prime Rib Niqht</p>
        <p>ght</p>
        <p>8.95</p>
        <p>Queen Cut Primp Rib.............*M0o/</p>
        <p>All Dinners Include SdUd Har. ( hone Of Po(.ito Or Wqelable Rol! And Bui</p>
        <p>THE</p>
        <p>and ^een</p>
        <p>R.STARANT</p>
        <p>IO:i I ^sibtool, Orive 0(1 2h4  4)|&amp;gt;eii  Miin(lvSAlurddV  Nlqhik    758-8883</p>
        <p>SUNDAY UNKHION SPMI All</p>
        <p>Roast Turkey, Dressing, Cranberry Sauce, Creamed Potatoes, Qreen Beans</p>
        <p>IneludM Bamna Puddlnfl For Oaaaart</p>
        <p>*3.50</p>
        <p>Baked Ham WHh Raisin Sauce, Stewed Apples &amp;amp; Qreen Beans..........</p>
        <p>Indudaa Banana PuCkSng rw Oaaaart</p>
        <p>*3.50</p>
        <p>GREENVILLE</p>
        <p>WILSON</p>
        <p>FAMILY RESTAlRANT</p>
        <p>AVHAUOTA MEAL</p>
        <p>Banquat FacilHlaa AvailaUa 75B0327</p>
        <p>Opan Daily Sunday thru Thuraday 11 AJH. to B P.M. Friday and Saturday 11 A.M. to 10 P.M.</p>
        <p>most weekends until the performance (^ns fiff a Feb. 10-13 run in McGinnis Theater.</p>
        <p>For more details, caU 757-6390.</p>
        <p>itigued from a trip last week to New York City where he received a Lifetime Acmevement Award from the National Academy</p>
        <p>of Itecording Artsand^iencK, 0^</p>
        <p>spiAesman Jerry Strobel said nesday.</p>
        <p>At the dinner. Miss Pearl was given a community service award named for Acuff, who has been per-forming on the Opry, a live country music snow, for about 50 years.</p>
        <p>Dining Comments from Bob</p>
        <p>Sunday &amp;amp; Monday Are Real Special...</p>
        <p>at the Beef Bam. Thats when I cook Prime Rib. Add a garden fresh house salad, steaming baked potato &amp;amp; just baked bread, all for only $9.95 &amp;amp; theyll be special for you.</p>
        <p>BEEF</p>
        <p>BARN</p>
        <p>Bob Simon</p>
        <p>Manager</p>
        <p>400 St Andrews Dr.* 756-1161</p>
        <p>Dinnur Surving TfanusMooday thru Saturday from 6:00 pa Nl^ltiy Sunday Sarvtng Ttma Fran S:30 pn autU 9K)0 pn</p>
        <p>You re invited to an old-fashioned</p>
        <p>THANKSGIVING MNNER</p>
        <p>$5.49</p>
        <p>Children under 12 just $2.99</p>
        <p>Thanksgiving Day, beginning 11:00 a.m. All you care to eat from our better than ever.</p>
        <p>Soup, Salad and Fruit Bar</p>
        <p>^ree Pumpkin Pic</p>
        <p>Cranberry Sauce</p>
        <p>Toasted Dinner Bread</p>
        <p>Buttered Peas</p>
        <p>Tender, Sliced Tom Turkey Carryout service is available.</p>
        <p>Hot Mashed Potatoes</p>
        <p>Light Combread Dressing</p>
        <p>Stan yuur holiday off right with our Breakfast Bar. Its open tUl ncron Thanksgiving Day.</p>
        <p>803 Memorial Drive</p>
        <p>Greenville</p>
        <p>Thanicgiving At Hcme</p>
        <p>EHNNER</p>
        <p>$8*95 children under 10 $2a95</p>
        <p>Come sit at our warm, bountiful table this Thanksgiving. lt*s an old-fashioned harvest feast like no other with SECONDS ON US!!</p>
        <p> Oven-Roasted Turkey with Dressing</p>
        <p> Fresh-Whipped Potatoes with Giblet Gravy</p>
        <p> Cranberry-Apple Relish</p>
        <p> Buttered Vegetables</p>
        <p>.. . complete with Tossed Green Salad and Freshly-Baked Pumpkin-Pecan Pie for Dessert.. . AND SECONDS ON US!</p>
        <p>Or, if you prefer a less traditional feast, make a selection from our special Holiday Menu, featuring Darryls most popular Appetizers, Entrees &amp;amp;. Desserts.</p>
        <p>Starting at 11 a.m.Thank8givingDay... Make Your RcBervatiions Now!</p>
        <p>Actom from East Carolina</p>
        <p>Upivegiity^</p>
        <p>752-1907</p>
        <pb facs="00096780_0087" />
        <p>Phil Hines First Administrator Of Greenville's Playwright Fund, Inc.</p>
        <p>Wdltc^r Plemmer On Piano Wednesdays</p>
        <p>By JERRY RAYNOR Reflector Staff Writer</p>
        <p>I%il Hines, the first administrative director of The Playwrights Fund of Greoiville, Inc., says he is discovering 'invaluable rewards and experience in his position. The Playwrights Fund IS an exceptional institution, he says. It is the only one officially recognized 1^ the Theater Arts Division of the N.C. Arts Council as a professional script development program organization in K state,</p>
        <p>with annual financial support by the arts council.</p>
        <p>It is the only one of its kind in North Carolina, different from other playwright groups in the state. So you see, the status of The Playwrights Fund is a very special one for Gremiville in the mattmr of continuing assistance given to the develi^ ment (rf new works of drama.</p>
        <p>that the Playwrights Fund is not a production company, but that of an outlet for playwrights to get public</p>
        <p>This is a valuable and needed part of the process in a writers effort to shape, to turn out a play, Hines added And because of the nature of the Playwrights Fund, we are in a position to feed the results of our efforts to other groups.</p>
        <p>The fund, origmally founded by Greenville writer/playwright Christine Rusch seven years ago, has steadily grown from a fledgling get-togethr group to read aim discuss lo^y produced material to its present status as the leading organization of its type in the Southeastern states. Each year a playwri^ts conference is held in Gremiville that draws</p>
        <p>PHIL HINES</p>
        <p>Mrs. Rusch is the funds artistic director. Grigg Denton, production coortetmr, rounds out ttie organizations staff.</p>
        <p>Our efforts have been encouraged and nourished both by the state Arts</p>
        <p>Opera Broadcasts Begin Saturday</p>
        <p>Four anniversaries and all three of this seasons new productions  II Trovatore, Das Rheingold, and Siegfriedwill be the focal points (A the Met Marathon, a special broadcast from 1 p.m. to. 5 p.m. Saturday as a prelude to the 1987-88 broadcast season of 20 live broadcasts from the stage of the Met.</p>
        <p>The Met Marathon will be heard locally over radio staticms WRRF, Washmgton, N.C., 93.0 mi the AM (hal, and WTEB New Bern, 89.5 on the FM dial.</p>
        <p>Anniversaries to be commemorated on the four-hour broadcast of taped highlights from 50 years of Metioj^tan Opera broadcasts include the lOOtfa anniversary of the birth of Lotte Lehmann, the 50th anniversary of Zinka Milanovs Met debut, and the 25th anniversary of the first Met performance of Richard Strausss Awadne auf Naxos. Heard in excerpts from II Trovatore will be Leontyne Price, Zinka Milanov, Bruna Castagna, Carlo Bergonzi, and Jussi Bioerling; Joan Sutherland and Luciano Pavarotti, who will be heard in the</p>
        <p>Festival</p>
        <p>MEXICO CITY (AP) - Pop singer Linda Ronstadt closed the Acapulco Film Festival with soi^ from her new Spanish-language record and a duet with singer Lola Beltran, queen (d ranchera music in Mexico.</p>
        <p>The performance of Ms. Ronstadt, dressed in a typical Mexican costume and wearir^ flowers in her hair, was broadcast nationally Tuesday night as part of the closing ceremonies for the 10-day festival in the Pacific resort.</p>
        <p>TTie performances of the two female singers was among the higldights of the KHlay festival, resumed after a hiatus of 19 years. It featured 60 movies from 17 countries, as well as television, video, radio and music.</p>
        <p>The remote areas of New Zealand are known as wop-wops.</p>
        <p>Council and by support from individuals and corpm^tums in Greenville, Mrs. Rusch said. They were convinced that we were woridng hard to make it a viable organization with iaaip&amp;lt;^ihing woriwhile to offer the public, and have consistently been genmrous in tteir support.</p>
        <p>Hines position, in fact, is funded by a recent grant from the Arts Council.</p>
        <p>Much of the success gained by the fund is attributable to our board of directors, Hines says. These are ie, volunteers, who give freely of time and energy in serving the fund.</p>
        <p>A native (A Troy in Montgomeiy County, Hines majored in English and drama at Pfeiffer College. Pfeiffer has an outstanding new play pro^pram. For me it meant the of^rfimity to have half a dozen of my plays done. I was involved in ac-tirana directing.</p>
        <p>After graduating from Pfeiffer, Hines says I tow the usual post-college choice, going to New York. I lived there three years, involved in acting, directing and writing. Two of my plays were presented at Lambs l^ter in New Yoric City as part of a spring workshop in 1965. Then I came back to North (Wlina, to Charlotte, where I helped organize the Play-wri^ts Forum. We did staged reamng of plays.</p>
        <p>His next venture was as director of the North Carolina Writers Network, headquartered in Durham. The basic onentation of the netw(N is fostering the writing of poetry and fiction.</p>
        <p>I liked being with the network, but my real love has always been writing plays, so I was delighted when I was</p>
        <p>selected for the administrative assistant position with fulltime exposure toplaywriting.</p>
        <p>Among plays Hines has written are Retreat,^ Magnets, and Home Place. ffis Home Places was featured in the reading production for September by the Playwrights Fund, with a Saturday now reac at the Greenville Museum of Art i a night reading at the funds produc-ti&amp;lt;m site in the Humber House on West Fifth Street.</p>
        <p>Home Place has bew one of my more successful efforts, Hines says. It was presented in July at the Ap-ilachian festival, and more receny f the Raleigh Ensemble Players. At each reading, Hines says, the playwright gets responses, input from members of the audience. This is an essential part in the process of a playwrights development of a script  to know, to understand what audiences feel are weak and</p>
        <p>^M^uroint in tirne^ Hines is pretty well tied im in reading scripts received by the fund. Each year, the fiind receives about 250 manuscripts from the Southeastern states, an amazing number, Hines says.</p>
        <p>Eventually, when time peimits, I hope we can work out a strong program to work more in the community, with teenagers, with community groups, get to use more of Greenviltes fine resources.</p>
        <p>My wish and that of many others concerned with drama in the South is that we not lose our best writers, that we can give playwrights a chance to do their best work here. Greenville has that chance. Its a wonderful opportunity and a worthwhile challenge.^</p>
        <p>May We Offer Catering To Go!</p>
        <p>Hot Anti Cold Hors doeuvres V  Fruit  Trays</p>
        <p>Desserts Let Us Give An Added Dimension To Your Next Party.</p>
        <p>Call 758*8883, Ask For Manager</p>
        <p>theU":  i  i n</p>
        <p>and</p>
        <p>ueen</p>
        <p>KFSTAIJRANT</p>
        <p>103 t.astbrook Drivp Off 264 HvPass Oppn Monday-Salurdav Nlqht^ 75H SH83</p>
        <p>broadcast of the Mets new production of D Trovahve later this season, wUl be heard in exceipts from La Sonnambula and Er-nani. From past broadcasts of Das Rheingold and Siegfried, Kirsten Flagstad, Lauritz Melchior, and Friedrich Schorr will be featured.</p>
        <p>Among those celebrating the anniversaries will be Victoria de los Angeles, Kiri Te Kanawa, Mario Del Monaco, Placido Domingo, Giovanni Martinelli, James McCracken, Robert Merrill, Jon Vickers, and Ramon Vinay in Otello; Jessye Norman, Leonie Rysanek, Tatiana Trvanos, aqd Jess Thomas in Adnadne auf Naxos; and Lotte Lehmann and Lauritz Melchior in Ldiengrin. Ccmductors will include Artur Bodanzky, Karl Bohm, Fritz Busch, Fausto Oeva, Andrew Davis, Herbert von Karajan, James Levine, and Fritz Stiedry.</p>
        <p>In addition to the musical selections, present and former Met artists will be interviewed.</p>
        <p>Robert Sherman, executive producer for radio station WQXR in New York, will be the host, and the announcer will be Peter Allen, announcer for the 1987-88 Texaco-Metropolitan Opera radio broadcasts. Geoige Jellinek, host of the nationally syndicated prog^ The Vocal Scene, will provide special commentary.</p>
        <p>Listeners to the Marathon are encouraged to call a toll-free number to receive the Metropolitans special Broadcast Guide. The Guide, a gift from the met, includes information on the complete 1967-88 Texaco-Metropolitan Opera broadcast season, stories ot the operas, and special articles including a history of the Met radio broadcasts, written by David Hamilton, as well as infonna-tioD on this seasons television series.</p>
        <p>Listeners in the United States should call 1-800-11^-1967 to receive the free guide; or write to: Met Broadcast Guide, Box 50, New York, New York 10023. '</p>
        <p>Funding for the Met Marathon broadcast is make possible by a grant from Texaco Inc.</p>
        <p>S21 Cotanehe St.</p>
        <p>Afahe Your Christmas Shopping Easier With Chico's Gift Certificates</p>
        <p>Celebrate Your Christmas Parties In ^ Our Fiesta Room.</p>
        <p>SOUL MASTERMarcus Miller, at 28 is a modern-day soul master, a top composer and producer, a solo artist and co-founder of a new group, the Jamacia Boys. (Washingtn P(t Photo by Lucien Perkins)</p>
        <p>ITALIAN SILK TEXTILES</p>
        <p>LOS ANGELES (AP) - An exhibition of 100 Italian silk textiles dating from the 14th century through the beginning of the 19th century is on view through Jan. 10, 1988, at the Los</p>
        <p>works on view were objects, parts of clothing or furnishings in palaces and churches. As sudi, they iwrovide insight into the chanjging lifestyles and suteequent demands on tlw world of fabrics.</p>
        <p>The museum says Five Centuries of Italian Textiles illuminates the ways in which textile designs were mirrored in painting, sculpture and everyday life by comparing actual fabncs with photographs of representative works of art and genre settings.</p>
        <p>THANKSGIVING</p>
        <p>DAYBUFFET</p>
        <p>11:30am to 3:00pm</p>
        <p>Serving delicious Thanksgiving delights</p>
        <p> Carved Roaat Turkey  s  Squash Caaaerole</p>
        <p>with GlUet Gravy    Green Bean Almondlne</p>
        <p> Carved Roaat Ham    Scalloped Potatoes</p>
        <p> Carved Roast Round of Beef  Assorted Autumn Salads</p>
        <p> Qnnamon Chicken    Pecan and PumpUn Pie</p>
        <p>ButterBeans    Minced Meat Pie</p>
        <p> Glazed Sweet Potatoes   And Other Assorted Desserts</p>
        <p>Senior Citizens Discount of $1.00 off</p>
        <p>Sheraton GreenvUte</p>
        <p>ThshospltsUty people of ITT</p>
        <p>MtNVH.i.1 kONTMCANOilNA tlWMS-MM</p>
        <p>All you care to eat. .. $7.95</p>
        <p>Children (Under 12)...$3.95  Seniors...$6.95</p>
        <p>*Tas a |Mah| sM ImM</p>
        <p>Thursday (Nov. 26th) 11AM - 3PM</p>
        <p>A feast of turkey and homemade dressing  carved steamship round  ham sweet potato casserole  mashed potato * stewed summer squash fresh cranberry sauce  giblet gravy  carrot and raisin salad salad and relish table  pumpkin pie  iqiple cobbler mince meat pie and, of course, coffee, tet or milk</p>
        <p>Reservations Recommended</p>
        <p>Medical Center, Greenville</p>
        <p>\</p>
        <pb facs="00096780_0088" />
        <p>4 Jfer  '.  . .</p>
        <p>Q,&amp;lt;j 2 The Dally Reflector, Greenville. N.C/   Sunday,</p>
        <p>t t</p>
        <p>try</p>
        <p>r-^'vy</p>
        <p>Raveling lours May</p>
        <p>B Ending</p>
        <p>.r.'</p>
        <p>y&amp;gt;/</p>
        <p>'-Vi</p>
        <p>n</p>
        <p>V By KAY BARTLETT AP Newsfeatures Writer NEW YORK (AP) - Ti dreaded book;^uthors tour if this is Tuesday ilmust be WKRP in Cincinnati -7 *  the way of the traveling</p>
        <p>newest innovation in the of peddling books is video vs via satellite. AuUhh^ sit ably in a local studio and stions from television per-1 in another city, first really new advance</p>
        <p>smce we began sending authors on the road, says Betty ^pian, a lingttme book publicist based in Los ^ Angeles and now affiliated with On' the one of a handful of companies specializing in the long-^t^iCe interviews.</p>
        <p>I^blishers of potentially profitable boots have always been willing to s^nd ^ lot of money for promotion a^ tl^ almost always included a toip&amp;gt; In which the author hq^ . f^m airplane to airplane, from itt-t^ew to interview, in the larger markets across the countryplaces like Miami, Atlanta, Detroit, Seattle, Dalls, Chicago, Portland, Ore. .</p>
        <p>Tt^efficient publicist had usually</p>
        <p>ltelevisi(mtalkshowor two,aS , weU as lined up for radio and newspaper interviews.</p>
        <p>gruelling and- many an raaidnevw again. the satellite technology, the authors biggest disruption comes ,:. when the makeup men come aroi^ . ; '  to polisb shiny noses or recomb hair betwemi feeds. In an hour-lon| ses-^aon^^ttie author can be interviewed ' by the^ocal talk show host ing or . sevSh cities. In a fom-hour sessim, tbemessagecan getout to22to24ct-iea.</p>
        <p>Feeds to a dozen or so markets cost between $10,000 and $12,000. Ellen firick, publicist for Warner Books, s^ that if the author visited the cities in person the cost would be more than twice that.</p>
        <p>.The difference is very simple . says Sidney Sheldon, the prolifc pro-diuer of best sellers. Once when I was on a 20Hnty tour, Detroit was on nay agoida. I asked the taxi drivm* to .nmfltout any of the large automotive if we went by one. The drivtf \</p>
        <p>I around and said, But youre. Ittsburg.    *</p>
        <p>latest book, Windows of. and its predeeeskMr, if Comes, Sheldon simply sat in the studio for a few hours and reach! the same 20 cities.</p>
        <p>Its absolute heaven, he says. Its the biggest advance that has come along for authors selling books.</p>
        <p>SljbSdon recently did tour England, ^^ij^balia,, Scotland and Ireland to pernote a book, but he believes its oiAy a'matter of time before the sat-^te tour reaches those comers of mbglo^aswell.</p>
        <p>Smipian says the new technology  best serves well-known authors, 8ome&amp;lt;me the local stations are al-rea(j^ ea^er to interview. The disad-vai^e IS that the author gets ex-poame oi y (me outlet, televisi(m.</p>
        <p>a personal tour, radio and news-' pat^mterviews are likely included, as #ell as book-signing sessions at Ibookstores.</p>
        <p>ite system recently have in-Gore Vidal, William F. Helen Hayes, Victoria Carl Sagan, Jackie Col-rbara Taylor Bradford, Judith Krantz, James Clavell, F-ther'Jndirew Greeley, Jane Fonda, t and Robert Ludhutt. ' ) years ago it was a question of r* edgBig the publishers that tbk wa^an alternative to the book tour/ Shap^ says. Random House, Lit-and Warner Books were I pioneers. They tried it and , m wuu results and now everybody</p>
        <p>4 1  *</p>
        <p>'  repkescnt authors who ten me are willing to give me an after-' on, but they are not willing to give I three weeks of their lives to go</p>
        <p>thebooktour.</p>
        <p>(^|,4he Scene is one of about four companies specializing in the book t.toir sat^te Ixttiness. On the Sccme, Jor instance, booked eight authors in ^*ivJune.</p>
        <p>Another big company is J-Nex Television and News Services, also hbsed in Los Angeles. It uses its own studios, whereas On the Scene rents I . . facilities from Home B(n( Office.</p>
        <p>' The local station can opt for a vari</p>
        <p>ety of formats. They can interview traight</p>
        <p>one author straight for eleven mlnhtes, they can chop it into two flve-ihinute pieces to be aired at dif-, fierent times, or they can choose a all^mmute window and allow the au-(heoce to ask questions of the author fdrthelastio.</p>
        <p>^kJitoerge Merlis, chairm^ of J-Nex,</p>
        <p>liujhe doesnt know of an author</p>
        <p>I doesnt like the system.</p>
        <p>' Theres one authmr who will only do,the satellite tour because he is afraid of flying, he s^. I wont tell you the name. Then theres anotbsr who said,she could write awdher book in the three weeks an Adthors tour takes.</p>
        <p>only know of one jwblicist who is resistant to the satellite book tour. And thats because he loves the trav-lelf. as well as the chance to mid expense account. .</p>
        <p>,1987</p>
        <p>wiQoly</p>
        <p>\</p>
        <p>.S.0 Selected Beef!</p>
        <p>TRIMMED THE WAY YOU UKEIT!</p>
        <p>GRADE A</p>
        <p>99</p>
        <p>X'</p>
        <p>TURKEYS</p>
        <p>10 LBS. &amp;amp; UP</p>
        <p>LIMIT 1 WITH THIS COUPON AND A $20 OR MORE FOOD ORDER.</p>
        <p>COUPON EXPIRES NOV. 26.1987</p>
        <p>PIU-IO </p>
        <p>GRADE A</p>
        <p>TURKEYS</p>
        <p>10 LBS. &amp;amp;UP</p>
        <p>RIB EYE</p>
        <p>STEAK</p>
        <p>LB.</p>
        <p>LIMIT I.PLEASe</p>
        <p>4-7 U.</p>
        <p>lEASTS. LB</p>
        <p>fSRKEY PARTS</p>
        <p>WHOLE SMOKED</p>
        <p>PICNICS</p>
        <p>12 OZ.</p>
        <p>FROSTY MORN</p>
        <p>. NECKS. ORUMSTICKSLB.</p>
        <p>BACON</p>
        <p>MHISE OF RAEFARD fresh FRYER</p>
        <p>WHOLE</p>
        <p>COUNTRY</p>
        <p>LB.</p>
        <p>SWIFTS HOSTESS</p>
        <p>CANNED</p>
        <p>HAMS</p>
        <p>HAMS</p>
        <p>LB.</p>
        <p>QUARTER LOIN</p>
        <p>PORK CHOPS</p>
        <p>
        </p>
        <p>mm</p>
        <p>CAN</p>
        <p>FAMILY PACK FRESH PORK</p>
        <p>NECKBONES, &amp;amp; PI6 FEET</p>
        <p>LB.</p>
        <p>JOHN MORRELLS 1LB.PKB.  |ig.</p>
        <p>25 LB. BUCKET</p>
        <p>10 LB. BUCKET PORK  M  QQ</p>
        <p>Chitterlings 4^</p>
        <p>LARD</p>
        <p>JAMESTOWN</p>
        <p>SAUSA6E</p>
        <p>NOT ONI MILO 1 LB. PRO.</p>
        <p>Bolfmna</p>
        <p>12 OZ. mOTt</p>
        <p>FRANKS o9C:</p>
        <p>1 LB. PK8.  -</p>
        <p>SusageBBC:</p>
        <p>  . .140 CT.</p>
        <p>TROPIC ISLE</p>
        <p>mOZEN COCONUT ,2bz</p>
        <p>ChIcKEN pastry 24 OZ. 1J69</p>
        <p>690/1 890</p>
        <p>t</p>
        <p>IKE, DIET COKES laLO YELLO</p>
        <p>tum</p>
        <p>fblgers</p>
        <p>FOLGER'S</p>
        <p>COFFEE</p>
        <p>^9</p>
        <p>1 LB. BAG</p>
        <p>13 OZ. BAG DECAF.</p>
        <p>/  4</p>
        <p>PI06LY WIGGLY</p>
        <p>CHARCOAL</p>
        <p>20 LB. BAG</p>
        <p>PIGGLY WIGGLY</p>
        <p>MARGARINE</p>
        <p>[2Petm(z</p>
        <p>PETRITZ &amp;gt;</p>
        <p>PIE SHELLS</p>
        <p>2 PR.</p>
        <p>BRIGHT &amp;amp; EARLY</p>
        <p>BREAKFAST</p>
        <p>BEVERAGE</p>
        <p>64 OZ. CTN.</p>
        <p>ff</p>
        <p>MT. OLIVE</p>
        <p>SALAD</p>
        <p>CUBES</p>
        <p>12 OZ.</p>
        <p>PI60LY WIGGLY</p>
        <p>WHIPPED</p>
        <p>TOPPING</p>
        <p>THANK YOU CHERRY</p>
        <p>PIE</p>
        <p>FILLING</p>
        <p>20 OZ.</p>
        <p>2;1</p>
        <p>'t' -f. sr</p>
        <pb facs="00096780_0089" />
        <p>Enhance</p>
        <p>PRICES EFFECTIVE NOV. I8-26,1987</p>
        <p>. Qfeenvllle, N.C.  SwKtey. November 22,1987  0--|3</p>
        <p>WE RESERVE THE RIGHT TO LIMIT QUAHTITIES</p>
        <p>TAI</p>
        <p>NONE SOLD TO DEALERS OR RESTAURANTS. VE GLADLY ACCEPT U.S.O.A. FOOD STAMPS.</p>
        <p>ilND Save ll/lonevi</p>
        <p>CELERY</p>
        <p>12 OZ. PKG.</p>
        <p>WHITE</p>
        <p>8 LB. BAG</p>
        <p>5 LB. BAG</p>
        <p>COLLARDS .. Li. 49C</p>
        <p>IWEET POTATOES</p>
        <p>3/100</p>
        <p>BSrshmallow</p>
        <p>CREME 7ozD90</p>
        <p>2/100</p>
        <p>KRAFT 105 OZ.</p>
        <p>MINIATURE</p>
        <p>Marshmallows</p>
        <p>KRAFT REG. OR LIGHT PHILADELPHIA BRAND QQ^</p>
        <p>Cream Cheeses oz.</p>
        <p>VEGETABLE OIL</p>
        <p>PlfiGLY WIGGLY</p>
        <p>CRANBERRY</p>
        <p>16 OZ.</p>
        <p>3/100</p>
        <p>PIGGIY WIGGLY</p>
        <p>FLOUR</p>
        <p>GOLDEN GESY '</p>
        <p>CRINKLE CUT</p>
        <p>PIGGLV</p>
        <p>W/tGGLV</p>
        <p>PIG8LY WIGGLY</p>
        <p>ME SHELLS</p>
        <p>French</p>
        <p>Fries</p>
        <p>2 LBS.</p>
        <p>FAB</p>
        <p>DHERGENT</p>
        <p>42 OZ.</p>
        <p>GOLDEN BEST</p>
        <p>VEGETABLES</p>
        <p>CUT GREEN BEANS, MIXED VEGETABLES. CREAM STYLE OR WHOLE KERNtL GOLDEN CORN</p>
        <p>303 SIZE  MIX 08 MATCH - YOUR CHOICE</p>
        <p>PIGGLY WIGGLY GUTTERMILK</p>
        <p>BISCUITS</p>
        <p>4 PR.</p>
        <p>ROLLER</p>
        <p>CHAMPlOH</p>
        <p>SELF-RISING</p>
        <p>FLOUR</p>
        <p>25-LB. BAG</p>
        <p>GOLDEN BEST</p>
        <p>SHORTENING</p>
        <p>42 OZ.</p>
        <p>SURF</p>
        <p>OETERGENT 42 OZ.</p>
        <p>PIGGLY WIGGLY</p>
        <p>MAYONNAISE or SALAD DRESSING</p>
        <p>^ YOUR CHOICE</p>
        <p>|89</p>
        <p>SEALTST</p>
        <p>Sour Cream</p>
        <p>Ml dMn IwMlv tMM</p>
        <p>BUTTeSR</p>
        <p>PIGGLY WIGGLY</p>
        <p>BUHER</p>
        <p>199</p>
        <p>PI6GLY WIG6LY MIOWN A SERVE</p>
        <p>ROLLS</p>
        <p>2pkgs.</p>
        <p>89</p>
        <p>AKE MIX</p>
        <p>PIBGLY WIGGLY</p>
        <p>ICE CREAM</p>
        <p>)29</p>
        <p>FROSTING</p>
        <p>10 OZ.</p>
        <p>'h GAt</p>
        <p>PIGGLY WIGGLY HEAVY DUn</p>
        <p>ALUMINUM</p>
        <p>FOIL</p>
        <p>I8'X25</p>
        <p>ScotTowels</p>
        <p>8 0Z.</p>
        <p>DIXIE CRYSTALS</p>
        <p>SUGAR</p>
        <p>4X. IOX.'A.'b^.^K. RR.</p>
        <p>JUMBO</p>
        <p>ROLLS</p>
        <p>PER ROLL</p>
        <p>MAXWEU HOUSE</p>
        <p>INSTANT</p>
        <p>COFFEE</p>
        <p>BOZ.</p>
        <p>329</p>
        <p>mnvt</p>
        <p>CHUP</p>
        <p>32 OZ.</p>
        <p>pkaY WI06LV IODID</p>
        <p>00</p>
        <p>|2OZ'</p>
        <p>BOX</p>
        <p>QOLOEN BEST</p>
        <p>MACARONI &amp;amp; CHEESE</p>
        <p>DINNERS</p>
        <p>BOX</p>
        <p>2105 DICKINSON AVENUE OPEN 7 A.M. T012 AM. SEVEN DAYS A WEEK</p>
        <p>r</p>
        <p>3GLY \AIIGG</p>
        <p>I</p>
        <p>MS"</p>
        <p>Music</p>
        <p>Without</p>
        <p>Musicians</p>
        <p>By POPULAR MECHANICS A Hearst Magazine Music recordiogs these days are made from mothership studios with streamlined banks of electronic' e^pment that look like a NASA flipht control center.</p>
        <p>Musical manipulation is part of an electronic revolution in me music busiiiess that, according to an article in the current issue of Popular Mediamcs, allows recordings to be made without musicians even being in Uie same dty. Some are noiade without musicians at an.</p>
        <p>Large recording centers are the inotharahipB that coordinate the woit. Ihe system consists of source rfmnneh that are the input from microphones, electric guitars and so forth, and tracks, the number of paths atong the tape available for thowe sources.</p>
        <p>A miving mtmn acts as a traffic cop between me source channels and the tracks.</p>
        <p>This aUows the artist and producer pCTiormance</p>
        <p>to shape the recorded as they see fit.</p>
        <p>For example, there might be only four musidaBS in a baml, but the producer could beef up the performance by insertiiig background vocals or instrumentals on the extra trade  even after the band has recorded its parts.</p>
        <p>The band need not even record together. The lead singer can add his vocals after instrumentalists have laid down thdr tracks  or vice versa. Multichannel equipment makes all manner of musical manipulation possible aftor the actual recording. The druniiner can be nioved electronicaUy fixim the right to tiie left side of the soundstage.</p>
        <p>The recording can be rebalanced, to emphasize u sound on certain t^cks ovor others. This hanpmis often in classical recordings. The conductor and mginecr mi^t pump up the channel &amp;amp;t contains a violin sok), focusing an acoustical spotlight on the soloist.</p>
        <p>In Bruce Williss The Return of Bruno, ev^ effort was made to make it as live-soundiiig as possible.</p>
        <p>into the act, replacing some hve drum tracks with computer drums, and Willis lead vocals were com</p>
        <p>posites, spliced together from several takes.</p>
        <p>When the Beatles first used an electronic music synthesizer 20 years tfo for Set. Peppers Lonely Hearts Chib Band, they used a Mellotron</p>
        <p>that housed tapes of instruments inside a keyboard. Striking a key activated the tape of, say, 100 violins playing a C note.</p>
        <p>Now, many studios are equipped with gital samiding synthesizers. Their keyboards can store any sound digitally, allowing the user to play back the sound over the entire musical spectrum.</p>
        <p>Jan Hammer, the musician who scored Miami Vice, used one of these to create whole orchestral scores, as well as 12-string guitars, vibraplxmes, drums, horns, woodwinds and other instnunents. Not a single instrument beard on the show score is being played by a live musician.</p>
        <p>KU Madrigal DbinenSel</p>
        <p>ECU News Bureau</p>
        <p>The food, festivities, music and merriment of Englands Renaissance will be recreated at East Carotina University Dec. 2-5 at the 11th anmial Christmas Madrigal Dinner Series.</p>
        <p>Each evening will feature entertainment by two music ensembles  the ECU Madrigal Singers and the Collegium Musicum - presenting tnufitional carols, madngals and dance muric of the Elizabethan era.</p>
        <p>Presidiiig in the banquet hall are a Lord and Lady of the Manor. Each evening will include wassail toasts, display of a roast boars head, brass fanfares and entertainment by dancers and a jester. The lords and ladies of the bead table, musidans and servants will be clad in circa IBOO *</p>
        <p>ptffiodCO*HiinNt</p>
        <p>Ticket hohting guests will be served three-course dinners of salad,</p>
        <p>! rib with vegetables, and flam: [fruit dessert.</p>
        <p>the annual dinner series, ECUs Mendenhall Student Center room has been fin*-and decorated in the style of an English country manor hall, with red banquet tables [colorfiil heraldic banners.</p>
        <p>Dr. Charles Moore of the ECU School of Music (timts the Madrkal Dinners at ECU. Sponsors are the School of Music and the ECU Dnartment of University Unions.</p>
        <p>Since the popular Macfrigal Dinner ssries is nonniilly 8&amp;lt;dd out well in advance, ea^ purchase of tickets is advised. Tklmts for the general public are $18 per person and are avaOahle at the ECU Central Ticket Office (919) wmi. ext. 186. The Ticket Office is m from a a.m. to 6 p.m. on weskdays. VISA/Master-Cud telephone orders and mail orders wiU be accepted for a han-dUngfeofSOcents.</p>
        <pb facs="00096780_0090" />
        <p>Q.j4 rhe Daily Hetieciui, vareenviiie, N.. Sunday, November 22,1987'The Winter People' Filmd At Plumtree</p>
        <p>PLUMTREE, N.C. (AP) - The wood smoke curling from the backwoods cabin seemed to summon the fog that spread up through leafless trees at the back end of a mountain hollow.</p>
        <p>The only thing that was real was the mountain hollow.</p>
        <p>Everything else had been delivered from Hollywood.</p>
        <p>But, despite the portahility of even some of the leafless trees, the movie that Hollywood will carry from this Avery County community in a few months will likely be a realistic canicie of the hardscrabble Appalachians of 1934.</p>
        <p>In The Winter People, the film adaptation of John Ehles novel, tte story and region go hand in hand, said producer Robert Solo.</p>
        <p>Solo was standing in a cow pasture nervously studying the sky and juggling shooting scl^ules inside his head.</p>
        <p>Realism is what brought Solo, about 100 movie technicians and some tOfKirawer actors to Plumtree, a bump on N.C. 194 that those movie people^ have rebuilt to look similar to tm mountain hamlet that it really was during the Depression.</p>
        <p>And, realism prompted Nelson Films, the production company, to hunt thnnigh Avery County and Asheville for dozens of mountaineer-loddng folk to cast as extras in the film and add to the reality of the piece, Solo told the Winston-Salem Journal.</p>
        <p>Columbia Pictures, the distributor, has not given a date for release of the film, which Solo has been trying for five years to convince the money people should be made. Sxioting here is expected to be finished sometime in January.</p>
        <p>Even if it is being made in the North Carolina mountains, The Winter People is no B*grade moonshine yam.</p>
        <p>Solo is the producer of such films</p>
        <p>is Bad Boys, Invasiim of the Body .......y,  Col-</p>
        <p>Snatchers and, most recently,</p>
        <p>&amp;gt;rs, directed by Dennis Hopper.</p>
        <p>The Winter People stars Kelly McGillis, Kurt Russell, Lloyd</p>
        <p>Bridges and J(dm Russell.</p>
        <p>The director, Ted Kotcheff, is known fw his films North Dallas Forty, First Blood and Uncommon Valor.</p>
        <p>Ehle, a North Carolina author with homes in Winston-Salem and Penland, helped the producers find the mountain setting and is often a welcome visitor on the set.</p>
        <p>The Winter People, published in 1981, places an unemployed clockmaker and his daughter in an unnamed mountain village as winter approaches. He falls in love with an unmarried mother who persuades her family to let the hero put a clock repair business in the comer of their general store.</p>
        <p>Its not, on the face of it, the most obvious, commercial movie. Its not Star Wars w Indiana Jones, Solo said. Its about the change of seasons, about winter, snow, ram.</p>
        <p>Since the winto* is almost a character itself. Solo is hoping for miserable weather  and hell probably get it here. Temperatures were already hovering in file 30s this week.</p>
        <p>But just in case, anearby ski resort has heen consulted about throwing snow on the sets.</p>
        <p>Movie making has not so much descended on this back side of Avery County as it has drifted in like the fog. So far, shooting has taken place on two ronote farms with the stars and the other movie people sequestered each night on Beech Mountain.</p>
        <p>Nonetheless, almost everylx^ has had at least some contact with the movie people, who are fond of,wearing woolen scarves and puzzling over state road maps.</p>
        <p>By now, in Plumtree and Minneapolis and Cranherry and the other communities, everybody has - or knows somebody wto has:</p>
        <p> Gotten a pvt in the movie, even if they dont get to say anything;</p>
        <p>~ Spotted Kurt Russell or Lloyd Bridges; or</p>
        <p>- ActuaDy read Ehles book, 'Which has developed a months-lo waiting list at the library in New!</p>
        <p>Aleta Buchanan, the postmaster in</p>
        <p>Plumtree, said, Everybodys real excited. Its been THE topic of conversation around here.</p>
        <p>Ms. Buchanan read the bode and said that it is a good story even if it does have a lot of four-letter wwrds.</p>
        <p>Movie people started drifting throu^ in July and dropping hints about something really big, said Ms. Buchanan, whos had a bout with star-gazing herself.</p>
        <p>I was pulling out of a parking lot n sticking</p>
        <p>in Cranberry and saw a man stic his arm out of an old A-Model Ford. I grabbed my sisters arm and said, TTiatsKurtRusseU.</p>
        <p>TTie movie business has brought temporary jobs to the area. Randy Miller looKM up from hammering on fiberglass rocks and said, Its just something to do to make a little money. Christmas will be here soon.^</p>
        <p>Miller, a construction hand, has been driving from Roan Mountain, Tenn., every day for several weeks, putting in 70 to 80 hours a week.</p>
        <p>But not all are interested in seeing themselves in celluloid, not when there are fields of Chrisfinas trees to tend to and regular jobs.</p>
        <p>Ruth Hughes, who runs a grocery store on N.C. 194, said that movie people asked her help by referring rugged-looking male customers to them for jobs as extras. TIk average days pay is $30 to $40.</p>
        <p>Some of these old boys are making $75 or $100 a day hanging Sheet-rock. They cant take of! from their jobs to do this, she said.</p>
        <p>There was a job for Amelia Burnett, however, that may change her life. The 9-year-old tagged along with playmates to a casting call in Asheville and came away with a major role, that of Paula, fiie daughter of the clockmaker.</p>
        <p>She said that after reading for the ; on five occasions, I was pretty 1 about it. I didnt think I was going to get the part at the time.</p>
        <p>Ammia has never been in front of a movie camera before, although she has auditioned fv TV commercials in Asheville. She has been on stage</p>
        <p>with her parents blu^ass band and is learning to i^y the fiddle.</p>
        <p>Suddenly, she found herself with her own dressing room furnished with a tutor. And, she found herself working 14-hour days. Movie people are pretty much fun, she said.</p>
        <p>Actings fun all the way around. I would definitely do it again if I had the chance.</p>
        <p>And, I get to be Kurt Russells daughter.</p>
        <p>Gary Burnette, Amelias father, said, Its just something she wanted to go for. They said it was just a miracle she got the part because shes never had any acting experience. Shes just a natural ham anyway.</p>
        <p>Most the extras will be used in filming at the set in Plumtree, where an ancient general stm*e hv been resuscitated with a pot-belly stove, a stock of dry goods and even stick can^.</p>
        <p>Kay Wilkins said, But, they dont have it stocked like we had it stocked. My father had it filled to the brim.</p>
        <p>afe. Wilkins grandfather, C. W. Burleson, built the store and much of Plumtree just after the Civil War.</p>
        <p>Nonetheless, the movie set brings back memories to Mrs. Wilkins, a retired schoolteacher who worked in the store for her father, Henry Burleson, as she was growing up.</p>
        <p>The movie people rented the store, the 200-year-old log cabin next door and much of the surrounding land from the family. They built cattle pens, a bridge and a Depression-era church with a fake cemetery.</p>
        <p>The real church, Plumtree Presbyterian, discreetly hides behind another prop  the side of a bam with burley tobacco hanging from the rafters.</p>
        <p>After the movie people leave, the Plumtree commumty can keep the set as a tourist attraction or put Plumtree back like it was.</p>
        <p>The real Plumtree in the 1930s was a tad more cosmopolitan than the movie version, Mrs. Wilkins said.</p>
        <p>We were educated praple thn^ here. Most of the families that lived here had a college education.</p>
        <p>Henry Burleson had an engineering decree and wired the hanolet for electric lights in 1917, she said.</p>
        <p>in its prune m the late I93us, Plum-tree boasted the first movie theater in Avery County, a tea shop, a cheese</p>
        <p>factory, a candy kitchen, a barber shop and several thriving industries, including the Tarheel Mica Co.,</p>
        <p>The plant is still operating with a handful of employees processing mica imptxrted from India.</p>
        <p>Mrs. Wilkins, who learned to drive one of the stores trucks when she was 11 years old, said it was the areas first shopping center. Bustling with clerks, the store catered to shoppers from places named Pancake, Powder Mill, Lick Log and Spear.</p>
        <p>Ten miles away in Cranberry, the movie people have invaded tte old irry High School, using it first ition hall and then conver-</p>
        <p>asana ting it into a sound stage.</p>
        <p>Solo, the producer, said, Because all of the book is set in North Carolina, it makes sense to have those sets here so if its raining, we can go inside and shoot.</p>
        <p>MOUNTAIN MOVIE SET - The cast for the movie, The Winter People, awaits the start of filming recently as fog rises behind a hamlet built especially fur the film</p>
        <p>on location near the village of Plumtree, Avery County, in the western mountains area of Nmrth Carolina. (AP Laserphoto)</p>
        <p>Taking the script back to</p>
        <p>aking</p>
        <p>Hollywood sound stag^ to shoot indoor scenes doesnt have the ring of authenticity, he said.</p>
        <p>When an oil crisis hit the wcnrld, Brazil was the (ily nation to switch successfully from gasoline to a renewable resource  sugar cane-based ethanol -- for automobile fuel.</p>
        <p>Banyan trees usually sprout from seeds that animals have dropped into cracks in the branches of other trees, and their roots grow down from the host branches ii</p>
        <p>atices</p>
        <p>NEXT EVENT</p>
        <p>The King!; Sngos</p>
        <p>The Rolls Royce of barberehop quartets - with six voices.</p>
        <p>- VarMy</p>
        <p>Monday, November 30, 1987 Wright Auditorium East Carolina Univoraity 8:00 p.m.</p>
        <p>8ponsor*d by IIm Otpartmnt o( UnlvtrtHy Untom</p>
        <p>For ticket Information contact:</p>
        <p>The Central Ticket Office Mendenhall Student Center East Carolina University Qreenvllle, NC 27858-4353 or call:</p>
        <p>(919) 757-6611, ext. 266</p>
        <p>Mal a personal appearance this holiday season</p>
        <p>Send Snapshot 6netlngs. Put yourself and your family on a snapshot greeting card mode from your favorite color negative, slide or print As 0 member of the Kodak Coloiwotch system, we ll give you color snapshot greetings that ore as lifelike as possible Motching envelopes with each card. &amp;amp;ing us your fovorite picture and order todoy</p>
        <p>V&amp;gt;5.'</p>
        <p>Ho Ho Ho</p>
        <p>Have the Merriest</p>
        <p>Cnotce ot lout designs/sentimenis</p>
        <p>5COUPON  COUPON  COUPON  COUPON  COUPON  COUPON  COUPON'</p>
        <p>FREE 8 X 10 OR 5 X 7</p>
        <p>Color Enlargement</p>
        <p>With this coupon and purchase of two or more at regular price. Offer available from 35mm negatives or slides. Also available from prints. Copy negative is extra. One coupon per order.</p>
        <p>(Expirm Dacember 24, 1987)</p>
        <p>S</p>
        <p>OYERNITE/1 HOUR PHOTO</p>
        <p>Qrttnvill* Square Shopping Cantar 703 Graanvilla Blvd.</p>
        <p>Phona: 760-OSOO</p>
        <p>...tor a Good Look</p>
        <p>Hour*; 8 a.m. to 6 p.m. Mon.-Frl. 9 a.m. to S p.m. Sal.Dixie Queen Seafood Restaurant</p>
        <p>Winterville 756-2333</p>
        <p>Rocky Mt. 446-4444</p>
        <p>Monday, Tuesday Wednesday &amp;amp; Thursday</p>
        <p>D.Q. Mini</p>
        <p>Shrimp Speciai.. .*3.65</p>
        <p>Banquet Facilities Available Wa Hava Planty Of Parking Mon.-Sat., 4:00 P.M. to 9:00 P.M. Closed Sunday</p>
        <p>NOW OPEN SUNDAYS yDU KITCHEN11 AM-3 PM</p>
        <p>Comer Dickinson &amp;amp; Raleigh Ave.</p>
        <p>I  Phone 752-5339  i^  Eat/n S Take Out  Awv Speclaliiing In Home</p>
        <p>&amp;amp;^INEP11X ODEON Pun THEATRES</p>
        <p>$3.00 BARGAIN MATINEE</p>
        <p>ALL SHOWS SEfORE 6 PM MON. TO FW,</p>
        <p>ON SAT., SUN,, A HOLIDAYS RRST AFTERNOON SHOW ONLY AT SELECTED THEATRESCHECK SHOWTIMES</p>
        <p>"StWVLJiedmiig rmaswmJEimim sun. asattyittadeane. 'j  weekdaysi</p>
        <p>OlitMiiia.mmrm  ^  X  7:2(W:35</p>
        <p>It is the year 2019. The Running Man is a</p>
        <p>deadly game no one has ever survived.</p>
        <p>But...Schwarzenegger has yet to play.</p>
        <p>SCHVHARZENIG6ER</p>
        <p>THE</p>
        <p>RUNHMGMAN</p>
        <p>TRI-STAR PICTURES</p>
        <p>1</p>
        <p>SUN. 2:30-4:45 7:15-9:15 WEEKDAYS 7:15-9:15</p>
        <p>PLin</p>
        <p>CAROLINA EAST CENTER 756 1449</p>
        <p>THE BEST THRILLER I'VE SEEM IH YEARS... Close and Douglas turn in the performances of their careers...hlgh wire thrills." John Tibbetts, kctv tv</p>
        <p>.Nichael Douglas Qleim Close</p>
        <p>AterriiyingkwsWy.</p>
        <p>A PARAMOUNT PICTURE</p>
        <p>11</p>
        <p>9TH SENSATIONAL WEEK</p>
        <p>SUN. 2:004:30-7:10-9:30 WEEKDAYS 7:104:30</p>
        <p>PLin</p>
        <p>CAROLINA EAST CENTER 7M1449</p>
        <p>most widefy fead best</p>
        <p>yeariB incredible shocKei;</p>
        <p>NEW WOHU) PK TUHE.S PRILS tNTERrAINMI NT A CH ARI.es FRIES PW MH riK)N UXAVERSIN THEAITIt n-..VK'TORIA TENNANT KRISTI Y SWANSON JEB ADAMS - UHJISE FLETCHER m..,CHRISR)PHER YOUNG iw-,VC ANDREWS JEFFREY BIXKJM i-.v.N.i..ratARLCSFRIES*MIKE ROSENFELD , SY LEVIN * rHOMAS FRIES</p>
        <p>Ik NEW WORLD naURES JEFFREY BUK)M IPQl^aiiwiw</p>
        <p>f9V7Miioa6pMCfvMiPMiiHMvD v.i7aar*ii  Imm^Mav</p>
        <p>SUN. 1:00^:00-5:00-7:00-9:00 WEEKDAYS 7:00-9:00</p>
        <p>7</p>
        <p>i</p>
        <pb facs="00096780_0091" />
        <p>King's Singers Concert On November 30</p>
        <p>\ ECU News Bureau The Kings Singers, noted all-niale vocal ensemble, will aiqpear onstage at East Carolina Universitys Wri^t Auditnrium Nov. 30 at 8 p.m. The groups ECU performance is one of</p>
        <p>\</p>
        <p>approximately 100 scheduled for this season, including appearances throughout England, western Europe, the Far East and the United States.</p>
        <p>Since the groups formation in 1988</p>
        <p>at Kings College, Cambridge, the six-man Kings Singers have developed a diverse repertoire, ranging from very early madrigals and tradi-titmal folk srgs to cmitempwary pieces and modem popular songs.</p>
        <p>IN CONCERT NOV. 30 - Tbe Kings Singers, a six-man singing group from England, will perform at 8 p.m. Nov. 30 in Wright Auditorium. Ibe group is currently on a tour that will take them across the United l^tes., to the</p>
        <p>Far East, Europe and appearances in their home country. Tickets are priced at |12 for adults and $6 for youth higlHschool age and younger. Fmr mwe details and ticket orders, caU 757-6611.</p>
        <p>Included in their ECU concert will be a selection of Renaissance sacred music for the Christmas season, a set of five. Czech songs by Janacek, two English compositions created for the Kings Singers, and an open-ended Arrangements in Close Harmony, a selection of lighter pieces: folk songs and spirituals, standard evergreens and current pop songs.</p>
        <p>Members the Kings Silvers are countertmiors Jeremy Jackman and Alastair Hume, tenor Bob Chilcott, baritone/bass Colin Mason, barit(mes Simon Carrington and Bruce Russell and bass Stephen Om-nolly. All the men began their singing careers during boyhood, as choristers in British school and cathedral choirs.</p>
        <p>Tbe Singers U. S. tours have included repeat visits to the NBC-TV Tonight^ and Today shows and engagements on the PBS Evening at Pops series. They appeared on an On Stage at Wolf Trap TV broadcast earlier this year. The group has recorded more than 20 albums.</p>
        <p>The Singers will be available backstage for autographs and infw-mal meetings with the audience following their ECU concert.</p>
        <p>The Kings Singers concert is part of ECUs 1987-88 Artists Series sponsored by the Department of University Unions.</p>
        <p>Tickets for the general public are on sale at the ECU Central Ticket Office for $12 each ($6 for youth high school-aged and yo^er). Tickets may be purchased with major credit cai^ by telephoning (919) 757-6611, ext. 266, on weekdays between 11 a.m.and6p.m.</p>
        <p>Seats $2.25 Everyday Til 5:30 PM</p>
        <p>1:00-2:30^KK&amp;gt;-5:; CINDERELLA -O-</p>
        <p>PRINCE OF DARKNESS 7:00 4.0:00 -R-</p>
        <p>9!?</p>
        <p>1:00-3:00-5:00-7:00</p>
        <p>2:00-4:30</p>
        <p>9:00</p>
        <p>7:004:20</p>
        <p>TEEN WOLF TOO</p>
        <p>SUSPECT</p>
        <p>-FG-</p>
        <p>HELD OVER! -R- ii</p>
        <p>Berenger Rebounds After Layoff From Stardom</p>
        <p>By BOB THOMAS Associated Press Writer LOS ANGELES (AP) - After playing the killer in Looking for Mr. Goodbar, Tom Berenger became a hot ticket in the film world. Then with breathtaking swiftness, everything stopped.</p>
        <p>A couple of pictures Id done didnt make any money, the actor recalled. I had problems with agents and managers; I didnt feel they were doing their job. I finally feft them, but not soon enough.</p>
        <p>I knew casting peqple who had cast me in lead roles and good supporting roles, people I had even entertained in my house. I walked into their offices in New York, and it was like starting all over again. I looked around the room, and I didnt see any actors I recognized. After waiting a half-hour, I returned the script, ,and said, T dont think Ill do this today. I walked out, and Ive never seen them again. They lust didnt care anymore. Your stocks down; youre nettling. Its like any business: If youve spent so many years working (m it ana nobody wants you, its kind of rough.</p>
        <p>Thw want him now. After a two-year layoff, Berenger rebounded as the troubl^ TV star in The Big Chill and the rock star-tumea-teacher in Eddie and the Cruisers. A smashing breakthrough came with his Academy Award-nominated role of the scarred Sgt. Barnes in Platoon.</p>
        <p>Berenger currently stars in Someone to Watch Over Me. Its a difierent role for the 37-vear-old actor. He plays a marriea New York pdice officer who falls in love while guarding a wealthy socialite (Mimi Rogers) who has witnessed a murder.</p>
        <p>After Platoon, the creative minds of Hollywood naturally wanted to cast Berenger in other combat movies. He declined. Amazingly, he had never been cast as a cop. He was</p>
        <p>receptive when director Ridley Scott offered him the role.</p>
        <p>Its not the usual cop story, Berenaer said. Although hes a detective, its not in the traditional ic detective sense, like Popeye 7le in "rhe French Connection.</p>
        <p>domestic life, partners, bosses, etc.</p>
        <p>The bodyguard situation naturally results in close relationships, since the person being guarded beccnnes depoident. Police protectors are not supposed to engage in romance, but Berengers character does. Thats his fatal flaw; but if he had not done that, we wouldnt have a sUnry, would</p>
        <p>With customary thoroughness, Berenger spent six weeks of nightly duty with a New York detective, leaniing the procedures as well as the tedium. Eighty percent of an actors role is his homework, he said.</p>
        <p>Berenger is strongly built, with a handsome, cra^ mce and permanently tousled hair. He was born on Chicagos South Side to parents who grew up in the Depression.</p>
        <p>a film actor is between 35 and 45, he said</p>
        <p>When he read the Platoon script, he immediately signed on.</p>
        <p>The Vh weeks of jungle training was lust fabulous, oe said. It got an of us to know each other, our military rank, our character names, mir functions and assignments in the platoon. In a real fast crash course we had to learn quite a bit.</p>
        <p>Previously I had read about 26 Ixxte and talked to a couple of fnends who were Marine grunts in Vietnam. I also talked to a number of guys at Parris Island Marine base. It aU added up, Berenger said.</p>
        <p>Before filming there were a ni  _</p>
        <p>out of Pltoon. Either they didnt want to do itFtHr. their agents or the moms didnt want them to. I think they regretted it.</p>
        <p>Even for people who had the smallest parts it was a hell of an experience. Many of us became close friends. Out of the 30 actors in the cast, about 19 of us stay in touch and together now and ttoi. Thats</p>
        <p>Lisa, make their home in South Carolina.</p>
        <p>I dont even have a studio apa ment in Hollywood, he said. I dont want to do that, because then Id belong. I dont want to get entrenched here.</p>
        <p>In fact, a lot of my films have been made in Third Wixrld or other</p>
        <p>foreign countries. I could probably live anywhere. My wife is from South Carolina, and I like the area. I could</p>
        <p>have moved her to New York, but I needed the cl^e.</p>
        <p>Funny thing, as soon as I moved to South Carolina, I started working again.</p>
        <p>IKWOCOLOR'</p>
        <p>&amp;lt;4mmt* wgr*nwinuw</p>
        <p>rmmiG march zs rOX</p>
        <p>oeiure iunuii(i mere were a  .  ... ,</p>
        <p>number of young actors who dropped  Long Wait</p>
        <p>9ut of Platoon. Either they didnt</p>
        <p>throu^ life one day at a time until you (he; Ive fought that philosophy all my life, the actor once said.</p>
        <p>Acting in Whos Afraid of Virginia WoolfT at the University of Missouri helped inspire Berenger to try New York. He studied with Uta Ha^n and Herbert Berghof, acted in'off-Broadway plays as well as the opora One Life at a Time. That to TV films (John^, We Hardly Knew Ye,Flesh and Blood,Tomorrow Never Comes) and movies (In Praise of Older Butch and Sundance: The</p>
        <p>1 to do even in a movie with four characters.</p>
        <p>Like many of todays film actors, Berenger chooses not to live in Los Angeles. He and his second wife.</p>
        <p>SANTA MONICA, Calif. (AP) -Actress Sally Kirkland, playing lead role in the movie Anna, sai producer David 0. Selznick told her when she was a 17-year-old apprentice that shed have to wait until middle age to be a star.</p>
        <p>Now 43, Miss Kirkland, who has over the years played ofi^ite the likes of Robert DeNiro ana made TV guest appearances shed rather forget, muses that Selznicks advice may have been a self-fulfilling prophecy.</p>
        <p>WfM</p>
        <p>Mr*</p>
        <p>V</p>
        <p>1:00-3:00-s:00-7:0p-9:00</p>
        <p>\ Freshmen have always had trouble adjusting to ooUege life.</p>
        <p>But never like this.</p>
        <p>e PLAZA CINEMA</p>
        <p>PLAZA</p>
        <p>MALL</p>
        <p>756-0088</p>
        <p>r</p>
        <p>SAT.-SUN. MATINEES ONLY $2.50</p>
        <p>Early Yeare,The Dogs ofWar).</p>
        <p>Borenger returned from his two-year enle - during which he also underwent a divorce  with a new maturity. I figure the best time for</p>
        <p>EROTIC, BIZARRE, EXOTIC MAKES THE LOST BOYS</p>
        <p>LOOK LIKE TINKERBELL</p>
        <p>JAY scon, TORONTO GLOBE &amp;amp; MAIL</p>
        <p>NEAR DAR</p>
        <p>DAILY 7:00 &amp;amp; 9:00 -R-SAT.-SUN. MATINEES 2:00 &amp;amp; 4:00</p>
        <p>Our</p>
        <p>Thanbsgiving  ^</p>
        <p>Buffet  *</p>
        <p>isii'tjust for the birdst</p>
        <p>A hair-raising comedy</p>
        <p>starring Jason Bateman.</p>
        <p>She gets kidnapped.</p>
        <p>He gets killed.</p>
        <p>But it all ends up okay.</p>
        <p>PrncesQ</p>
        <p>BRIDES</p>
        <p>uiiK mum</p>
        <p>Nsaa-ESH om- MB AMW ESUBBHC  JKm</p>
        <p>josm in INwnin  TN9IR IRK</p>
        <p>AHmm</p>
        <p>"K.I*</p>
        <p>kiOiUiabtllKiHi</p>
        <p>(W.f  '1,1</p>
        <p>It 8 a fiUed-to-the-brim cornucopia of delicious delights. Not just turkey and your favorite trknminks, but table after table of hand carved roast beef, ham and all the appetizers, salads, vegetables and tantali^nk desserts your hungry pilgrims could hope for.</p>
        <p>Join us Thankskivink Day fro*n until 3KX) PM. Adults $9.95, children 12 and under $4.95, children 6 and under eat free.</p>
        <p>DAILY 7:00 &amp;amp; 9:05 -PQ- SAT.-SUN. MATINEES 2:00 &amp;amp; 4:05</p>
        <p>This holiday season you have... N</p>
        <p>a date with romance, cwwdy, magic^!^</p>
        <p>anda...</p>
        <p>For Reservations Call 355-5000</p>
        <p>HILTON INN</p>
        <p>207 S.W. GrMnvills Blvd./355-)000</p>
        <p>IkTEiiANiXL</p>
        <p>DAILY 7:00 &amp;amp; 9:10 -PQ-L SAT.-SUN. MATINEES 2:00 A 4:10</p>
        <p>$1.50 ALL TIMES</p>
        <p>WEEKDAYS 7:00 A 9:00</p>
        <p>SAT. A SUN. 2-4-7-9 -R-</p>
        <p>752-7649</p>
        <p>UCTOWN C.Ht f NVILI f</p>
        <p>Its the last game \ ou II e\ cr play.</p>
        <p>2:00-4:30-7:00-9:20 HELD OVER! 2ND SMASH WEEK!</p>
        <p>Shes a tawyer who broke two lows of her profession...</p>
        <p>CHER DENNIS QUMD</p>
        <p>susPEcr.s</p>
        <p>EVENINGS ONLY: 7:00-9:00</p>
        <p>PRINCE 2F It is evil. DARKNE^ It is real.</p>
        <p>COMING WED., NOV. 2STH PLANES, TRAINS &amp;amp; AUTOMOBILESI</p>
        <pb facs="00096780_0092" />
        <p>/</p>
        <p>I&amp;gt;.16 The Dally Reflector. Greenville. N.C. Sunday. November 22.1^ .First Female Panelist Has Returned To parolina Today</p>
        <p>By JERRY RAYNOR Reflector Staff Writer DiAnne Bowen is back on the Carolina Today television show, cthhosting with Slim Short the daily weekday two-hour show.</p>
        <p>I was the first female panelist of the show, and Im delighted to be badi in Greenville and with the show again, she said.</p>
        <p>A native of Windsor in Bertie County, Miss Bowen holds degrees from East Carolina Universtiy and is wffiT^ (m her masters at the University of North Carolina at Chapel Hill in the field of radio-televisition c(Mnmunicafi^. Ilie attractive, tall - 5-foot, 8-inches - dark haired Miss Bow won several beauty cinnpeti-tions, including that of Miss North Carolina.</p>
        <p>Ive always been attracted to per-fonning and broadcasting, she said. I think it must run in my family. My older sister has a d^ree in theater and drama. I have two other sisters and a brottier, and all of us are to an extt acting hams.</p>
        <p>In the years that have passed since Miss Bowen was first on Carolina Today, ^ has be engaged in a wide range of thtrical, television c(Hnmercial, a movie role, fashion and travel activities.</p>
        <p>age. As a 4^ stiidt m hi^ sd she became an internatial ex-</p>
        <p>dange studt to Holland. Oos as ai</p>
        <p>Other early honors included North Carolina winner at a national 4-H conference in Chicago, receiving The Rotary Outstanding Yth Award,</p>
        <p>Conference, she worked with President Richard Nix, the secretary of agriculture and congressm as a ywth leader.</p>
        <p>pet^e, and with the travel that goes along with meeting people, with rep-restng groups, she said. This</p>
        <p>as the female yth to serve  Natioinal Eltric Development Committee.</p>
        <p>An avid traveler. Bow has traveled in various capacities to Europe  numerous occasions, touring 14 coimtries as well as areas in Mexico and Canada. Norway is one pf my favorite places, she said, m far. Ive be there more than a dozen times. I love the crisp cleaness of the country, its magnifict nigged sce-</p>
        <p>nwy.</p>
        <p>At Chapel Hill, I was one of six firom 6,000 applicants chos by the Irish government for travels in Ireland^ she said. That trip was definitely a highlight of my travels. We traveled througlMMit the country, oferenceandi</p>
        <p>would be required to indi-</p>
        <p> ^ list the accomplishmts</p>
        <p>achieved by DiAnne Bowen. These include fashi shows, TV oiKamera commercials, theater roles at Chowan College, Mars Hill College and UNC-Chapel Hill, and assi^-ments with the travd industry, including writing and publicity work.</p>
        <p>Her most rect achievemt was that Of a role in the movie Shag, produced Ity the DeLaiirtis studio m Wilmingt. I understand its to be released in Febraury, she said.</p>
        <p>Toudiing  pleasant memories, ^ said I have very fond recol-I witti artist Sarah Greville while she</p>
        <p>my portrait. She is such a _. jly, chainning person. Every time I wt for a sitting, she always served tea and her special homemade lit-tlecakes.</p>
        <p>Im really delighted and consider</p>
        <p>myself fortunate to be back in Greville, she said. Evtually^ my big dim is to own a travel agency of my own, to hopefully have a successful career in the travel</p>
        <p>NEED CASH</p>
        <p>INSTANT LOANS-FENCED SECURITY , AREA FOR LARGE ITEMS</p>
        <p>SOUTHERN GUN &amp;amp; PAWN INC.</p>
        <p>'JCO OALA  500  North  Greene  St.</p>
        <p>Greenville</p>
        <p>tions. Ill never forget the warm ^ cie the government ai^ the Irish people gave us.</p>
        <p>DIANNE BOWEN</p>
        <p>Hollywood Makes Apartheid Movie</p>
        <p>By BOB THOMAS Associated Press Writer LOS ANGELES (AP) - In 1983, Richard Attenborough won the Academy Award for Gandhi, the result of his 20-yr effort to film the</p>
        <p>Tn/lino  laa/lar</p>
        <p>iif^story of Indias martyred lder. ~   "[liversal PicI</p>
        <p>This monUi Universal Pictures is releasing Cry Freedom, a $20 mil-li epic about the struj^e against apar&amp;amp;id in South Africa. It stars I&amp;amp;vin Kline as crusading editor Donald Woods and Denzel Washington as Uie black lder Stephen Biko.</p>
        <p>Attenborough, 64, made his film debut as a sailor in Noel Cowards 1942 film In Which We Serve. He continued as an actor after Ip wartime service, then turned to directing in the 1969 with Oh! What a Lovely War. His other films as a director include Young Winston,A Bridge T Far,Magic and A Chorus Line.</p>
        <p>In Hollywood for the opening of Ciy Freedom, Attenbonwgh talked abt his latest project in an interview with The Associated Press.</p>
        <p>Q. What was your purpose in making Cry Freedom?</p>
        <p>A. I wanted to reach pple who are unknowing, indifferent,  actually antagonistic, to persuade them that they can no longer ignore what goes in Stii Africa.</p>
        <p>Q. How do y balaiKre drama with the obvious message?</p>
        <p>encapsulated in its own time frame - it would stand the test of time -and it also had the entertainment qualities. It had the triumph of the human spirit; it didnt end in total disaster.</p>
        <p>Q. Was the film as difficult to finance as Gandhi?</p>
        <p>A. Oddly enough, I dont think Ive ever madfe a film where the money</p>
        <p>A. Its very difficult. The problem always is that if y make an essen-j tially documtary film which is go-^ ing to play in the art hoi^ and thus lMrch to the cverted, thats fine. But I think its a waste of time.</p>
        <p>Tte peq&amp;gt;le I want to reach are those wto tove never even csid-ered the whole question of Sth Africa. In order to do that, y have to make a film that is fundamentally Im in the entertainment business; Im not a politician. ... I make movies for millions of people all over the world.</p>
        <p>Q. Was Cry Freedom a long project for y?</p>
        <p>A. It was a lg project in the cooking, in that I tried to make a film on apartheid in Stii Africa in the late 1950s. I bought a number of subjects and commissioned scrnplays, but I never found one that was sufficiently entertaining.</p>
        <p>After the showing of Gandhi, this remarkable man, Donald Woods, st me his bi(^aphy of Steve Biko and Woods autobiography, Asking for Tnnible. For the first time, I thought there was a story that was</p>
        <p>C </p>
        <p> T</p>
        <p>4 Wynnes Inc.</p>
        <p>Tours and Travels</p>
        <p>RL I, Bt)x 463-A Wliitcrvillc, M.C. 28590</p>
        <p>r</p>
        <p>Q LOVE TO SNOW SKI?</p>
        <p>Then Join Jimmy Wynne Of 4 Wynnes Trnvels For Day Trips And Overnight Trips (Beginning In The Middle Of December) To: Wintergreen, Massanut-ten &amp;amp; Winterplace Monday, Wednesday &amp;amp; Friday &amp;amp; 3 And 4 Day Trips Transportation, Lifts, Continental Breakfast Ski Rentals, Lessons ^</p>
        <p>Call &amp;amp; Sign Up Today Also* Utah Trip in February Join Snow Ski Express 919-355*5611 Your Ski Connection N.C. Watts 1-800-426-4091</p>
        <p>Remember</p>
        <p>TOP TUNES 56 YE ARS AGO Your Hit Parade November 20,1937</p>
        <p>1. VieniVieni</p>
        <p>2. Y Cant Stop Me From Dreaming</p>
        <p>3. Once In A While</p>
        <p>4. Remember Me</p>
        <p>5. Blossoms On Broadway</p>
        <p>6. I Still Love To Kiss YCtood-</p>
        <p>night</p>
        <p>7. That Old Feelini</p>
        <p>8. HItsTheLast'</p>
        <p>9. Harbor Ugh</p>
        <p>10. Roses In December</p>
        <p>IDo</p>
        <p>came more easily. I went to see Frank Price, who had moved from Columbia to Universal. After the usual pleasantries, he asked me what I wanted to do. 1 said I wanted to do the Donald Woods stories. He said he knew the stories, which had been at Columbia, and he asked who I wanted to write the script. I said Jack Briley, who wrote Gandhi.</p>
        <p>He asked, How much will it cost? I said, I dont know, maybe $20 milli. He said, If yw get the right script and its $20 million, y have the money. (Laughing) I was nev so amazed in my life.</p>
        <p>Q. Did y face any problems in shting?</p>
        <p>A. Nothing significant. ly real ccern was security. We filmed in Zimbabwe, which is one of the front-line states facing South Africa. Consequently, my wife and I had armed guards all the time. When we went t to supper in the evening, we had someone sitting at the next table. Armed guards were  all the sets.</p>
        <p>We learned from the government at the end of the picture that there had been four incursions from Sth Africa in an attempt to destroy sets and that sort of thmg, but we were not aware of that.</p>
        <p>Q. Have you visited South Africa?</p>
        <p>A. Only once. I agreed to go for the premiere of Gandhi, omy if the audiences were not segregated. I think the government tried to cht me. They said the audiences would not be segregated, but that was only in the theaters where the premieres were. So I didnt go.</p>
        <p>But I went wim my wife in 1984 to see as many pple as I could, because I hadnt decided abt making the film. I felt it essential to see Steves widow. If she didnt want the film made, I wouldnt do it. Fortunately, she was enthusiastic and said she would like the story to be based the books of Donald Woods, one of Steves closest friends.</p>
        <p>Eventually, (the government) did a sort of character assassination on television. I was told to lve the cotry since I was financed by Moscow and was a card-carrying member of the Communist Party. (Laughing)</p>
        <p>FURNITURE</p>
        <p>&amp;lt;S</p>
        <p>MATTRESS MADNESS</p>
        <p>OVER 300 SETS MUST GO!</p>
        <p>ALL AT WHOLESALE AND BELOW SERTA PERFECT SLEEPER</p>
        <p>(IN SETS ONLY)!</p>
        <p>Ai</p>
        <p>TKD. PR.</p>
        <p>SALE</p>
        <p>TWIN SET</p>
        <p>480</p>
        <p>196*M</p>
        <p>FULL SET</p>
        <p>600</p>
        <p>28730 1</p>
        <p>QUEEN SET</p>
        <p>750</p>
        <p>344</p>
        <p>KING SET</p>
        <p>990</p>
        <p>437~ 1</p>
        <p>MI  </p>
        <p>Maxwell</p>
        <p>FURNITURE</p>
        <p>S/'</p>
        <p>IN STORE FINANCING 90 DAYS SAME AS CASH</p>
        <p>9</p>
        <p>604 Qreenville Blvd.</p>
        <p>(Krogr Shopping Contor)</p>
        <p>Phone 756-3142 i</p>
        <pb facs="00096780_0093" />
        <p>n v^-</p>
        <p>I'l "i </p>
        <p>This year is the 3Qth anniversary of Sputnik 1, the first artifact of the human species to orbit the Earth. It is also the 25th anniversary of Mariner 2, tlie first spacecraft to explore another planet. These two achievementsone Soviet, the other American mark a new age of exploration, a new direction for our species: the extension of the human presence to other worlds.BY CARL SAGAN</p>
        <pb facs="00096780_0094" />
        <p>DidGeorge Shultz, Secretary cf State, ever work as a ffgoh in Chicaga under die name ofRiiuddo Shultz?F.E., MenbPorKCal^.</p>
        <p>Wumut^du</p>
        <p>4 No, but under the X^name Geoige ftatt Shuhz be was dean of the Gradate School of Business at the University of Chicago, 1962-68.</p>
        <p>HawmanyUS.xrvUxmendiedmVietnm, and did the actor John Wayne ever participate in dut war or any odier war as an officer or</p>
        <p>enlisted man?^ffD., Owings Mills, Md,</p>
        <p>A About 58,000 U.S. servicemen died in  Vietnam. The late John Wayne, who was bom in 1907 and fstheied seven children, never participated in any real war as an officer w enli^ed man.</p>
        <p>pucu Ui aujr tvoi wsu w as  w.  ~</p>
        <p>He was either too old or had too nMuiy dependents</p>
        <p>Miliia fiit mimkUm hUkn liMif hwaiwp</p>
        <p>J Can you give a progress report on the ro-manee between actor Rob Lowe and actress Melissa Gilbert?Karen Stewart, Dayton, Ohio</p>
        <p>.4 At this writing, tiicy have decided to go tfir l\j$sepanSt ways. But don't count on it being permanent. They are a capricious couple, it seems, in matters of the heart.</p>
        <p>Patty Pidia hag awrhayWiadPaaigfnai Jr. la 1970: MaMlaqrhlttlMiMf-HRlligaadraaaoB</p>
        <p>Many petle, myself included, have read diat Patty Duke gave birth out cfi^dlock to a stm as a remit of her affair widi Desi Amaz Jr. Thafs why Desfs mother, Lucille Ball, treated Patty so dhUy. then did you write dust John Astin, the actor wfum she later married, is the fadier of her son? Why cant you tell it as it is? Pam Rogers, Las Vegas, Nev.</p>
        <p>HowmanyffthemenseekingthePresidential MC# nominationaremarriedtopl^tsiciansandho^</p>
        <p>many to lawyers?Lainey Brown, Bikm, Miss.</p>
        <p>4 Noneofthecontendersismanriedtoaphysi-XX.*cian, but four are married to atttuneys. The lady lawyers are Hattie Babbitt, Elizabeth Dole, Elise du Pont and Jeanne Simon.</p>
        <p>(I</p>
        <p>Is Jovanka Brox the big, buxom</p>
        <p>beauty who was married tothelateMarshalTitoof Yugoslavia-^aliveordead? Was she his fourth or ffdi ffe?P. Dughovich, Cleveland, Ohio</p>
        <p>4 When Patty Duke was 23, she began an j[\ affsir with Desi Amaz Jr., who was then 17 but told her he was 19. When the actress later leunedhow young he really was, ^could understand Lucille Ball's ang^. b her best-sellmg auto-biogiaphy, tbll Me Amia," Patty, now 40, writes: *T&amp;gt;urmg my period  hidmg after that initial break</p>
        <p>(fiom Desi], I'd met and had a brief secret affair</p>
        <p>wib John Astm. lb was separated from his wife and children, but te was still married, and when he told me he was gomg back to his family, I bought</p>
        <p>.1* ...... *1.^ m,m.A i* T /.rtaiftltf AiAr%*t Irnmir</p>
        <p>4 Jovanka Broz, 62, i\j bird wife of President Tito, is alive m Belgrade, where the govern-</p>
        <p>Rnl lab kvaaka, 1963</p>
        <p>viavav</p>
        <p>ment reportedly holds her m low light because she seeks to inherit Titos private property. As a member of his housdiold, ^ nursed Tito brou^ a bad</p>
        <p>gallbladder illness. He subsequently married her m 1952, dumped her m 1977 and died m 1980.</p>
        <p>that was the cad of it.. .1 certainly bdnt know that just before we'd split up 1 had conceived our son... 1 assumed at first the baby was Desi's, but whmi I became more clearheaded and careilly counted the days, 1 realized the timmg was off. It had to be Jobi's." For further dettdls of Patty Duke's ttormy, incredibb life, her periods of manic depression and her turbulent times of success and feilure, we recommend bat you read her book.</p>
        <p>Dmm Maibi Md Llia MmmM: OM</p>
        <p>tonriMsh</p>
        <p>QI heard that years ago Deem Martin signed  Uza MinneUi to a contract giving him 50% of her earnings for Iffe. Why would Uza sign such an unfair contract?^.P., Scottsdale, Ariz.</p>
        <p>A The rumor has been circnlatBd for at least two decades, but there is no trub to it. Martin never offered Minnelli any such contract</p>
        <p>tmaascmner</p>
        <p>PARADE</p>
        <p>A rauiaa,CManHW ania.ayiirw&amp;lt;inw nnaoir.rMiMiiiW aniwcrHPiooir.iwwmniM</p>
        <p>WMimmnini iiiiiTiim MeisawBaiM.taVMk cBHiasruiMi.iMiiMr</p>
        <p>Kiaaaniwaaswanwa.siiiMCwiiitiiiiaimhW*in.awiniciw mmcmwmm,uwumim mau.tmttmum,uuutm rnncmwnmrmcmrmum mnmwnm.nmu9Laik nimiMnaiMiMmM</p>
        <p>awiiHi iwinr, Wwit imir. um  iiwM  ari.  tow  nitimri.  wtiiiiacnM.  m  cimwi.  on*  aw!,</p>
        <p>-----iMMiiiaM.iwii a, riiii Willi rawaiii nwiiMiriiiiiiimiiiiii Trm'imiTTii Brtiiiirtiiii iiiintiin</p>
        <p>THE SUNDAY NEWSPAPER MAGAZINE  uromionee.EWh6w</p>
        <p>NOVEMBER 2 2, 1BB7</p>
        <p>mil iMnnnr niim r^iiOiT  imiiw  ctia.  mm  wm.inuu Eumm.mmaun, Hmwu mnw, ium</p>
        <p>MbaM^IMIIMMl.nHM. MalWMla. lMiMMir.lM%  nM. NriwNMi, hkMiUW</p>
        <p>wiinamai  ......  *r----CMniTMainn.sirChMri,MaFiMh sntnomii,awiS*M</p>
        <p>nmnUmiun,n.tma.</p>
        <p>kiWMMltoMmWito</p>
        <p>meimwiiLii -  wsmwawi  MmanwiaHSWi  c(iaiiMiniwa.niwt  muiioaoniis,ifcwwi.aMM</p>
        <p>luw, aw* a * iwwWi &amp;lt;</p>
        <p>(Uw&amp;lt;lkMnK</p>
        <p> I I</p>
        <p>MM 2  NOVOm tl. tW7  PAMK MMMZME</p>
        <pb facs="00096780_0095" />
        <p>MMNng lovable, wann*heeft8d Heify laatumlng point for the Hendereons, In this hlarlous comedy for the whole fanNy</p>
        <p>MOmL</p>
        <p>nvicn</p>
        <p>Monty Pyttwn alar ' Terry Janes and jIugeMMtBrateam up tor this ribald comedy ^</p>
        <p>NOVWIHMi M</p>
        <p>SUPERMAN 4 ^Superman</p>
        <p>V0W810 rid the world of nudear weapons and faces two forrnidable foes; arch-criminal Lex Luthor and his radialion-chaigsd creation Nudear Man. whoee powers match Supermans. Stars CMstooherfeww, Qene</p>
        <p>t  Hackman,MargotKldderansi</p>
        <p>mmmam Marfs/fMnpway</p>
        <p>$29.98</p>
        <p>mCEGLAm: Hfror .</p>
        <p>lARDSnHD-The</p>
        <p>Suparslarsl</p>
        <p>Another coNecUon of daaaic</p>
        <p>pegmanoes.</p>
        <p>$19.95</p>
        <p>jompp-A</p>
        <p>classic waatam adventure. Slam OkHEastwood, RobertDwaKan JohnSamn.</p>
        <p>iwm</p>
        <p>ASiUUOl)</p>
        <p>LSlHALVIAPOll  BUMDnm-</p>
        <p>-WNhOarmy</p>
        <p>QtoverandMWQdh Broce Wife pair up sonastwoLA  for pandemonium In</p>
        <p>cope. One carries a  thishiarioy</p>
        <p>weapon... one la a  comedy</p>
        <p>I 9fUf</p>
        <p>$29.98 sum or TUB</p>
        <p>JBMIhegreel-marvmrnnr</p>
        <p>adventure of them al. Mrodudng the furry Mendy and IsroeEwola.</p>
        <p>m</p>
        <p>f</p>
        <p>$29.98</p>
        <p>JBWELOrTHB</p>
        <p>miB-Enioythis excHing sequel to</p>
        <p>ROIMnCnlB uW</p>
        <p>MIchaBi Douglas, Kalhloenkimerani DannyDMto. .g 3P'</p>
        <p>mmrnmm</p>
        <p>Asearingtaieof white slavery murder... and vengeance. With Nancy AKen.iadShaoksl-fend and Martirr Landau.</p>
        <p>MBBICARIIIIUA 3The Confrontation. The iMmate</p>
        <p>A---i---**  --</p>
        <p>Mnonctniignang machine la back wNh non-stop, knock-out adlonl</p>
        <p>tAfeak</p>
        <p>Wnn mKnam</p>
        <p>DuMt.</p>
        <p>JBtaSm</p>
        <p>ir'-Vri</p>
        <p>i</p>
        <p>$19.95</p>
        <p>THBBBSrOr</p>
        <p>cmrcBASB-</p>
        <p>Chevy his friends Md the entire SOS' UPdaylSgMUve</p>
        <p>___A  MM  -  -  &amp;gt;--</p>
        <p>GCRwiiOnmmn</p>
        <p>youl</p>
        <p>IQNMAR</p>
        <p>$39.95</p>
        <p>JAHBromMS-WOBIOUTWITH WB10HTS-A90 minule prrrgraaaive resiatanoe weight trtening program with Dan teaecson.</p>
        <p>ALL RIGHTS RESERVED 1967 coiayrrRow CORPORATION</p>
        <pb facs="00096780_0096" />
        <p>WE MUST OONIMUETDBE</p>
        <p>TbtfiwliwttftlMMarSrilM.</p>
        <p>fcgrfiliipiwliMiflliHn.iiilili</p>
        <p>M9mM to hMt M MMMtf NiM</p>
        <p>RrafMk IHIm M bt fMtod tor tkt</p>
        <p>nlttMtoJtopNllMtlyto|ifir2, ItotoMllMtagnMipMMiifttoMi toe bulk m el towteM plwtoif opMiiellMSm</p>
        <p>BY CARL SAGAN</p>
        <p>KNOW WHERE I WAS WHEN THE SPACE AGE BEGAN. In eariy October 1957,1 was a graduate student at the Univosity of Chicago, wcnking toward a doctorate in planetary astronomy. The previous year, when Mars was the cltraest it ever gets to Eardi, I had been at the McDonald Observatory in Thxas, peering through the telescope and trying to understand something of what our neighboring world is like. But there had been dust storms on both planets, and Mars was 40 million miles away. When youre stuck on die surface of the Earth, those other worlds re tantalizing but inaccessible.</p>
        <p>I was sure that someday spaceflight would be possible. 1 knew something, about Robert Goddard and V-2 rockets and Project VanguaM and even Soviet pRMiouncementseatlierinthe 1950s about their ultimate intentimis to eiblore the planets. But despite all that. Sputnik 1 cau^t me by surivise. 1 hadnt imagined diat the Soviets would beat the United States to Earth orbit, and 1 was startled by the large payload (which, American conunenUUors claimed, must have been reported with a'misplaced decimal pointV Here the satellite was, beeping away, eff&amp;lt;tlessly circling the Eaito every 90 minutes, and my heart soaredbecause it meant thai we would be going to the planets in my lifetime. The dre^ of visionary engineers and writersTsiolkovsky, Goddard, von Braun, H.G. Wells, Edgar Rice Bur-roi^iswoe about to he fulfilled.</p>
        <p>%s year is the 30th anniversary of Sputnik 1, the first artifact of the human species to orbit the Earth, ft is also the 2Sto anniversary of Mariner 2, die first spacecraft to rplore another plairet. iiiMe two adiicvaiicnts&amp;lt;c Soviet, the other Americanmark a new age of exploration, a new direction for our qiecies: the extrasion of diehuinan presence to other worids.</p>
        <p>We have always been explorers. It is part of our nature. Since we first evolved a millitm years or so ago in Africa, we</p>
        <p>have waMned and explmed our way across the planet. There are now humans on every oontinentfrom pole to de, from Mount Everest to die Dead .jaon the ocean bottoms and in resi drace 200 miles up in die sky.</p>
        <p>The first large-scale migration from the Old World to the New happened during the last ke age, around 11,500 years ago, when the growing polar ice caps shallowed the oceans and m^ it</p>
        <p>possibte to walk on dry land fnnn Siberia</p>
        <p>to Alaska. A thousand years later, we were in Tlena del Fiiego, the soudiem tip of South America. Long before Co-lundws, peojde from Borneo setdec</p>
        <p>Madagascar, off the African coast;</p>
        <p>die Westnm Pacific; and a ^eat fleet of</p>
        <p>cammmxAmctiOSMcmmJETm)PuumuBOM&amp;lt;m</p>
        <p>China crisscrossed the Indian established a base in Zanzibar, roundec die southern dp of Africa and entered the Atlantic Oc^. In die 18di and 19th centuries, American and Russian exploren, traders and settlers were racing</p>
        <p>F*eE 4  IIOieeKl 21, 111?  IIIWDE WWZWE</p>
        <pb facs="00096780_0097" />
        <p>tallWH</p>
        <p>The visioiis we present to our children siHMie the future. They hecome selMiilfilling prophecies.</p>
        <p>Dreams are maps.</p>
        <p>west and east across two vast continents to the Pacific. This exploratory urge has clear survival value. It is not restricted to any one nation or eduiic group. It is an endowment that the human species holds in common.</p>
        <p>At just the time when k Earth has become almost entirely explored, other wtvlds beckon. The nations that have pioneered this new age of exploration</p>
        <p>AMEMCMN</p>
        <p>EXPUNWnONOF</p>
        <p>1WSCNJWSVSIEM</p>
        <p>iMSKAawnmiKroFMi</p>
        <p>ltoiiiliiwplM&amp;lt;l wplinWM lN2-7l-aM RaH^ Un</p>
        <p>sssss^as'</p>
        <p>AMiteM alMiM hM bMi</p>
        <p>iHMMaiMtltTS.</p>
        <p>pnMK MttiZME  NOWEMn 22. IM7  PNAE S</p>
        <p>are the Soviet Union and the United Statesnnotivated nationalistically. of course, but serving as well as the vanguard of our species in space. Their combined achievements (see box, next page) are the stuff of legend. We humans have sent robots, tfien animus and that ourselves above die blue skies of Earth into the black interplanetary void. The footprints of 12 of us are</p>
        <p>scattered across the lunar surface, where</p>
        <p>they will last another million years. We have flown by some 40 new worlds, many of them discovered in the process. Our ships have set gently down on</p>
        <p>scorching Venus and chilly Marsreturning imagK of their surfaces and searclwg for life. Once above our blanket of air, we have turned our telescopes into the (^iths of qiace and back on our small planet tosee it asone interconnected and interdqpendent whole. We have launched artificial moons and artificial planets, and have sent four spacecraft on their way to the stars. .</p>
        <p>From die standpoint of a century ago, these accomplishments are Ines^tak-ing. From a longer perspctivc, they are mythic. If we manage to avoid self-destruction, so that there are future historians, our tme will be remembered in part because this was when we first set sail fw other wcdds. In the long run, ^ we strai^ten things out here, there will be more of us up there. There will be robot emissaries and human outposts throughout the Solar System. We will become a multiplanet species.</p>
        <p>We arc not motivated by gold or spices</p>
        <p>or slaves or a passion to cwivert the</p>
        <p>heathen to the ()ne TVue Faith, as were</p>
        <p>continued</p>
        <p>apaatiblt</p>
        <p>acaMftwKli*Mijlr21akeMrtmy.</p>
        <p>Mifciaaf iclinri haadafitiwwia. WharW</p>
        <p>-MMF.toadb^ii</p>
        <p>^ H  , linden Mahwan,tWi</p>
        <p>i|Winnailalipafiiirf -WM...  -jtMftolMtUn</p>
        <pb facs="00096780_0098" />
        <p>EXPVUmSconHnued</p>
        <p>the European explorers oi the ISth and 16th centuries. Our goals includeexplo-ration, science and techiK&amp;gt;lQgy, national (xestige and a rect^ition that die future is calling. There is a veiy practical reason as well: We can take better care of the Earth (and its inhabitants) by</p>
        <p>it widi Mher w(dds.</p>
        <p>But whatever our reasons, we are on our way. We advance by fits and staits; there are detours and failures of nerve. The kxig-temi trend, thou^, is clear. It is getting cheaper and easier to go into space, and there is progressively naore for us to do there.</p>
        <p>Only a handful of nations have access to space at the moment, but their nuniber is increasing. France and China are now lifting commercial payloads for a profit. Japan and the European Space Agency, in 1986, mustered their f^, extremely successful missitms info inteiplane^ space. There will be other spaceforing nations in the next few decades. Others may lose their determi</p>
        <p>nation and dieir vision, as did Portugal, which tiailblazed the great sailing-ship voyages of discover uid dien gradually sank into obscurity. Unhappilyastonishinglythe United States may become the first nation to hack off from die expknadon of space.</p>
        <p>Affceraconceited, systematic and his-fork setof missionsfoodier worids^-in-cluding the close-up leconnaissaiice of eveiyuanetyoucan see in the night sky die United States has sin^y stq^. There were 24 American missions in the 1960s (see chart, bottom of preceding page), 14 in the 1970s, but not onenot a sii^ spacecraft to the Mom or the planetssince 1978.</p>
        <p>This about-face is not mainly due to die tragic exidoskm of the Space Shuttle ChaUenger m January 1986: Such qce missions require many years from approval to irnplementadon; the explora-ttny decline m NASA began in die late Nixon Administradon. Itl^ continued through the Carter years and deeply worsened under Rea^. In the latest</p>
        <p>NASAbudget, the total funds requested are up 12 percent ovCT the previous fiscal year(mahily to fix the Slnitde),but die</p>
        <p>percent. In 1982, for the first dme in American history, milittuy expenditures inspaceexceededcivilianexpenditures. Ibday they are about twice as large.</p>
        <p>Arid yet this American retreat from expknadon could be reversed if there were real interest at the top or if the continuing public enthusiasm for space exploration were clearly voiced. As the Shuttle is reconfigured and retested, we need a fleet of large, expendable launch vehicles so we never again put all our launch eggs in one basket. The U.S. space stadon should be redesigned for exploratory objecdves. The great robot expkuers sitdng in laboratories for years dwuld be launched: Mallan, the radar miqiper of Venus; Galitoo, the Jupitermaumm</p>
        <p>MariKcialaahnaafflwiBrtk</p>
        <p>npiiakl,ttsn</p>
        <p>fM tM h apaea ISpM % 19571 nalipaeacraltfoaaeapaftwifta Eaittb 0mi|p|MMa 1,19591</p>
        <p>Rnl aiflleial plaast af lha 9m (Lna 1,</p>
        <p>UNWIPSWIES  S</p>
        <p>fimtadanlifctopyfospaca Vaa Mba laialliii baft (EsplQiirl^ 19591 finttalavMBB hMias af tha Mlh ftab</p>
        <p>Ural foMacramatapact aMlhirwsiM</p>
        <p>IbMilim</p>
        <p>nalapaaaoatla phalaiaili fta far alia</p>
        <p>M laaaM hi apaoa (WHbk 1,19611 iMlMaMfoaibftllKEarfb ftMakl,Ml</p>
        <p>FhHapaeeenlHafor Ip aflwr phaab (Ma].196l;lhnl,1962) fhalaaMibapi6a flbabk6^19631 IMI aaiQpanaa apaea aibaa flbahhail.1964)</p>
        <p>Hnlapaoa asir (IbaMM 2,19651</p>
        <p>fm OTBjr M9 lOT  otmOTT</p>
        <p>Plaaatl6aaafa3,l9661</p>
        <p>wLtoa^lW*^^</p>
        <p>nrit spaiaiinittaaiMI aaallarwaili</p>
        <p>llMa]9bl9p</p>
        <p>flat lal* aiifta la  aiaaiii twai</p>
        <p>aas6sraariittaM%19Hll HiHiaibgwmfa M MblirMdi</p>
        <p>OumI^MI</p>
        <p>Fnsl aab laaibg aa aaaHar plaaai</p>
        <p>abn3,1971|</p>
        <p>HiatiJialWiaii iiirniibllMiagM aaalharpMal(lbaan 1^19721</p>
        <p>r(bpbiar6bl9991 fhatacbaBib&amp;lt;acaiatybbbiphaataiy ipaia &amp;lt;iailaiianHibaaf1lifiihr iiMniariaar2,19621 Hrstacbambdlr laccaiiM phaataiy</p>
        <p>adsaba(liiMf2tallaat,11l6?l</p>
        <p>fhatafoaivabtybapaaalPSM,!^</p>
        <p>llialaaaaiiiailiafaaallarMiii</p>
        <p>(Npala8^1996)</p>
        <p>flat bMaaita bad aaaaailar add Wpalall, 19661</p>
        <p>Hnl aapba labanad ta Earth ftaai</p>
        <p>Tbskartlbal wdar.aiappbp; af aaaHar artiflbaaialS.1963)</p>
        <p>297 drtS Mat 7,19641</p>
        <p>M eaabbip aaaaaatar llbfa i,1966} flaipaiMaiaafo bl*iai spars rtalbamim</p>
        <p>raiUaipalall,1968}</p>
        <p>Hnl amaaad laviag aaHcb M aaattar</p>
        <p>arii(lpalal5,]9711</p>
        <p>rhatspacaciafttaaihKaaaBwrphab0iarti^6,19711</p>
        <p>Mataayttbilaar19,19741 nrssaacoaaaiM was BaNMK nTR apacacndttaaaawhbrtM aaaaMrpbaal(VMl,197 M4f4|s aflbmap PMaar 16^ 19141, JivBar Cnaaaar10,19731, Sihaa maiaartl,l91aadlliMaa nMv2,19661</p>
        <p>BbaaMyatfwrtaiiflapibraadtta aabwpaii to atato bfflril chaaab-alato ^laiBr arto ansas. (Iltoirl,197to</p>
        <p>ItolcbaaapaWlrarsabn^ toibpaaad anaaa (Wneaiai aai 2,19691 Rrak laaaaad laaaalb apaeaciaft</p>
        <p>15194,1961)</p>
        <p>rasi saman, w M laaMM, ladiptapad b apaaa ^sbrllbrtaaH bbaba, 19699'b fint apaoaenRta adina ascapa nabcip 6nn ba Sabr %abah~aGoatanltad hp [iaaa aaraialiia nth lapllir " IPtanait 16 ato 11,1973 sad 1974; toptoanlato^mi</p>
        <p>arbiter and entry probe; the Hubble Sp^ Telescope, whicti promises a revoludon in astroiKmiy (fomparable to diat bought by the first telescope; and die Gamma Ray Observer, which will search for, among (rther diings, that most exodc of beasts, a mmordial black hole within die Solar System.</p>
        <p>Odier missions continuing the mythic tradition need to be approved: a spacecraft that will keep pace with acomet in its orbit around me Sun; an advanced X-ray observatory; the Cassini mission to Titan, a world whose air is filled wim organic molecules of the sort that, 4 biuion years ago, led to the origin of life on arth; a radio telescope that can look bade in dme to glimpse the Universe shordy after it began; and, espe-cially,aset&amp;lt;rfrdx)texpkers&amp;lt;rfMars,</p>
        <p>culminatmg in the first human footfall</p>
        <p>on anodier idanet (see Lets (}o Ms1b9^*IARADE,tob.2,1986). These missions shottldbeiiiteniatkiiial accqXin^proffarpd Soviet coopenUion</p>
        <p>ing talent mvolved, reducing die costs to any one nadon id he^ing to bing our world together while exploring others. Sudi an objecdve has been endorsed Ity every U.S. Preskfent but one since the dawn of planetary exploradon (see box, precedine pa). Arid all fois would cost a srnall nacdon of die muld-triOioiHlolbr bill for die tedinicallydu-bous Stttr Wars program (The Leaky Shield, PARADE, Dec. 8,198S).</p>
        <p>It has been my good fortune to have parddpated, fiom the beginning, in mis new age of exploradon; to have worked</p>
        <p>wto those disteningMatineis,ApoUos, Pkmeets, Vildngs and Voyagers mtheir oumeys between the worlds, atechnol-ogy that harmed no one, that even Americas adversaries admired and respected; to have phtyed some part in the iteliniinaty reconnaissance of die Sobr tysteminnmidiwelive.Ifeeldiesame &amp;gt;y today in these exploratory triun^s I hat I did 30 years ago when Sputnik 1 : list circumnavigated die Earm, vdien our eimeCtatioM of toiat teclmology could &amp;lt; for us we nearly boundless.</p>
        <p>But since that time, something has soured. Iheandcipadon of progress has beensupidantedbyaftirebodingoftech-nokgkm ndn. I look into my rfanigh-ter*s eyes and ask m^lf what kind of ftitute we are preparing for our children. We have offeied them visions of a ftmiremwliidi--unabletoiead,todiink, to invent, to conqiele, to make dii^s work, to andcipate eventsour nadon inira info lethiagy and ecorumiic de</p>
        <p>spite to destroy die air, die water, the soil and the cliinate; in which we permit a mickff holocaust. The visions we</p>
        <p>moftemrtiatdiose viskms e. Often t^ become self-fulfilling profmecies. Dreams are maps.</p>
        <p>I do not think it irresponsible to portray even the direst futures; if we are to avoid them, we must understand that they are possible. But where are the alteroadves? Where are die dreams feat mbivate and impire? Wtoe are fee visions of hopeful nmiies, of times when technology is a tool for human wellbeing and not a gun on hair trigger pointed at our heads? Our children long for realistic maps of a future theyXand we) can be proud of . Where are the cartog-rqdieis cf human purpose?</p>
        <p>Condnuing, cooperative planetary exploradon cannot solve all our problems. It is merely one component of a solu-don. But it is pcacdcal, readily understood, cost-effecdve, p^fiil and stirring. It is our reqxmsiblity, 1 believe, to create a future wmlhy of our children, to fulfill the pnmuse made decades ago by Sputnik 1 andMariiter2, to open up dte Universe to those intrepid explorers ftom planb Earth. Q</p>
        <p>Carl Sagan cf Cornell University is tmpum ef NA^'s Medal for Excep-tionalScient^AcMevementandltmce) its Medal for D^^guished Public Service, as weU as the John F. Kennedy Astronautics Award of the American Astronautiad Society, die Konstimtin TsiolhovskyMedalcftheSovietCosmo-nautia Federt^tm and die Explorers Club 75th Anniversary Award.mmmwmmam</p>
        <p>1i ham tea</p>
        <p>ImHbM Mil iiadMe tete tMitiabtete</p>
        <p>tha Wwrtf tsili i Isspit spiw b-</p>
        <p>tteial gsMp la tts hMi Iht PlMitev UMh Bapk P, 61 IMb CaMha 9m,</p>
        <p>Pliai I  N9MMn22, Mir  liMPE MRMIMI</p>
        <pb facs="00096780_0099" />
        <p>wonoiiRi WINMUIERGRIIIinE</p>
        <p>Jarana Kamikaze pilois were unlike any other enemy I the U.S. had ever faced, lb them, death in battle was the greatest honor. And crashing meir planes into Allied craft nmmw was the supreme expresin htoOiAt ofJapanesespirit</p>
        <p>These suicide legk)ns are just part of whatyouH see in *The Pacific Campaignr your first videocassette in the landmark series, WORLD WAR II WITH WALTER CRONKITE.</p>
        <p>The Pacific Campaign starts with Japanese forces wideningltor stronghold in the Pacific. Then, as you watch, U.S. Intel-</p>
        <p>.The tide of the war continues to turn in favor of the U.S., as American forces establish a stepping-stone pattern of capturing a chain of crucial islarKk And with the costly taking of Ibrawa, we learn a lesson that will</p>
        <p>raid us in winnii^thewac H be aboard U.S. carriers as they capture the Mariana Islands and develop them into I new B-29 bombers, /for the Ifoota^lds you see World war 11 through the eyes of men who foi^ it. And this 90-minute vkteocassette isyoursfor just $4.95 ptusshippingand handling when you subscribe to the series.</p>
        <p>As a subscribei; you'll receive one new videocassette approxlrnately every six-t(veisht vreeks, always for a ten-day. risk-nree trial. And each cassette Win feature a different chapter of the wac Ybu'H see The German Hi^ Command: Air war Over Europe: and more. Each cassette will cost $49.95 plus shipping and handlir^ Therels no minimum number of cassettes to buyi and you can cancel your subscription at any time.</p>
        <p>This extraordinary video collection is available exclusive^ through the CBS Video Library So see Woild warTi like you never have before. Get "The Pacific Campaign by sending in the coupon. For fester service, use your credit card to ordei; and call toH Am.</p>
        <p>1800 CBS-4804. (In Indiana, call 1800 742-1200).</p>
        <p>IK</p>
        <p>JUST</p>
        <p>* plus sf^)ping and handNng with subscription</p>
        <p>lEIHMY.RISK-niEinilL</p>
        <p>CBS VIDEO LIBRARY</p>
        <p>DepL WA3, RO. Box 1111, Ierre Haute, IN 47811 YES, eiaw my sutncriplion to WORLD WAR II umlw the tarns docribed in tMt al SMKl me'7/w Padllc Campr at the Mroductory price of $4.95 plus 45 sNpping arto handing, which I'm payliii K indkaled bUcmUKInX Abo, send me future cassettes on approwl (one approxlmatoly every other monthlwilhnooMlblQntobuy CheckOne; pVHS K1A Check How Payir</p>
        <p> CMBKPlQOSeD lor $7.40* (K95-t-S2.45) Future cassettes bled with shiprnent  C23</p>
        <p>'  DCRlDrraMBLChatpriw series purchases, bedrwirig with $7.40 far rny first cassette, to;</p>
        <p>I  AmericanExpress dvtSA 0kitoslerCard d^inersClub  C24</p>
        <p>I</p>
        <p>I</p>
        <p>I</p>
        <p>I</p>
        <p>I</p>
        <p>I</p>
        <p>I</p>
        <p>I</p>
        <p>L.</p>
        <p>Account#.</p>
        <p>Signatoie-</p>
        <p>.Expiration Dels.</p>
        <p>Address.</p>
        <p>City.</p>
        <p>ipyee print)</p>
        <p>.Phone(</p>
        <p>Apt</p>
        <p>.State.</p>
        <p>-ZiPL</p>
        <p>. NOTE: Al subscriptions subject to review CBS Video Libtary reserves the right to rNect or cancel any subscription. *Applicahle sales tea adJadtoaHewbts.</p>
        <pb facs="00096780_0100" />
        <p>She^MtatallHhe the uptight DA she</p>
        <p>phqfsonLAlmrIWntGoTbBed</p>
        <p>MngGuiy</p>
        <p>M34,SusauDe)ris fhMlyhdaiiciiig the ffMwt parts of her Me.</p>
        <p>1NTHEBUSINESS0FAC11NG. talent can be defined as the distance betMveen an actress per-tosonality and the character she plays. Grace Van Owen, die deputy district attorney played by Susan Dcy on the NBC-TV series! A. ow, is ad^dy controlled, emotionally fragile, competent and almost ImnKHrless prosecute whose steel-trap mind never lets a detail escape.</p>
        <p>Susan Dey, on die morning 1 meet her, is lau^ng over die fact that her phone has been disconnecled. Fnre weeks of collect calls made while she was on a location sl^ in the South Pacific have left her with a $600 phone bill that nobody remembered to pay. i thii^ it was disconiKCted just as a litde reminder to me," she says, grinning. "I made a nde that 1 wouldnt do any business after 3:30 in the afternoon, so I would have time for my daughter. My home was turning into an office, and I was on the phone until 5:30every evening, doing business. The 3:30rule lastedone week, then I was ri^t back to wmting all evening. Thats why the phone was disconnected."</p>
        <p>Grace Van Owen is high-strung, unbending and always ele^t, each hair in place and no wrinkles evident in her coolly formal business suits. Susan Dey, in blackjeans and gray sweater, acupof coffee in one hand and an unfiltered cigarette in die odier, could hardly be forther away from the uptight lawyer she portrays weekly. That, she says, was not always the case.</p>
        <p>"I never learned to st&amp;lt;m wmiting, she explaim. "This is ^ tot time ^t wwk ^ been just a part of my life, instead of being the way I see myself, the way I validale myself.</p>
        <p>At 34, Susan Dey has been working for almost 20 years. "The summer 1 was</p>
        <p>IS," she says, 1 remember having this feeling inside of me. I had to do something. I didnt know what it wafr1 just knew 1 had to do something." Not many 15-year-olds are burning with die desire to go to work, but Deys premature sense of responsibility came from surviving more ufdieaval than most adolescents ever know.</p>
        <p>Bom in Pbkin, 111., Dey moved to New Yorks Westchester County when her newspsqierman father changed jobs. Then, when Susan was 8, her mother suddoily died of complications from</p>
        <p>pneumonia. Herfiadierremarried. Luckily, her stramodier had a creative idea for channeling Susans eneigy.</p>
        <p>It wasnt in my head to model," Dey</p>
        <p>Dey almost 20 years to learn yen have toaccept</p>
        <p>embrace</p>
        <p>recalls. It was my stepmothers idea But I felt like it was destiny. She threw herself into d business, appearing in Glamour^ Vogue, Seventeen and sever alcommociate. Predictably, Dey pushet herself too hard; by her second summer in die business, she was in constan demand. It was worit, work, woik woik, job, job, job, job," says Dey."BY MICHAEL RYAN</p>
        <p>MM   MWam n, IN7  MMK MMMWC</p>
        <pb facs="00096780_0101" />
        <p>realized that I was irritable and anm and unpleasant to live widi. I remen^ stopping at a pay phone in Manhattan and calling the agency and saying, Med a we^ off. 1 was all of 16.</p>
        <p>Dey got her week off, but almos unnicdiately she was back on the tread mill. There was this fear, she remem lets. That was the force that told me ust keep going, just keep going and lold (mto it. If you su^ and say, Isn* this great? its going to be taken away. It wasnt taken away. By the time she was 17, Dey was a TV star, playing jiurie, David Cassidys cute kid siste m The Partridge Family. The role was static CI was bored by the th^ year, die remendiers), but it established he ntelevision. It also taught her she couk for good parts, like the role of Jo which she played in a television production of Little Women. They saic No, no, no, youre way too pretty, Oy recalls. Isaid, KathariMHcpbum is ug^y? She played the part in the film What Jo is about is not being pretty notpietty. Its what she thinks ofherself. By the time she was 24, Dey had married ha* agent man 25 years senior. Their daughter, Sarah, was bon a year later, but the marriage lasted</p>
        <p>only five years. Sure there are strains being a single parent, says the actres But 1 had a choice: You stay married os youre a singje parent. I made choice.</p>
        <p>Motherhood also made Dey appiec ate her life more. I love the jnoccss &amp;lt; nK^hoing, she says. Hrwseback rit ing lessons, piano lessonsI love dio dungs. When Sarah goes horseback ri ing, 1 go widi her, d I just enter in her world with total abandon. They nice moments. At the same time, De was starting to shed sonre of her adolescent feelings of resprmsibility for eva thing. We all have a guilt button we push, she says. 1 was beginning unMrstand that and say, Im not goin to feel guilty. But you cant stop guilt intellectually. You have to ihiou^ aiocess of accepting life, bracing</p>
        <p>More and more, Dey was realizin that she could control not only her pe sonal life but also her career. This cess went into high gear while she w acting on the prime-time soap opera Emerald Point NA.S. Although it w developed by the creators of Dynasty the program never took off. Dey st she wMtght to in^nove her character, I to no avail: T went to the writers said, You cant have this woman be alcoholic one week and thoi not be alcoholic the Mxt week and not duough any process of recovery. Am they said, Were just comedy write We dont want to get too deeply into characters.  When the show went the air, the actress finally found t courage to do what she needed to-&amp;lt; continuet</p>
        <p>SURGEON GENERAL'S WARNING; Smoking Causes Lung Cancer, Heart Disease, Emphi^ema, And May Complicate Pregnancy.</p>
        <p>eiirihrl,lK.,ULSA.W</p>
        <pb facs="00096780_0102" />
        <p>OWR Tffi PHONE TO GRANDMOTHERS HOUSE.</p>
        <p>\R'Ul i/iiiK' li . hi I r/ui i-.il hr&amp;gt;i u aii  'I</p>
        <p>hfliiht'.  I 71 mi' (ir h.</p>
        <p>W 1  I  rir I ' .ink-ipr.  irip e^ t'r voii/lclfilor.iO .id liflp V(.ii</p>
        <p>niiil-1 Oil  iniirtM  iinrti' . V*.  h} ,i Gnpk; photu' (. all. lo yoiir loLai  tli'n t.</p>
        <p>I  . ,1 I  fi &amp;gt;r  Ec I'  u f 1 r ,1 I r.intH-rry MoKl ik)UiiiK !.</p>
        <p> u  1.  ;i  -'a.iT , Hi 'I ,  M.tjra'.U 7 f ott hv clcuarif lidliihi', .  .ifi.lk ,</p>
        <p>I tH liia.'u. Ii .Gic':! r ^U' ii I'i'.a lv, cc-raniH i. ranncrr ^t riG r I' Ml , ,int 1-t hm. l.ikt it with \.uj H wni . a</p>
        <p> i.iiluT  viii.K.^* '.Diir Hon ! 1-1 allinu Imtm ,</p>
        <p>WIIIY/continued</p>
        <p>Shej</p>
        <p>off die treadmill of work, pauiofi was gone, she says. 1 had no feeling formy work, and I didnt want to work like that. ^</p>
        <p>Instead, Dey became involved in the world around her. The National Organization for Women had asked to ^ some campaigning for them, she recalls, and I went to a few meetings and said okay. I campaigned at colleges. 1 was writing speeches for myself -^is is someone who stutters now and thenand speaking to other people about my beliefs. I didnt stand up and say, Dont vote-for Ronald Reagan. 1 said, Know who youre voting for.  Dey sometimes was jeered and even laughed at during her campus appearances. Some of these young guys got really angry, si^ r^alls. It was almost can^s riot time. Bufl wasnt upset. It wasnt anything personal. After the 1984 election, Dey went on to work for UFE, a group mganized to feed the hungry in Los Angeles, as well as for an organization that of^xises drilling for oil in the coastal waters off Los Angeles. 1 realized that I had this power because of my visibility, and it was time I used it for good, she says.</p>
        <p>By the time LA. Law came along</p>
        <p>last season, D^s life had settled into a m. she was balancing modi-</p>
        <p>hiqipytfaythm. erfaood and a career. She became en-gi^ to the producer Bemie Softonski, wl^ ^ will nuury when bodi have the time to do it right. We dont want to be married in a restaurant or a hotel, she says. We tried to do it this summer in Fans, but they had too many rules and regulations. But the wedding will be only a celebratiim. The coiiunitinent is already made.</p>
        <p>When success arrived, Dey was ready forit. If anything, my success on L A. Law is the result of my attempt at emotional around,</p>
        <p>used mask myself, pears? and I would think about moving to a ftum in Northern California and baking my own bread. Ifallofdiiswere to disiqqiear now, Id just start creating a^, start relHiilding.</p>
        <p>When I woke up &amp;amp;s nKxning, she adds, smiling, I had scorpions in my house, the had fleas and the car had brdoen down. Once upon a time, everything would have seeined so black and dark mat 1 couldnt get out of bed. 1 would think, 7 have to flick the fleas off me dogs, / have to make sure my kid doesnt get stung by scorpions, / have to fix this car.* Id be feeling guilty.</p>
        <p>I in life</p>
        <p>Now, I know these are just things in lii you have to respond to. 1 bet you anything I dont d^ with half of it today. But I wont go to bed feeling guilty. She shakes hands, refills hm* tiaveL ing coffee ctqi and goes off to Sears in search of an auto bitfteiy.  ||</p>
        <p>PNfii M  NOVEMn a, 1M7  MMK WIMIME</p>
        <pb facs="00096780_0103" />
        <p>AintepT shoes offer something rare in women's footweargood loobdut feelgood.</p>
        <p>So Wre making this remarkable olfeL Put youndf in our dioea kv 30 dasjn. If you don*t agree dwy are die moat oom&amp;amp;ntaUe shoes youV ever worn, return them iwith (mM^offiurohase for a fiiD rafemd.</p>
        <p>/MUb M d USA Kmm MM. SiriN Mi 1  wy kr Mk</p>
        <p>Airstep has aquabty, cushioned oonatmction. A huge sefedion of wide widths and siaes in bddi dieaqr and casual styles. And we give you that beautiful, pdlow4oft comfort for a painless price--inM st]^ under $20. So take home a pair or two of Airstqi shoes.</p>
        <p>YouD feel much better.</p>
        <p>H-most sqnes undm</p>
        <pb facs="00096780_0104" />
        <p>TWs holiday season, werreflolngtDgtveyou somemlng to ^ about With notowortfay prices on world-famous La-Z-Boy rechners that are as nk</p>
        <p>.to give as tfiey are to leoelve. Durir ttie La-Z-Boy^ Holiday Sale.</p>
        <p>So an you have to do to save a generous amount on a generous gift Is visit one of the dealers listed below.</p>
        <p>Of course, with savings Uke these, these comfortable, wen-built La-Z-Boy rediners win disappear fester than you can say Kris Krin^ And that means if you reelly want to deck the</p>
        <p>hurry to your La-Z-Boy dealer dialng the La-Z-Boy Hobday Sale.</p>
        <p>lA-Z-DOY</p>
        <p>Havertylt AH Locations. Montgomery Wtnf AH rSiI Stores Cmv</p>
        <p>Cooper^ Furniture House 820E.CbitliamEdmiMi</p>
        <p>EdentonFum.</p>
        <p>211 S. Broad SL</p>
        <p>Bostic Sugg Film.</p>
        <p>2037w3l0th</p>
        <p>tOnslon</p>
        <p>Highland Furniture Shop Vernon Bark ManUtvloil</p>
        <p>VMboumeFuro.</p>
        <p>New Bern</p>
        <p>IbMMoiyFiimilon</p>
        <p>2724Noi$eBlwl.</p>
        <p>S^oy Showcase Shoppe Hwy,401S.</p>
        <p>La-Z-Boy Showcase Shoppe HwyZOnt Hftinehe RtpMs Shell Ftim.</p>
        <p>931 Roanoke Aue.</p>
        <p>Robersonville Furniture Co. 120 S. Main Rocky ML Joyners Fum. imyL 301 Bypass S.</p>
        <p>Peoples Furniture Co. 414 S. College Rd. Zebulon</p>
        <p>Whitley Furniture Co. 101 Vance St</p>
        <p>SheHFiim.</p>
        <p>Weldon Rd &amp;amp;I-95 NRHamston</p>
        <p>Courtney Film. llZLMain</p>
        <pb facs="00096780_0105" />
        <p>AdveiHsament</p>
        <p>BY BILL NOEST</p>
        <p>Ijttugh^arade'</p>
        <p>^1 Mid, *Bring me my tIipiMn not, 'Bring iiwtomysNpiwn!</p>
        <p>what yon id frnr MUng Mm mtck ThoThraoSlMiM.*</p>
        <p>MMOC MMAZM  NOVEM 22. It^</p>
        <p>333Science Iricks and Experiments</p>
        <p>B Includes orlginoldeiiionsfroHonsnotfownd in most guides of its</p>
        <p>Idndl</p>
        <p>B Each trick is fully expkiined so thatevenocMId may understand and follow the step-by-step direcHonsI ^ All the materials used are inexpensive Hems that can be found In</p>
        <p>B'May be an mccellent source for school or science fair profectsl</p>
        <p>tiiic principles and illusions: From tricks based on iner^ momentum, sound and ottio' vibrations and projects to build, to experiments in biology and p^chology, water surface tension, gravity and cen^ force, heat, light, chemistry, and me-</p>
        <p>rtyinify</p>
        <p>Interesting to young and old alike, these experiments are designed to satisfy the investigative curiosity about how and why things happen. These are projects tiiat develq) interest in and answer questions about biolo^sudi as de^&amp;lt;H&amp;gt;* ing new plant leaves...or producing natural from vegetables or fruits. Readers explore the tricks* of air and water pressure building an atomizer using a straw and a giass of water...and so much more!</p>
        <p>ALEAFHUNT</p>
        <p>LowImI wiril IlMMlrMlB of</p>
        <p>CRAZY WATB</p>
        <p>There are many experiments tfiat help eiqplain much of the phemmiena in the worid around us.. Jk wonderful way for diildren to learn as they do! The exporiments are easy to perform, exfriana-tions and illustraticxis make them easy to understand and construct using ordinary houselKrfd items.</p>
        <p>This is a totally fascinating collection ot tricks and experimmits. It may be welcome as a source of classroom examples for elementary through hi^ school...as well as a treasure trove of entertaining projects fmr children and adults...o^aff ages. Itb a bonanza for anyone looking fw rainy day entertainment ideas!</p>
        <p>. Ne-HskOvaraWM</p>
        <p>Ity 333 SaENCE TRICKS AND EXPERIMENTS tor 30 days. If you arent 100% delighted with this fascinating book, please return it for a full refund. No questions asted. You risk nothing. Why not order yoar copy today!</p>
        <p>m-----_ A</p>
        <p>IflOTTBQ W UNBBiiVflTVYn</p>
        <p>Sound AOllwr iToBuHd</p>
        <p>Ughfll'</p>
        <p>Chowiistry . M^ci^anlcs^^</p>
        <p>idlfaki 60 dm GoMnl OOccK 37 lllh StUion. NY 1170.01987 N9.</p>
        <p>your nomo odcboss,xlp codo and dwck or TW WRIwBKo monoy ordor for $9.99 plus $1 JO posMigo and handling los PubNshors Choko, Box 4171 Ospl. BR50-PE, HunMnglon StaffcmpNY</p>
        <p>Stafionr^ 11746. NY ond IL rosidonis odd appropvicrto soIm tax.</p>
        <pb facs="00096780_0106" />
        <p>Good News; America</p>
        <p>rivalstheJapanese in small car valua</p>
        <p>j.</p>
        <p>Better News;</p>
        <p>The best American small car value* conies from Chrysler. Dodge Omni America. Plyniouth Horizon Americai</p>
        <p>$5995</p>
        <p>Based on oonpanWy equiiped stidw prioe eompartalon 0 TO Aitierica to W compeaihe mWKXitnpt</p>
        <pb facs="00096780_0107" />
        <p>Best News; You save up to $2354.</p>
        <p>Dodge Omni America Plymouth Horizon America</p>
        <p>$5995</p>
        <p>Chrysler Saves Ybu.</p>
        <p>Chevy Spectrum</p>
        <p>$7709</p>
        <p>$1714</p>
        <p>Ford Escort Pony</p>
        <p>$6586</p>
        <p>$591</p>
        <p>Nissan Sentra E</p>
        <p>$8349</p>
        <p>Subaru GL Hatchback</p>
        <p>$7588</p>
        <p>$1593</p>
        <p>Base sticker prices esccluding taxBS and destination charges.'88 Ameiica vs.'87 co^ Standard equipment leveis inay vary _</p>
        <p>Chrysler loaded Omni and Horizon America with extra equipinent and cut the sticker pice. They come with a 2.2 li fil-injected engine, 5-speed manual transmission, power brakes, rear defroster; rear washer/wiper, tinted glass, Rallye instrument duster; 13" Rallye wheds, doth seats, and more.</p>
        <p>And Chryslff backs the quality of every Omni and Horizon America with 7 years or 70,000 miles of protection cmi the engine and powertrain, 7 years or 100,000 miles against</p>
        <p>outerbody rust-through.^</p>
        <p>CtWVSLBlmoTOiis</p>
        <p>OIRYSLER  Pmy/KDUTH  D(X)GE CAfS  DC^</p>
        <p>1</p>
        <p>V\fe just want to be the best.</p>
        <p>^See limited warranty at dealer. Restrictions apply</p>
        <pb facs="00096780_0108" />
        <p>PARADE'S SPECIALInkMgence B^ort</p>
        <p>MMMDltriMDrfRHHraMiMi. Pmis ngislsKi</p>
        <p>Seci^ofYiMitli</p>
        <p>f!rien&amp;lt; , ^ H^Bnighborild^</p>
        <p>H Hpharmiunst informedj .HMlis that an increasihg^ h^ber of women 30 or over have been appearmg inius9rugst(^of late, bearing prescriptions for a s^tlietic form of vitamin A Imbwna as  ^</p>
        <p>tretinoin and sold und^ thB.,^! brand name ifetin-A. "  </p>
        <p>For years, dermatologists have prescribed this inedi^tibn for adolescente suffering fitin, ache. "But th| woipen who arb</p>
        <p>coming into me stor, bur pharmacist said, "mre neithe^j.^.</p>
        <p>Btfwv (OMaftM; kMMWisMih &amp;lt;</p>
        <p>"WHathasU</p>
        <p>none sufferers hbr addsChts^. pharmisMJi^ told Theyve simply heard through (&amp;gt;thbPbi^naxuti the grapevine that clinical, ,, . submdafy of Johi^  ^</p>
        <p>trials of Betin^A or reti^A&amp;lt;^|; ^  from</p>
        <p>are under way to prove bri.</p>
        <p>disjwe whether it can delay^^ effwti^^</p>
        <p>or reverse the aging prbb^'f' making the skinlbpk more</p>
        <p>Dhotoaged sl^ [skin diuo^^ yputhful.H m^^^</p>
        <p>by sun expos^3."l6ay  qMm;  Ybik</p>
        <p>does, they want to%t a head^'^iUM^toty, Bbston;Uni\^</p>
        <p>start. Thaf whyj^re,  ^^1heuiu;^mty of  iand</p>
        <p>pressmdng theif^pl^iricimM to * the Um^i^3f bfX)^^ write prebcriptibhs for it. *' ^ fryini^ clMcal study sites.;Vfe He further explained that tlm * prbmgt|y^ medication had bi^h apprb^ : l^^bf Tucs^,i)rincipal ' the Food and Dimg ^  investigator fortiwArizohateste</p>
        <p>Admihltritioh tyMute^,-^ -^ahdastldyfMt^^^^ but nfy tor the treatment of  theFbuntain of |buthfix&amp;gt;nU acn^notfor remc^di^ vvrinkles ^.i^vu^  ;</p>
        <p>or improving skin tone.  unirerritysfidx-mohth testof</p>
        <p>the</p>
        <p>Does it reduce fine wrihldihg? Does it stimulate the blood flow so that the skin g. ta^bn a rsir glow? Does it</p>
        <p>i %crease the production of  oolll^h; enhh^  the s0d.</p>
        <p>t wtK  more youthful look?</p>
        <p>"3^ hiayc 80 volunteers, most of them'^teeu aged 30 to 50,</p>
        <p>, rintiiestdy,:iieadded. Twenty ^ mb 0ren the create iu strength,to apply to their faces. Another 20 are given the cream  ;|ln ni^rte strength, 20 get</p>
        <p>.. -:______..___ ^ttie ci^ in high strength, and</p>
        <p>Mjw agy.  / fho rftnia.inmg^20 are given a</p>
        <p>uie tibtihoih compound beg^ ,J^placebo, a dimm^ last Summer arid its fii^t phase / jwithout aioy ritatoin A.^Come would end ih ^briiiary.  Whatg . February, well tally the results were doing, he said, is  and tiben condiict anothr six-</p>
        <p>experiTheuting Wilh a  r month study ^th the same</p>
        <p>reformulated Retin-tir  volunteers.-</p>
        <p>Until  Lbvine is advising</p>
        <p>hte rgi^ patiente'that</p>
        <p>^ formulated for teens ^M^e,is much too strong '^be u^ by acne-free adults. To those who refuse to accept for an answer, he diplomatically refuses to I pibscri^ the cxeam, pointing but"tt^ approve it as an anti-aging ' Cbmppm^^fo adults. Almost ? everyonf he remarked _ li "philosophically, wants to go teTM L^  tiuough life looking young. </p>
        <p>vV'W',  ,  r.  -  :  f-'CVr  ','   .__</p>
        <p>deterag^iifefi^ m ndjle-</p>
        <p>Japan: Moving Fast and Upward</p>
        <p>Japan was defeated in World Weur n, but ever since Sept. 2.1945, that covmtry has wrought one of the great economic miracles the century. Its industrious and intelligent people, who have an incredible savings rate of 20%, are providing capital for less fortunate nations. Its currency, the yen, may well becomeif the dollar continues to falterthe strongest currency in the world. And its financial institutions are outpacing many of ours month after month.</p>
        <p>Recently The WWJ Street Journal published a list of the</p>
        <p>worlds laigest public companies, as determined by Morgan Stanl^ Capital International Perspective and based on current market value. Herewith the top 10, eight of them Japanese:</p>
        <p>1) Nippon Telegraph &amp;amp; Telephone (Japan)</p>
        <p>2) IBM (U.S.)</p>
        <p>3) Exxon (U.S.)</p>
        <p>4) Sumitomo Bank (Japan)</p>
        <p>5) Industrial Bank of Japan</p>
        <p>6) Tokyo Electric Power (Japan)</p>
        <p>7) Nomura Securities (Japw)</p>
        <p>8) Dai-IbhiKangyo Bank (Japan)</p>
        <p>9) Fuji Bank (Japan)</p>
        <p>10) Mitsubishi Bank (Japan)Piiwcy Prices</p>
        <p>For years, Singapore and Taiwan were regare[&amp;lt;l the leading piracy countries of Aria, refuong to accord copyright protection to American works of literature, art and music. Now Thailand has superseded those two nations in offering pirated audiotapes, videotapes and computer software at ridiculously low prices.</p>
        <p>In Bangkok, for example, consumers can rent a Booky or Rambo videotape for 10 baht (38 cents) and any number of poiroq^nraphio tapes at 20 baht (76</p>
        <p>cents) each. Pirated U.S. recordings and films are for sale m Bangkok street stalls at a firaction of their retaU prices m New York, Chicago or L. A.</p>
        <p>- ^*-1_ -  mam</p>
        <p>Hnl 38 CMit,  a trip te ThailaMlBY LLOYD SHEARER  1987</p>
        <p>PMBi M * NQVEim 22,1M7  PMMK MMAZMI</p>
        <pb facs="00096780_0109" />
        <p>TOASTS</p>
        <p>"May you have wanii words on a cold evening</p>
        <p>AM moon on a diik night And the road downhill all the way to your door"</p>
        <p>A hh the Irish, When they get together, their love of lan-M Xguage finds its finest expression in toasting each others health. Here youll find loads of traditional Irish toasts. 'They are beautifully written, and all are accompanied by a lovely full color illustration.</p>
        <p>YouD find toasts for weddings, retirement, courting, birthdays, St Patricks Diy, and nearly every other occasion! Printed and bound in Ireland, the fine quality and crafts-manshq) is certain to make this a lasting family treasure. ^  ^</p>
        <p>So order your copy today!</p>
        <p>^ont miss out on this gem! A UTTLE IRISH COOKBOOK offers you the : of traditional Irish cooking. This [ volume is filled with lovely.fufl  illustrations to complement the ' savory reccesranging from a ! Irish farmhouse breakfast, to potato soup^ Limerick Ham, barm apple and blackberry crumble and 1 Coffee. An exceptional bargain -while they last!</p>
        <p> not mrder a few? The set wiD make a distinctive gift! G^0iBcK 37 Uth Aie.  Sttfiao, NY U74&amp;amp; 019S7 Natiaail Syiri^^</p>
        <p>PUBUSHERS</p>
        <p>CHOICE</p>
        <p>GUARANTEE</p>
        <p>I jmi are dissatisfied with purchase ia any wm may return it for a : and hiO isfiwd Al lers are processed nptly and notification IbeaenthicMeofddigt wnt ia guaranteed ifiOdsys.</p>
        <p>PUBLISHERS CHOICE, Box 4183.</p>
        <p>Dept BFSOPB, Huntington Statkm, NY U746 Please nish me:</p>
        <p>_.#BF80 DUSHTQASTS IS.95 ^#BH80 UTTLE IRISH COOKBOOK $5.95 Please add $L00 postige and handing for each booL NY and IL residents add appnpriate sales tax.</p>
        <p>SAVE! Ordar both for tiaOSphu 0.00 po0tt^ tad haadlii^.</p>
        <p>Plwm print  IbialniKMntsadosedl_____</p>
        <p>Name.</p>
        <p>City.</p>
        <p>.Stale.instanhy!*t)alibrated Coin CountersSET0F4 ONLY S795</p>
        <p>Pour a handful of coins into tube</p>
        <p>Tilt the tube to release metras</p>
        <p>TUrn upside down coins sliide into wrapper</p>
        <p>f t quickly adds up! Pour a handful of coins into the wide funnel top M... when full, tilt to dispense extra coins... place wrsypper over top of first few coins ... turn upside down, coins will slide into wrapper. Its a snapso fast, easy and accurate even a child can do it. A real tme^ver for anyone who handles coins regularlywaitresses, cashiera, coin collectors. Made from hi-impact ABS plastic. Set of 4 tubesone each for quarters, dimes, nickels and pennies.</p>
        <p>OI9M Anwk Mly Giml 0GW 37 lllh Am., Hunliiiwon</p>
        <p>AMERICAN FAMILY GUARANTEE</p>
        <p>\hamuitbedelgbledwith your purcbue. if not, you</p>
        <p>imgrretiiroitforapnapt and hi refund. Al ofdm ire pncMMd k and nofiflciion wH be rent in care of delay. Shipmentia guaranteed within 60 dqn.</p>
        <p>n</p>
        <p>, AMERICAN FAMILY, Box 416S, Dept. KA90-PW,</p>
        <p>I Huntingtoo Station, NY 11746 I lfea.pleaaesendinetheXalibntedCotaCoantei!s(Setof4). I Enclosed pieaie find my check  roon^order for 17.95 phis $1.50 postage A handling.</p>
        <p>I SAVE! Oiier two for only I14J5 phis $2.95 postage and I hamfflng. NY residents add appropriate sales tu.</p>
        <p>I Qty_Amt  enclosed_</p>
        <p>I NAME_</p>
        <p>I ADDRESS_</p>
        <p>CITY_</p>
        <p>n</p>
        <p>L</p>
        <p>sms.</p>
        <p>ZIP.</p>
        <p>-J</p>
        <pb facs="00096780_0110" />
        <p>THE LOWEST STILL UNCHALLENGED</p>
        <p>NOW</p>
        <p>2mg.</p>
        <p>'rcl</p>
        <p>i a</p>
        <p>...</p>
        <p>3mg.</p>
        <p>*  3#  1,,  '</p>
        <p>* 'U ^</p>
        <p>ni.</p>
        <p>i  '  i.'</p>
        <p>ewBA**miw6ooea '%.CMIIViMli^*inCiMlMi ^ B0RyalRUii1lieha*Qaa&amp;gt;*a*bFrm^</p>
        <p>WiVIlHII:1|.XW.*oii^Pi^ iip(tm(8ttinkiMiMasii.niCiMiMiu)6ii| ^</p>
        <p>MiisaRMamfi]Bfc2i^.va2i.iiMiRiiS(rf mam KNMi:</p>
        <p>I^mM,  s-  s?-  v^z  j</p>
        <p>ti-5len"</p>
        <p>At coRsiraMrt, do you thinktlM AMoricau poo^ roly uMio ou firtt kupTMtioiit than o truo oortb?</p>
        <p>^TuUie Folsom, Houston, Tex.</p>
        <p>I diink we tend to lely on first impressions when we decide to buy and on true worth when we decide to sell.</p>
        <p>Wbaft tiM diffMOBCO betooon aa enorandauiislako?</p>
        <p>Art Bullock, hiet^ord, Mass.</p>
        <p>An error becomes a mistake when we refuse to admit it.</p>
        <p>Siaco the concept of expamiOB pretuppotot sonNtMiig expandiag into tomtUiiHgtliat alroady tidii^ iaio what it the uaimto expanding?</p>
        <p>David J. Franus, Stanford, Conn.</p>
        <p>/f the universe indeed is expanding, perhaps we should hope that it's expanding into nothings because if its expanding into sanediing, diwe ccKild be a sort of squeeze out there' with who-knows-what interesting result.</p>
        <p>Now Wted or nalinited do yon think brain lanctioB actnaHy it?</p>
        <p>Loara Staey, neuroscientist. University ofArkansasfor Medical Sciences, Little Rock, Ark.</p>
        <p>I suspect it is far more limited than we would like to believe. A fish is unaware that it can't understand spoken language like a dog, a dog is unaware that it can't undostand mathematics like a human, and a human is unaware dud he or she cant undostand... who knows what?</p>
        <p>How doot one go about finding Mt or bor pnrpoto in Hfi, or ita*t thitpotaflUo?</p>
        <p>Cheryl McKay, Albuquerque, ff.M.</p>
        <p>Id suggest makingoiic, instead. Youl be happier with it.</p>
        <p>Vymlmta fuaiuifirU!^rmSmmi. wtoteAMtiilr 'MMm M^TNMWAnnb mkkr 'MtifentJO.' Wkwr -AeUmtlim.' HUM. nOVMUt.. Mtm IM. MK10017. townr ^iwtaw qfMair. fMMiW nfftts aw aM</p>
        <p>MCE U  NQVEin 22,1M7  PARMW MtailZMi</p>
        <pb facs="00096780_0111" />
        <p>102 MRDHOIISES and FEEDERS mi Can Make</p>
        <p>NOW you can have the easy-to-read plans for 102 birdhouses and feeders at your fingertips, tf ycRi want to attract more Urds, and a greater variety to your bad^ard, 102 BIRDHOU^ AND FEE0EI6 YOU (VW MAKE is the book for you.</p>
        <p>Fhxn the simple Robin Shelter to the nnore elaborate Hotel Martin (which accommodates 58 families), the easy Gourd Homes and the picturesque oriental style Japanese Cottage, to the Tfeepee for Crested Ffycatcher youre sure to find a project that will be fun to make. And think of the enjoyment youll have in the years to come as you lode outyour window and see more colorful birds than youve ever had before!</p>
        <p>Just look at some of die 26 species of birds you may attract widi your birdhouses and feeders;</p>
        <p>Bhieblrd</p>
        <p>Phoebe</p>
        <p>Nnthateh</p>
        <p>unenra nycncrcr</p>
        <p>TItnomse</p>
        <p>Woodpecker</p>
        <p>Robin</p>
        <p>Owl</p>
        <p>wren</p>
        <p>Flicker</p>
        <p>Swallow</p>
        <p>Sterling</p>
        <p>Martin</p>
        <p>Wood Duck</p>
        <p>For most of the projects you can use outdoor plywood, solid cypress, redwood, red cedar, white pine or yellow poplar. If you want to paint your birdhouse or feeder youll learn which colors are best Get started soon on a prefect you're sure to ijoy. Order your copy today!</p>
        <p>PIIB1JSHEI8 CHOICE 6HABAII1EE</p>
        <p>If you are dissatisfied with your purchase in any wm you may return it for a prompt I and full refund. All orders are processed promptly and notification will be soit in case of delay Shipment is guaranteed within 60 days.</p>
        <p> (knyoaoes:37IIttAw,Hunita|tonStatloii.NY1174e.on87Htfkri9yiidha^ -</p>
        <p>Send yov name, address, alp code and check IV VnVJUlSor money Older for M.tSplns $2.00 postage laod handling to: dilislierB Choice, Boa 4171, Dept BF90-PB, Hnnllngton IStalloB, NY 1174f. NY and IL resMems add appropriate sales tax.</p>
        <p>From the Penthouse Suite to the Ocean Deep...THE MARINERGoes Where the Action Is!</p>
        <p>More than a watch, the Mariner is a precision, multifunction timepiece youH want to wear everywherefrom the office, to the golf course, to the beach even for diving!</p>
        <p>Its high technology quartz movement-accurate to within seconds a month powers an amazing array of features.</p>
        <p>The Mariner shows you the time two ways: on a luminous analog dial AND a lighted digital readout You also get day or date and month at the pimh of a button; alarm and hourly chime; a full-function sports stopwatch; tachymeter dial; and outer bezel.</p>
        <p>BUT THArS NOT ALU The Mariner is built tough, to withstand the rigors of your active life, itb guaranteed waterproof to 150 feet And its handsome styling makes it perfect for the boardroom ... the golf course ... the ocean... wherever the action is!</p>
        <p>ORDER NOW, WHILE SUPPLIES LAST!</p>
        <p>PEmcr roi DRESS.. .the</p>
        <p>-e- ac t  **</p>
        <p>iQMn mMWttt gMS wmi me molt elefMtfMMl wear.</p>
        <p>PERFECT FOR SPORTS ...</p>
        <p>coostmctioo mahes it a Mhnl far year actbeSfestyle.</p>
        <p>AND ITS WATERPROOF... ftands ip to the pressure even ISO feet underwater!</p>
        <p>QamI oOkw lltt Awe.. HunUnikin SMfcm. try arm e 1917 AnvicMi IMIy</p>
        <p>AMERICAN FAMILY GUARANTEE tel most be MpSri with your purdmie. Hoot, youmigr reten it fare prompt and fal reAud. Al orders are pro-cessed immedbMy and astl-fiGationiHibeseWincaieflf detsgi Shipment is laaraa-leed nilhin 60 dq. credit card orders arewbjectto credit ap-</p>
        <p>HuiERICANFAMILKBoKAlSS. DeptKF9I-PH, HiiiillDgtooStatioii,NrU746 Vea, please send me the Mariner Watch.</p>
        <p>Errdosed please find my  check motiejr order for I14J5 plus 12.95 poage and baiidiiiig for each watch ordered.</p>
        <p>NY resideiits add appropriate sales tax.</p>
        <p>NAME.</p>
        <p>ADDRESS</p>
        <p>i:</p>
        <p>CITY.</p>
        <p>STATE.</p>
        <p>ZIP.</p>
        <p>-J</p>
        <pb facs="00096780_0112" />
        <p>TELEVISIONEVAMARESAINT In Fanrily Drama</p>
        <p>Eva Mane Saint lends wannth and class to eveiything she does. Norman HodnMffi BraaUnc Homo Tins</p>
        <p>(inspired by die famous painting of a pensive farm fadier seeing his son off to college) stars die actress as the mother, Jason Robards as the father and Doug KkKeon as the boy. Its both a coming-of-age tale ai^ a story</p>
        <p>of family relationships. **About niim years ago, says Saint, **Jas(i and I did something called A Christmas to Remember, about other farm folks in that one, we had a grandchild. In diis one, we have a son. As Jason says, were getting younger all the time. ABC, Thursday, 9-11 p.m. EST.</p>
        <p>VIDEOlive Sn bowing</p>
        <p>Alkno ftmm in Bmkhfi, a good, old-fashioned 40s movie about a spirited, sensitive young giri and ha* struggling Brooklyn family at the tura of the century, still has the power to touch and entertain us. Playhmise Video.</p>
        <p>NOVEMBER 2 2, 1SB7Ow Varade' WHATS Up This WEEK</p>
        <p>BY LYNN MINTON</p>
        <p>MOVIES</p>
        <p>Cant you just jncture Barbra  takes cm Oie legaL^^ttHn, ^W . r</p>
        <p>Streisand ^Chudiai^Draita^  p^chiattistsandbmrta%,R9&amp;lt;p^</p>
        <p>&amp;lt; ttestitmg-mlled, endmrrassingly them to rase tbe quK&amp;amp;ms: IMio is oidspdoen hercnne of NMi, whose asay7 Who is pot? Who ded^? family ktiyhig to have her confined Stremodherslfsaysdudmanyl toajaieiital institution? the psychiatrists, lawy^ judges hdp&amp;lt;^ mi at-first-reluctmtt public seemtoherm(Beiirationaldian defender(RichardDreyfiiss), Draper the patients.^ (Warner Bwh.)</p>
        <p>magazinesRoKugAkmg</p>
        <p>Ru Jbflhr Stoned 20lh aimlieriaiy</p>
        <p>issM, the magazines writers talked with rock stars and some others who hdped to shape the era. A few of the quotes:</p>
        <p>yomtBuez; In the Sixties, we may have been working uphill in an avalanche, but enou^ of us didnt feel like that.</p>
        <p> Walter Cronkite: I thought we had a movement of youth that would have an impact on politics. Im (fisappointed they didnt follow through when they got the vote.</p>
        <p> MickJagger: It was not the intent of the Rolling Stones to become drug-user outlaws. That image was a teal drawback.</p>
        <p> Smokey Robinson: All [Motown] was doing was just putting good songs on good tracks, songs that anybody could relate to [whether] you were white or Orientiil or Chicano... And tiiat made a world of differaice.</p>
        <p>P.S. Appearances by f&amp;lt;Mnner Beatle George Harrison, plus Grace Slick, MickJagger and'nnalbraer, give ABC the makings of a niajor rnoment in TV history fra: its 2(M Annivrrsory of Rolling Stone special on l\iesday, 9-11 p.m. EST.Bright Ideas</p>
        <p>BY MNE CMBAnBBICreate 8 Victorian Christmas Tree</p>
        <p>EACH YEAR, THE STAFF AT THE historic Biltmore House museum in Asheville, N.C., recreates Christmas circa 1895 with autiientic Victorian ambience. This means using natural materials and homemade ornaments ingredients you could try on your own tree this holiday season:</p>
        <p> Featter wreaths. Cut the center out of a 3-inch circle of cardboard. Irim craft feathers into IVV to 2-inch pieces and layer onto the cardboard doughnut once it has been</p>
        <p>completely covered with craft glue. When first side is dry, repeat on the other side. Decorate with bows, beads rar glitter, hang witii ribbon.</p>
        <p> "TUssie nmssks.</p>
        <p>These decorative nosegays of dried, silk or paper flowers alM can be used to adorn your holiday dinner table. Start witii a rose with a 6-inch</p>
        <p>stem. Circle with smaller flowers with shorter stems, then with ferns, tiny flowers or babys breaih. Wrap wire stems together, push duough a piper doily, secure witii floral rape. Finish with a bow and streamers below the doily. Attach to the tree by the wire stem._</p>
        <p> Pine coneskang from red velvet ribbons.</p>
        <p> Pomander baUs-^toBf^ of nedfmit and fragrant spices. The Victorians hung ti^ ramaments fixim curtains, in closets, above doorways and on Christmas trees. Stud apples, pears, oranges, limes rar lemons with whole cloves, shake in a paper bag with cinnamon and ground orris root, then dry for about two weeks, turning ftran time to time.</p>
        <p>When dried, wrap the scented balls in a square of net tulle andtiewitha ribbon at the top.</p>
        <p>Ice cream ornes. GlueaStynrfoam ball atop each sugar cone, then glue on</p>
        <p>a circle of cotton batting, making drips, and sprinkle with ^tter. Or cover the balls with glue and sprinkle witii potpourri mix. To hang, glue ribbon to besides of each cone, then pin for extra security.</p>
        <p>For full instructirais on these and other Victorian decorations, send for the booklet A Christmas Past. Its $3.95 ftran The Biltmore Estate, Dept. P, 1 North Pack Square, Asheville, N.C. 28801. To order by Visa or MasterCard, call toll-free: 1-800-334-0411, ext. 5.</p>
        <p>MUE 2t  NtWIMai 22.1M7  MMOE MNiAZMi</p>
        <pb facs="00096780_0113" />
        <p>ana give memories.</p>
        <p>I</p>
        <p>Now v\^11 giN^ you &amp;amp;ee 3M film and pTocessiiig</p>
        <p>to capture them.</p>
        <p>Ibreverythmg&amp;amp;omseriouscam^  of ejqxjsed film with coupon, the</p>
        <p>ing to fun in the sun ...for every age,  sales receipfrointteColeii^ prod</p>
        <p>Coleman products make pafect^^  and the UrCc^ fern t^Cplem</p>
        <p>Now when you buy selected  package^\^11sendbaproctsed</p>
        <p>Coleman products, youll also receive hee  pictures and a replaceinet r^ot high-</p>
        <p>processing and film Just send in any roll  quality 3MFotorama fikn, free._</p>
        <p>BSBBS</p>
        <p>rrs NOT JUST1HE NAME OPACOMEANY.</p>
        <p>ITS THE NAME QFAEAMDY.</p>
        <p>lariswS SSsfe</p>
        <p>S-  -I-.</p>
        <p>m</p>
        <p>_FREEFHM</p>
        <p>and proo^ngv^th selected Ccdeman products</p>
        <p>Name.</p>
        <p>sSaSSS=s^ss:</p>
        <p>KStarsszscaKss</p>
        <p>Sr^ESaMiWLHnoa^^</p>
        <p>OfcbtMiMilO</p>
        <p>MtaiifrMliirfate</p>
        <p> UJ.</p>
        <p>LltatMirfitiflvri</p>
        <pb facs="00096780_0114" />
        <p>A li 11 le ' known way to change behaviorDont EatThose Peas!</p>
        <p>_IKE  MANY</p>
        <p>youngsters, 4-year-oId Tommy threw temper tantrums when he couldnt have his own way. Neither punidunent nor reascHiing tukd any effect. When die tantrums became an almost daily event, usually atembaiiassingtimes and places,</p>
        <p>his parents sought help from Rachel Hare-Mustin, Ph.D. .ap^choth^ist.</p>
        <p>Her way of dealing widi the situadtm staotled Tommys parents at first. Unlike other dieripsts, who had focused on getting lum to give up tantrums, she told the child it was all right to keep on</p>
        <p>having AemlMit only in a^pedal tantrum place at htmie. If you start to have one anywhere else, Dr. Hare-Mustin said, you must stop and wait till you get to your tantrum {dace.</p>
        <p>Later, the therapist sugges^ dun Tmnmy could have a tantrum if he did so widiin a specific time poiod. The fiunily agreed that S p.m. to 7 p.m. was best. Ifyoufeelatantrumcomingon, Hare-Mustin reminded the boy, you must wait until 5 p.m.</p>
        <p>During die next two weeks, Tommy had only one tantrum, which occurred at the prescribed place and time. One week late, he gave diem up entirely.</p>
        <p>Tommys case is not unusual. Radier, it is typical of the remaricablesome say almost magicalpower of paradoxical therapy, which uses a kind of inverse logic diat seemingly defies common sense. Paradoxical therapy was first</p>
        <p>suggested more than half a century ago by the Viennese psychiatrist Dr. Viktor Frankl. Overlooked for years, its use is recognized today as a distmct and effective technique.</p>
        <p>Paradoxical dienqiy tends to turn con-ventionaltherapeuticapproachesupade-down. Unlike dienqiists who believe that a patient must imderstand the cause of the problem in order to overcome it, pioponnasoMrpaiiidoxical therapy believe that, for all its absurdity, this technique is one of the most effective ways of achieving rapid prr^ress. For example:  A woman^s hands are raw because she was^ them every 20 minutes, but what bothers her most is anticipating dieconqHilsion todoso. Setyouroven rimer at 20-minute iittarvals and wash every time it Inizzes, die thenqpist tells her. That way, he explains, she need not be so anxious about having to wash</p>
        <p>gMStertl</p>
        <p>pandmdeal</p>
        <p>thmpfgiftMa</p>
        <p>flMtout</p>
        <p>taihhiMl</p>
        <p>totMch^that</p>
        <p>stafr.OllMr</p>
        <p>psycheliglttt</p>
        <p>uathasMna</p>
        <p>iMtrtalsglcte</p>
        <p>twipaHsidtii</p>
        <p>Ihair baac^ipsmmce fighting</p>
        <p>fire with Are, says one expert about this maglcaT therapy</p>
        <p>because she will be decfing when to do it. A week latnr, the woman asks if she can set the timer just once an hour, washing every 20 minutes is too mudi trouble, she says. By the following week, she has broken the compulsion completely.</p>
        <p> A successful novelist simers from writers block because he fears his current book will not measure to his previous work. A perfectionist, he is mid by die therapist to write somediing every day but deliberately to make it as bad as he can to guarantee rejectimi. The imperfect draft turns out better than the novelist expected, and soon the man is writing as well as ever. Being forced to try to fail has, paradoxically, cured</p>
        <p>him of the fear of failure.</p>
        <p> In his book Making Things Better by Making Them Worse, the New York psychiatrist Allen Fay tells of a i^ent recovering from an emotional crisis who thought he was about to have a relajise: You cant do that unless we plan it, Dr. Fay replied, deadpan, opening his ai^intment book. When do you want to have itr The startled patient picked a dam a mondi away, and Fay penciled it in. Now we can forget that, he said. A week after the relapse date, the patient admitted that he had forgotten about it. You missed your chance, its too late now," Fhy said briskly. The patient continued to progress.</p>
        <p>The technique is effective ag^st a broad range of problems, including insomnia, anorexia, procrastination and agoraphobia (fear of public places). It</p>
        <p>patterns of interpersonal .....</p>
        <p>nercy, Fh.D., a family therapist and associate professor at Purdue University in Indiana, tells of a couple who ludntually hurled sarcastic put-downs at each other when they arguBd.</p>
        <p>They cared enough about their mar-</p>
        <p>ri^ to want to save it, Dr. Piercy recalls, but they had no idea of how to stop a quarrel before hurting each other so much. Piercy asked if the couple were willing to play a game he had in mind. When they agreed, he gave each spouse 10 pennies. Whenever one of you utters a cutting remark, instead of answering back, the other perron is to give him or her a penny.* Piercy instructed. First one to give away all the pennies wins.</p>
        <p>During the next week, rather than react to a harsh remark with a zinger in return, each spouse merely smiled and handed over a penny. Soon both were refraining from sarcastic comments in order to avoid getting a penny. The game changed their arguing pattern, Piercy says.^Veibal onslaughts that bring the attadker a penny put him or her one-down instead of one-up. The only way a qpouse can win in diat situation is to stop spouting put-downs. With the conflict pattern oroken, Pier^ was d&amp;gt;le to teach the cou[de constructive ways of working out their differences.</p>
        <p>While tire use of paradoxical therapy has grown during recent years, then-BY NORMAN LOBSENZ</p>
        <pb facs="00096780_0115" />
        <p>pists cauti(N) that it is not suitable in every case.</p>
        <p>Not all dienq[)ists are able to use it effectively, says Michael Abrahams, a tterapist in Washington, D.C. And not any kind of nonsense is truly paradoxical. The technique is best called into play if all other efforts to solve a problem have failed. In other words, a person shcmld not go lodcing for a paradoxical therapist but should ask if paradoxical therapy can help.</p>
        <p>How does this mysterious therapy work? Basically, it seems to draw on die following techniques to produce psy-</p>
        <p>Prescribing the symptom. Paradoxical therapists instruct patients to keep doing the very thing they want to stop doing. The result, Allen Fay explains, is to turn an involuntary sym[om something that happens to youinto deliberate, even scheduled, behavior. Thus the symptom comes under your control. Anticipation of the symptom, whkh is often more troubling than the behavim* itself, also is reduced.</p>
        <p>The more one tries to stop being anxious, for example, to fall asleep.</p>
        <p>the harder it is to do. says Dr. Mark Goulston, a Los Angeles psychiatrist. Its the same principle as being told not to think of a green rhinoceros. Its almost impossible to tiiink of anything else.</p>
        <p>Dr. Goulston sees the technique as a form of fighting fire with fire. Consider this ^ical case: A depressed patient says he is never ftee of gloomy thoughts. While another therapist might seek dw causes of the depression, the paradoxical therapist matter-of-factly observes that the man, no doubt, has much to be dqnessed about. The therapist is sur-jmaxl he isnt nKWf depressed. The pa* dent is told to set aside a specific hour each day to think about the worst things that can happen; Save ail your worries for that time. Be as depressed as you can fw the whole hour, even if yw must face yourself. Goulston explains; Scheduling an hour a day of total gloom makes it unnecessary for the man to be de-pie^ at odier times. Somi the patients dejnession lightens, eventually vanishing. lUtimatily tbs&amp;gt;vony hour becomes too boring or absurd to continue.**^ ^</p>
        <p>V Provoking rebellion. While prescrib</p>
        <p>ing the symptom works well with com-(Mpai^ who follow orders, it works equally well with defiant ones by provoking and co-opting their resistance. Instead offighting attempts to help them give up problem behavior, such patients typically resist the paradoxical order to continue it. But in so doing they are subdy maneuvered to the same goal to become symptom-fra. In effect it is psychological judo, using the patients resistance as leven^.</p>
        <p>The late Milton Erickson, a master of landoxical techniques, often used this lomely illustration: His young son, serv^ asparagus witii diimer, declared that he wouldnt cat any of that stuff. Replied Dr. Erickson, Of course not, youre not old enough. Whereupon the boy ate die asparagus to prove that he was, indeed, old enough.</p>
        <p>Ther^iists also provide rebelliousness by exag^rating the (xoblem (patients then deny its that bad) or by predicting a reliqise just when the patient is markedly improving (the patient rebels by continuing to get better).</p>
        <p>Reframing. When Tom Sawyer convinced his friends that it was a privilege.</p>
        <p>not a chore, to whitewash a fence, he was using tiiis paradoxical approach. Refifaming changes a persons perspective on a pnfolem from a negative to positive, says Prof. Rick Bruhn of the Family Life Center at St. Marys University in San Antonio. It casts the problem behavim in a more benevolent light. Anger is redefined as caring, suffering as sacrifice, conflict as a last-(titcb way of seeking intinuicy. the ordeal. This is a variation of paratfexiod prescriptions which imposes a task that causes so much more stress than the symptom that the patient is usually glad to give up die symptom. An insomniac is told that if he is still awake an hour after retiring he must get up and do 30 minutes of ^nuous exerase. If still awake an hour later, he must iqieat die process, and soon through the nigjit, every night. Before long, the patient finds it preferable to fall asleep.</p>
        <p>How do therapists persuade anyone to carry out what seem to be unreasonable and often inane actions? The answer, experts suggest, is that patients at the end of their rope will do anything to ease their emotional pain.  Q</p>
        <p>OnceAgam,</p>
        <p>AmirakBrmgs</p>
        <p>GreatIukl</p>
        <p>UUUESDowNlbEAinH</p>
        <p>IMiW you dont ham to iMve the ground to gft the moot out off your trmi dollar. With our new All Aboaid America Fmoo you can visit any one region off</p>
        <p>the countiyffor Just $138. IWo regions for $188. Or sightsee coast to coast for only $238. All ffaios are round-trip and you can make two stopovers along the way-</p>
        <p>For shorter trips, thoro% our $7 Itotom Faro. Whenever your one-way fare Is over $60 (with no change off trains), well bring you home again ffor Just $7 more.</p>
        <p>As alwi^, children under twolvo travel haN price.</p>
        <p>And on Amtrak, we wont leave you In the ah* when It oomes to comfort On board youll ffhid wide, recHnfaig</p>
        <p>seats. Friendly serrice. And evotythbigfromffull-courae meals in our dining cars to tasty snacks and beverages whenever you like In our lounge cars.</p>
        <p>Some restrictions apply, so call your travel agent or can Amtrak at 1-800-USA-RAIL lor more Information. And ramember, when you tnwol acrossllieoounhyonAnilndc, you get to see the counhy youre traveling across.</p>
        <p>MiitailpHylttcMciVWoiwlwlffcwtjii</p>
        <pb facs="00096780_0116" />
        <p>IN STEP WITH:</p>
        <p>BY JAMES BRADV</p>
        <p>SUSPECT THAT WHEREVER HE CELEBRATES Thanksgiving, Edward Woodward will be feeling even mcne grateful than most of us.</p>
        <p>Woodward, star of the CBS series The Equalizer, was bombed by German planes as an English schoolboy during the war, once was hijacked while flying over Africa and just last summer suffered a major heart attack in England.</p>
        <p>Nothing daunted, hes back on the air in a show that was very nearly canceled fOT low ratings and at an age (his late 50s) when few actors get to play the hero in action-adventure yams on the tube.</p>
        <p>He may be die most unlike-ly.success stwy in network television.</p>
        <p>Sir Laurence Olivier once called Woodward the best</p>
        <p>actor in England." 1 asked about diat and got a lau^.</p>
        <p>Oh, Larrys always saymg diat;" Woodward relied.</p>
        <p>He has said it about 25 different people. He says it when he wants you to play a role diat doesnt pay very weU."  ,  .</p>
        <p>Woodward grew- up in suburban London near (^y-don Airport, a favorite target for German bombers.</p>
        <p>By his own testimony, his sclmol was hit five times,</p>
        <p>and once he briefly WM buried alive. He considered journalism, but a seri of redes in college prodiKdions led to a ptofessioil dieater career diat began widi his London debut in 1955.</p>
        <p>Though hed starred in some 20(X) British TV roles and played everything from SiUDeiapearetomusicalconii-edy. Woodward remained almost unknown to Amni-can audiences until his superb portrayal of the doomed Ausbidian officer in die film</p>
        <p>Breaker Morant.  -;;---</p>
        <p>The Equalizer is filmed on location in New York,</p>
        <p>and die time 1 met its star was in a hotel ^Iroom</p>
        <p>during rehearsals for an episode where terrorists burst in on a gala weckling party and take hostages. Almost casually. Woodward told nK about his own hijack experience in Africa. Terri^ing stuff, he said, grinning. You get the sense he probably grinned when it harmmed. This is a very cool Englishnian, as urdliqppsme as his Equalizer character, the retired secret agent Robert McCall.</p>
        <p>When he suffered his heart attack last July 28, there were already four episodes of The Equalizer in the can, including a season opener with Telly Savalas. There were rumors Woodward might be dropped, that Kirk Douglas might be brou^t in. CBS didnt panic, md Wo^ward did the sensible diingstarted dieting, hired a secretary to answer the fan mail and walked three miles a day.</p>
        <p>Woodward has three grown children and a little girl. His wife is the actress Michele Dotrice, who has q^peared on his series and with whom he has done a series of Shakespearean readings. Hes also a miyor recording star in England and Australia, plays very good piano and collects antique swords.  Q</p>
        <p>TheEvualBer is back on CBS, with Edward Woodward foiiingthe bad guys. Butin Juiy he confronted, andsunrived, his greatest reaHife crisis a serious heart attack.</p>
        <p>PIME 24  NIWEMBI22,1M7  nUMK MMAZME</p>
        <pb facs="00096780_0117" />
        <pb facs="00096780_0118" />
        <p>I-</p>
        <p>Iglg KMg^ljjjlOyCP ^</p>
        <p>lssi.finiimR</p>
        <p>8lhna4a.1</p>
        <p>fmm ROitO</p>
        <p>liwr !</p>
        <p>s auB&amp;gt;]</p>
        <p>ms JSBSUBBfitt.</p>
        <p>ImBRBI, MMUinaBHVIMt</p>
        <p>|l!gt ^ iMOa&amp;gt;^ ]</p>
        <p>fma mmmmsF*</p>
        <p>1 n^KI mmmlOmm</p>
        <p>SSW.1K]</p>
        <p>I OSfim MS&amp;amp;C&amp;amp;r</p>
        <p>Bi.S8S1</p>
        <p>'OCCSS?</p>
        <p>1- rOTTl</p>
        <p>mjssmsrn</p>
        <p>y *&amp;amp;wgr</p>
        <p>'isummr</p>
        <p>wasr ssssBPSi</p>
        <p>BWCi</p>
        <p>JfADOii**;</p>
        <p>lea a-arsBL. Maaaaawa</p>
        <p>JV CCiSrSS^^</p>
        <p>mmss</p>
        <p>im  mssusi^</p>
        <p>ISS^</p>
        <p>ZSSff</p>
        <p>SM camSSrS^U</p>
        <p>ir MIES8U BTOMW</p>
        <p>SBgigTOSSiA</p>
        <p>s^ssss</p>
        <p>SSffJwii IIII</p>
        <p>W5#Stf5</p>
        <p>ilMPMIItl</p>
        <p>B* mWMBm]</p>
        <p>mm^SSSSSl</p>
        <p>QgMg r wlIWWWWW&amp;gt; j</p>
        <p>mmrTmmmm]</p>
        <p>ar* -Bgaurig" -.agt</p>
        <p>K,</p>
        <p>TRAMie</p>
        <p>m ^ .BSRSr</p>
        <p>ffiSSMSSTB&amp;amp;ff ]</p>
        <p>..im:</p>
        <p>jmsi</p>
        <p>UkM-. '^bBS vMHIMrM^</p>
        <p>iSBSSi^jSSS?</p>
        <p>W^mm. wmr</p>
        <p>Jtimia i</p>
        <p>^XSfiSS*</p>
        <p>iBar Mf?</p>
        <p>USBSBI</p>
        <p>Bb'MSKT</p>
        <p>SSSmmSSSSSS,</p>
        <p>moM* tmmmmtm wwci mummmmmmm</p>
        <p>8S6 unwtSSIianm</p>
        <p>na SSfiUBSSSF</p>
        <p>nOCVl iMiPCKIWyCC</p>
        <p>B* .BS.</p>
        <p>MnASffiffBr</p>
        <p>ffis .ana</p>
        <p>|MM IMMMMI fllM MWINm</p>
        <p>nifilSCS</p>
        <p>B</p>
        <p>aran mtmmmjMn</p>
        <p>hwpW OMMCBIcm</p>
        <p>no fmyMMMi</p>
        <p>OB BMKOOM</p>
        <p>ff-WJSW</p>
        <p>aasttn fflUBMn</p>
        <p>nEl BMnwlilC</p>
        <p>CBilfflfliWoS'lE&amp;amp;Wi</p>
        <p>22a* gMtilt- ^</p>
        <p>aaww MBrarifis</p>
        <p>a8r8UEssrm|5^!^mS!li</p>
        <p>ONRRRO*</p>
        <p>&amp;lt;123.</p>
        <p>iiMiynfgiL</p>
        <p>IMN MBOIMI COI</p>
        <p>ir sfism 11^</p>
        <p>iS^g|^|y^TB5*</p>
        <p>OBfcn COiBS - ai</p>
        <p>[S^jSS^bI</p>
        <p>iBBfe nc</p>
        <p>IB*&amp;lt;CSSI</p>
        <p>RAM flHi</p>
        <p>ARM</p>
        <p>OSB mSR^Cni</p>
        <p>^ooPBjn^ocoBBR</p>
        <p>^Sbd</p>
        <p>aMMM nUMIIIMMI</p>
        <p>9Bb nSmSmT</p>
        <p>IHOiPBDOMOl</p>
        <p>iiiSiB3Srr</p>
        <p>AJ8BglR</p>
        <p>anltfJAaMi</p>
        <pb facs="00096780_0119" />
        <p>-wr- mma.</p>
        <p>m Mikssm,]</p>
        <p>i^itssar</p>
        <p>MMU* MMUMWn^</p>
        <p>WS^ '&amp;gt; JWSiSSSt</p>
        <p>m^wmsf</p>
        <p>MM ^ &amp;gt;MU&amp;lt; wW raMR</p>
        <p>-Mtt MHLflmDMD</p>
        <p>pBiiaJ8MgtW?Wg</p>
        <p>sr</p>
        <p>afeagggSBi</p>
        <p>mm iMMigiHDiM|Mi</p>
        <p>y|g* ^ammmm</p>
        <p>'jaesen</p>
        <p>m &amp;lt;&amp;gt; Msg. lab sRisaui</p>
        <p>g^WMlg^B!^</p>
        <p>lg22ESS</p>
        <p>SS ' MWL</p>
        <p>liar mw</p>
        <p>AMM  IM|||1J|Lm1</p>
        <p>mmnw ^inr^j</p>
        <p>ssriSBsr</p>
        <p>mm</p>
        <p>hm^S</p>
        <p>S^SnT</p>
        <p>Hsm</p>
        <p>I</p>
        <p>|ggKwJg|^gBBaJ^</p>
        <p>TSSSI^IISailBTSr^E^^</p>
        <p>m MLwn* in</p>
        <p>["ffga'_</p>
        <p>'"'iS^'fgar aBV8H8&amp;amp;.i</p>
        <p>OR if you prefe you may fake</p>
        <p>raENDNOMONEV-JUSTMNLOOUPON</p>
        <p>It o your</p>
        <p>The ie of CO MMMI It hem-end you Mporai^a^p^^</p>
        <p>srcoasss:^^</p>
        <p>pennylJMlMinmdinlfttipploeloa ourmpoMt.</p>
        <p>NonttdtoaondtnyinomynothHMVbR  ifwCOi you onftr during your mtmbor</p>
        <p>VMV ! IVIfH  INiwmof      t^w  linWVWfffWWfHWfOlpfWtifrmw</p>
        <p>yotr--end you may then cvoil your moiK your trwoMmard agroarnairt. you may caiv-bariHpanyilmianvdoingaa  omrnainbariimatarwtlmKNyoudaddato</p>
        <p>HertheClubefto.AbouteMryfour</p>
        <p>waaia(0</p>
        <p>CbnmMlc</p>
        <p>fS*</p>
        <p>TOSSSSSSSSS^, SKS!fflOSSii^</p>
        <p>loWolupto19iiuy&amp;amp;opporturiae  AOWNCE  BONUS  OFFER:  Aa  a  wadal</p>
        <p>ByouolahioiooaNaBitOalacilonoHht -------------  </p>
        <p>- younoaddonotMng~lt'^^</p>
        <p>  __________ CompiPlOltciIjWt---------</p>
        <p>alippad autadioally. N you ptiim an al- addibnall&amp;amp;S&amp;amp;viacli^i famalaaalaodon.flrnontatal.NltnMm aalacdonalaaupartoapttoal</p>
        <p>lachanoatogata</p>
        <p>you an iWth</p>
        <p>8BMEmeaC3C0MMCT</p>
        <p>nscsranoNurttoo</p>
        <p>ftaanrErPUfliE</p>
        <p>AM</p>
        <p>Km-</p>
        <p>srs:</p>
        <p>Nt</p>
        <p>!?yjT*jrTTTSmft^</p>
        <pb facs="00096780_0120" />
        <p>fj0f</p>
        <p>lief" *iss&amp;amp;sssss*</p>
        <p>BWb  WOmfmmtKKmnm</p>
        <p>awns B..m.</p>
        <p>mfJBKStSi'</p>
        <p>mm sTiaa</p>
        <p>mmmmmammm</p>
        <p>fgm .iiHTfffflWUi</p>
        <p>mm wooTSiMlii otBiei NBMtwiMaNr</p>
        <p>msk mssf^</p>
        <p>fMMEi MRiVMnilMip</p>
        <p>wsn'jmvSrn</p>
        <p>mm ammmmm</p>
        <p>fmmm mmmm</p>
        <p>|lww BBBB TBgftgjg</p>
        <p>aa mMssUi</p>
        <p>JSSitlii</p>
        <p>StgSgriai &amp;lt;ssMi.'</p>
        <p>3MSW BMUHBWiaaMt</p>
        <p>WWMm* IMiWIIBMDa</p>
        <p>ss^ymnui</p>
        <p> umbi amataammitim</p>
        <p>wSS/Miiiawr</p>
        <p>^ ^ msm</p>
        <p>Ir ssmsssrni</p>
        <p>1 * th -If' asr^rt^k ,if</p>
        <p>I^bhbqii^</p>
        <p>mv^ORSSiyimmR%pkmadiMice to get2 more FREE</p>
        <p>naiKit9aimiiHiibfeidtaM&amp;lt;mtiao</p>
        <p>idNCk rMOMraidw for ltfl(m form I</p>
        <p>opsv  siiaa IT IN</p>
        <p>BB iSR^II^fS</p>
        <p>mmmsr</p>
        <p>S itiumni</p>
        <p>S^^'"BStSSSSm</p>
        <p>s^rMOsar</p>
        <p>m^ssssr</p>
        <p>gr*'-</p>
        <p>'SSffssamt</p>
        <p>S&amp;amp;8S^i^ssQ</p>
        <p>rnsim</p>
        <p>Ssasiigi^Sp</p>
        <p>ir vWmBL</p>
        <p>m</p>
        <p>mss^ssnssi^</p>
        <p>V aaaNnwriaia.</p>
        <p>asm* wage* I</p>
        <p>ir^ ssstsK</p>
        <p>MM JOaiMiY</p>
        <p>mus rir MrnHBMl '.^t l</p>
        <p>p*tw i-aflfeM</p>
        <p>Hf  .?s. '^rmirwi</p>
        <p>mamm aiiuza </p>
        <p>'ssissws'sssssisisse^^</p>
        <p>-</p>
        <p>12 TAPES OR RECORDS I OR 3 COMPACT DISCS I</p>
        <p>ihiM</p>
        <p>n'u-j il^iDpinq rind tuincilinc] A'ith inpintirrship urtiU" ! 'rn^^ Outhnpd dmO'/.</p>
        <p>CMMEnB Dncon</p>
        <p>QtopTiioGK DPOP  aooiMmv</p>
        <p>HfcHU&amp;lt;llKk  ftWlNlMllft  JMZ</p>
        <p>AMMtaw rntOmma n IMU^VMnM. aXCKMUWC aiMvunmMQ </p>
        <p>MyNMKUt MwyMlM UmiSSSm MMemnaeH</p>
        <p>mtmtHrnm</p>
        <p>AnylfeMyouean</p>
        <p>Reonl&amp;amp;1p0CI----</p>
        <p>doon ribums ii IW m and</p>
        <p>ndnwH</p>
        <p>chaGkorinonayantarf(Hii86 (M12 aalMliora^ pkjs im t.</p>
        <p>caialtnimbaratan))imeartBrdolno</p>
        <p>How tht Club raoaivatheCli-------</p>
        <p>of tha Month for aach mmvw mw&amp;gt;...piw hhmvwip w natas from avary yd of musfe lnjadc^</p>
        <p>vldaoeasaanaayoupuchaaaasaCtub...</p>
        <p>TuiBiii!WWOfyouifnwiD&amp;gt;iin^</p>
        <p>lor ow'Hy b&amp;gt;gt ona free*'</p>
        <p>_ . _ Each 'thatataat jmtfmato lhaCDsor itoward</p>
        <p>roBNn wnaooevor, MI raiumawM yuwH wiDwi wom NT  iwi</p>
        <p>laMidandyouwMhavanofurtharofagaltoftSoadno^^</p>
        <p>/yHEHESHOfTOQEr2IIOIlEAIJUM8FIiyouwlah.</p>
        <p>rc</p>
        <p>saSSSS-SaSgSgK BfessBSssffl--"---</p>
        <p>HttfaCM^DISC</p>
        <p>that</p>
        <pb facs="00096780_0121" />
        <p>The</p>
        <p>Dailv Reflectors</p>
        <p>VMi CMv r* Ik ok or Nomte 22 - NtMolitr 28k MNEva Marie Saint Re-Establishes Old Ties</p>
        <p>By Evan Levine</p>
        <p>In the world of icy Ifitchcoddan blondes, few could forget the scene in North by Nor^est (19S9) where Eva Btoie ^int steps off a train with leggy grace and coolly appraises a p^ive Cary Grant. Saint brought to her role in On the Waterfront" (1954), as well as flms like Exodus" (1960). This week. Saint plays a more down-home kind of role, as a mother in a rural town in ABCs Norman Rockwells Breaking Home Ties," airing Nov. 26.</p>
        <p>Its important to keep up with the times," Saint explains, ^n I was first approached about doing a TV role, I said no. Then my agent asked me what my favorite show was. I said 'Moonlighting, and the week after, I had a recurring role," She played Cybill Shepherds mother. That made me more open to various roles. When this came along, I was very q)en-minded."</p>
        <p>Breaking Home Ties" takes its premise from a Norman Rockwell painting; a father and son are waiting for the train that will take the boy to college. The movie picks up the struggle the young man (Doug McKeon) faces at school, and the problems the rest the family has in the town where they Uve. Jasm Rob^ and Claire Trevor, also Academy Award wimim, round'wt the cast, as the boys father and teacher, respectively.</p>
        <p>e *T used to have a very limited view of myself and kind of into I could play," Saint explains. The person who was responsible for turning me around was Hitchcock. I had never iseen myslef as a sexy blonde. He changed my attitude, made : me realize I could do anything."</p>
        <p>Saint says that Hitchcock also showed her the importance of working with good actors. I had worked with Jason (Robards) before," she says. And working with good actors was reason enough to take this part.</p>
        <p>I also liked the character," she continues. Shes very giving. I dont agree with a decision she made, but I understand</p>
        <p>L 'v  .  4   </p>
        <p>lason Robanb (I.), Ia Marie Sainl and Douglas McKeon star in ABC's "Norman Rockwell's Breaking Home Ties/' a Thanksgiving special based on a Norman Rockwell paliiting. It airs Thursday, Nov. 26._</p>
        <p>it. The combination of the people involved and the script drew mein.</p>
        <p>Saind also liked the role because it wasnt typical Thanksgiving fare. It wasnt just sentimental," she explains. There was a hard edge, not holiday sweetness.</p>
        <p>But the best pprt," she reiterates, was working with Jason. In A Christmas to Remember we had a grandchild. This time we have a child. Next time," she says, Ill probably be pregnant."</p>
        <pb facs="00096780_0122" />
        <p>iip</p>
        <p>TV-2 Th*OrtyRfltor,Orwtll*,II.C. Sunday, Nowembw 22,1887</p>
        <p>Park Place</p>
        <p>Youth roup</p>
        <p>Single dresser with bookcase, headboard, footbo^, and storage underneath with mattress.</p>
        <p>Rg.$7S2JS -479*i (ftoor sample only)</p>
        <p>Burlington House Bedroom Suite</p>
        <p>Headboard, night table, armoire,dre8aw, and minor</p>
        <p>.*999** (floor sample only)</p>
        <p>Hurry. Don*t WaM</p>
        <p>^Ceming ^uxnihixe Co,</p>
        <p>Wtt</p>
        <p>1012 Dickinson Ave.</p>
        <p>MaslBicafd</p>
        <p>OnlyShipping Days Til Christinas</p>
        <p>New, Just arrived, handH^raftedfseulplured candles for the Holiday Season.</p>
        <p>Holiday hours effective 30, Novembar Mon.-Fri. 9 aiih 8 pm. Sat 9 am til 5 pm</p>
        <p>24 SlanionstMifo 04 (Stmilon aqua Shopphw Cenlw) Moii.-frHiM&amp;gt;HoeWI.8ettAIHe3PI  7SH712</p>
        <p>17</p>
        <p>I TVChannels !</p>
        <p>.i- :Ajo!</p>
        <p>",;qnf</p>
        <p>r-:f-</p>
        <p>m ,</p>
        <p>Aim</p>
        <p>A</p>
        <p>9</p>
        <p>7</p>
        <p>cpi</p>
        <p>9</p>
        <p>uam NK</p>
        <p>Iff</p>
        <p>flwrtAnntM</p>
        <p>-JL-</p>
        <p>19</p>
        <p>UBicr CM</p>
        <p>,9Wto!BP,-</p>
        <p>11</p>
        <p>OuHRvlMwOtobNilawfc</p>
        <p>-SL</p>
        <p>M</p>
        <p>wen ABO</p>
        <p>NwrBwu _</p>
        <p>19</p>
        <p>14</p>
        <p>air</p>
        <p>"t- -</p>
        <p>19</p>
        <p>17</p>
        <p>NBD</p>
        <p>19</p>
        <p>fHpiiGhMMl.</p>
        <p>19 </p>
        <p>ID</p>
        <p>  : c^^-' '</p>
        <p>mmmJrnSmm</p>
        <p>11</p>
        <p>It</p>
        <p>DlMWvCmwnP</p>
        <p>H</p>
        <p>umm</p>
        <p>94</p>
        <p>MMIMWuPNNmN</p>
        <p>99</p>
        <p>USA</p>
        <p>99</p>
        <p>HIV</p>
        <p>V</p>
        <p>99</p>
        <p>99</p>
        <p>HMAL CBS</p>
        <p>-9tob-</p>
        <p>99</p>
        <p>am</p>
        <p>1</p>
        <p>urira aiD</p>
        <p>UMMMO&amp;amp;</p>
        <p>Pmgnm whtdulM Mud In TV SiMWtlRW M futnMMd by IM</p>
        <p>GmmMu OiNy fMaetor. TV SlwwMmu. AN UniM MSi BnleiDiliufc 332 Eirt Bhw. Hopwirtl. VaTsato</p>
        <p>Put yoar money where your market is...</p>
        <p>r</p>
        <p>The</p>
        <p>DaSy Reflector's</p>
        <p>V</p>
        <p>SHCWTIME</p>
        <p>mwm.</p>
        <p>NEW AMT 600. WHEN YOUVE GOT WORK TO 00.</p>
        <p>*3136*</p>
        <p>(Includes Tax)</p>
        <p>LEADERSmP YOU CAN COUNT ON</p>
        <p> The new All Materials Transport gives you true hauling abiiity. Carries loads up to 600 pounds on level ground. Box is 4 feet by 3V4 feet by 11 inches.</p>
        <p> Get five-wheel stability and four-wheel drive. The 341 Gc ei^^ giva you a towing capacity of 1000 pounds. The variabte-speed transmission gives you a top speed of 20 mph, frius reverse.</p>
        <p>GREENVILLE TURF &amp;amp; TRACTOR</p>
        <p>218 Airport Rd.  Qroanvllia  757-1207 And</p>
        <p>FARMVILLE IMPLEMENT CO., c</p>
        <p>Hwy. 264 ByPaaa  FamwlNa  7534143</p>
        <p>Dale Robertson "JJ.SUrtMnck' Nov. 24 - NBC</p>
        <p>Joseph Bologna "Ragstolliclies'' Nov. 27-NBC</p>
        <p>SPECIAL OF THE WEEK!</p>
        <p>HEAVY DUTY EXTRA LAROE CAPACITY WASHER</p>
        <p>MoMWUMSIOOQ</p>
        <p>^ulw wash cycW. TWo wash/rinse tempwatura aelec-tiona.EnargyaaMing cold watar rinse.  i</p>
        <p>WAS $399. NOW $319..</p>
        <p>JAVE0'</p>
        <p>Bedrictl AppHiiieta 9lnM 1929*</p>
        <p>A pieiiNi la navw baMar than Hia aanlae bsMnd R.</p>
        <p>vow awt,iciT warn cum meraaviMMwawNca waayt</p>
        <p>IWM</p>
        <p>aw aiMN Mi. ms</p>
        <p>Michele Will Tell</p>
        <p>Mck a IW mdMM Mtar UMm Nhht -</p>
        <p>iiaaDuinrvmHr.NBWFORr,RX</p>
        <p>DiC. m rmed I Aimie, NJ, ml Blit</p>
        <p>The son of an Iraqi-bn life innirance execattve. Noun</p>
        <p>attended RolBm  to  Florida and Eroer^</p>
        <p>to BoBtoL where he ttodied theater arto planned to Iblhm to hto fathers foetatep4 "Tm licensed life tosnrsnce salesnisn,Nosri says,Iwt 1 was osl^ it long ewn# to know I never wantod to work to an office</p>
        <p>aoato. batowl, he optod for an acttog cweer. Alter staM with Jim Tattle and briefly with the late Lee</p>
        <p>Straabergjfoiri got hb flrrt iwofesiloiial M iwrt to toe 19$$ fiiiiLoodbye Coininbna. Dartagtoe mid-7$s, ba npeared to daytime aoq ("Somaraet, W fto TbminitmO I Prtne^</p>
        <p>His biggest role came to toe 1993 film Flashdanoe.* Last aeaaoB he stoned to toe ahort-Uved CBS aeries'Down-</p>
        <p>town, and the miniaeries Rage of Angek The Story Cootinties. The taU, iwarthy actor was married on May 10,19$$. to toe fecmer Vicky UghL Hes cnnently ator-rtag to toe bigwcreen torilier "The Hidden, wHb Kyle RIacLachlan.</p>
        <p>Dear Mehele: Was Meredito Baiter BImay OBCt to ton TVaariaa-lfettodJinctlTfedtoadi^f^</p>
        <p>late Geidn MneRae? ~ BnEL BEVAOQUA, FT. PI-ERCS.FLA.</p>
        <p>Its Meiedito MacRae yoare totoktog of on boto connto!</p>
        <p>Meredito, bom to 1N$. to the late Gordon MacRae and bb actress/singer wife Sheito, appeared as Billie Jo</p>
        <p>Bradley onPetticoat Junction (1969-70). She b manied</p>
        <p>to actor Greg MuUavey (Mary Hartman. Mary Hartman). Meredito Baxter Bimey, 40. currently starring on Family Tics, b the dsiighter of actress Whitney Blake ("Haxel) and former Loa Angeles radio annonncer Tom Baxter. She b married to actor David Bimey.</p>
        <p>Dear Michele: What was toe real name of WeMero atar Back Jones? - BOB KUCHENBE, MARINKTTE, Wise.</p>
        <p>Jones was boro Charles Frederick Gebbart, Dee. 4, 1969, to Vincennes, Ind. He rode to fame to Westwma oi the 20s and SOs, including The Desert Outlaw (1024), Texas Ranger (1934) and the "Phantom Rider aerial (1036). He died to 1942 to a Boston nightclub fire, while on a campaign to sell U.S. Bonds.</p>
        <p>Please addnai qnestiQiia to Michele Will TeO, e/o tob newapapar, PjO. Box 221$, Qnad Central Stotkni. New York, NY 10192. Bacaase of toe volnme of mall leoehred, personal repUes cannot ba sent</p>
        <p>VJi MERRITT &amp;amp; SONS</p>
        <p>AppHanets Sin rttHwUwain</p>
        <p>7S2-S736</p>
        <p>OiCKIEROOK</p>
        <p>A CLEAFffiR WORLD reminds you that as . you stort using your cold weather clothes to' check them for moth or other insect damage; also before putting your warm weather garmenb away, A CLEANER WORLD reminds you that it b important to have them cleaned to protect against insect damage.</p>
        <p>Although moth damage occurs during the summer months with woolens, warm weather garmenb that are not properly cleaned can also be attacked by insecb. So, just dont for^ about your warm weather garmtoib as you change to your winter wardrobe.</p>
        <p>ACI^nerWorld</p>
        <p>UE^GrauauUluBM.</p>
        <p>Vkfc Ug StatiM. Wm U Chch SS8-S710 S8S4I10</p>
        <p>MAJMUINiaMWMV^</p>
        <p> ...</p>
        <pb facs="00096780_0123" />
        <p>.-fe-</p>
        <p>Sunday Daytime</p>
        <p>tmm iM 1MI Of He</p>
        <p>ISeliiiiOllliV [iBvDm ^ Unit Tids Sporting</p>
        <p>) VUn VRmUobi IMPlwi (BnOAMrtCMlliidillH-aMi</p>
        <p>ajnQjinviMii</p>
        <p>rMmm mwm wm^miy</p>
        <p>nmJwUOnwm</p>
        <p>Sylvester</p>
        <p>an</p>
        <p>Utl</p>
        <p>MttnfUm</p>
        <p>So Mem Finiins Rein-bo$r(i9U)</p>
        <p>gix) lOCI aoekx VMio Te</p>
        <p>(BBOff) Mem Yong And FNe(im) (imitlifMltn Titofhimrtliimil Q8iMiDereat)g iRetotScMMg''</p>
        <p>Eimm MIhVIii^</p>
        <p>Heat Ofive</p>
        <p> Jtrry</p>
        <p>UPTON andassooahs</p>
        <p>234 Gresnvilie Blvd. 356-7002</p>
        <p>nitNuinberltoimkW</p>
        <p>VISUAL mPRESSION OF OPENNESS-. Arched foyer, formal living at dining, sunken library, Grecian columns, 9 piece mofdings, recreation with wet bar, solarium, 5 bedrooms/adjoining S baths, pool with Jacuzzi et more. IS98.000. Contact Annette Parker-Butler 355-7002 or 355-7009.</p>
        <p>GDOMHAr</p>
        <p>rltrii insmmiiiiue</p>
        <p>fmimi</p>
        <p>aMwMldHyt iiheraaiiBw</p>
        <p> t</p>
        <p>JfthVHtta Myetette Ottes Of</p>
        <p>4DIV) Hem Free ^t</p>
        <p>am</p>
        <p>flfliy Ton A Jmj Aad</p>
        <p>Mf ImMttftpdMd OlHeOUBeiM QOaiBdsyMmN</p>
        <p>Movie Strange Invaders (1M2)</p>
        <p>flMC) Mem Code Name: Emerald (IMS)</p>
        <p>IIJI</p>
        <p>ffmniMii (VimMNiei</p>
        <p>MSOeMiiao</p>
        <p>DkkCMm</p>
        <p>ffi Mem Dick Tracy Versas CnebaTftMd)</p>
        <p>8sr^</p>
        <p>miWhlheWillees</p>
        <p>MOlMBlMbapem</p>
        <p>pO) Mem Over lie Edge (1W)</p>
        <p> iMNeesBiMi</p>
        <p>imieVMmaOipRM!-</p>
        <p>lim mMrtoekSST"^**^*^ fkpeg O finl PiirtfltfliB CMRk FMBiVtMaMdl (eiRMMKAitiM pI)BroaikOfUfe (Ml Mem No Deposit, No RetBm(197S) (UP^GHdMoiyUpdm (MAI) Mem Thats Life!</p>
        <p>MaatThePnaig</p>
        <p>ODkkCmn</p>
        <p>(AMQ Mem Scott Of The Antarctic (IMS)</p>
        <p>I Mem Hamah And Her Sisten(lM6)</p>
        <p>(Uit)PkMlMlBnalVp-</p>
        <p>The DMy rMtoetor, OroMwine. N.C.  Swidey, Mwumfcer 22. tee?</p>
        <p>rv-3</p>
        <p>NBE ModM VHee ie</p>
        <p>rMem Tine Days Of The OoodorUMI)</p>
        <p>)OMYeeBeHtaMrt</p>
        <p>(Show Bob (INI)</p>
        <p>THeVMSB</p>
        <p>Yen CmFI De ThM Oe</p>
        <p>(MO) Mom A Home Of Oar Own(lf7S)</p>
        <p>(TMQMem The DelU Force (1</p>
        <p>AH-AnminfMMg ISMMBmwflyimad e North CaimMlMi Hoik</p>
        <p>NattoaalGoopepMe NFL live</p>
        <p>I gUUj^MimrH^</p>
        <p>liWQOtmmMeweWeleoih Decode Mad t^OMiOflBlaaaolt</p>
        <p>Memnawsiii^afTS) BMMBMHMkflOi n^YhMttli. )MhopaiMe|||HYp-</p>
        <p>)fBofMty</p>
        <p>jMemSaaFranciac(r</p>
        <p>(19M)</p>
        <p>sme Mem Jack Slade (19SS) IMifkmFbflarliopa</p>
        <p>d) Mem Charlottes Web (WJ)</p>
        <p>(ui9iiiiiGiimjmiMi%&amp;gt;</p>
        <p>pgSi&amp;amp;i</p>
        <p>l5S8f!ffl^.Ky!!h</p>
        <p>rheBnkeniiele(lllS)</p>
        <p>OJoFOrFiWiai</p>
        <p>ONiLPMieil</p>
        <p>GDMemTheJah-am) V</p>
        <p>S Mem The Hwdven, taresOf Merlin Jones (1N4K  Q^lMadKPirim%</p>
        <p>(IMM) Moldo IMMoeChiMw-</p>
        <p>MieNhoalOffhmMg lUMAadtMsCIAaM</p>
        <p>SkleVkwa</p>
        <p>Kenny Ro0m OiiFiftti</p>
        <p>(cLAHIidBleheecklOM: mrnCIW) Mevlt 'Vnight,^ Mother(UN)</p>
        <p>ima JWM vinm Mmas</p>
        <p>OsokMr-OMdoon</p>
        <p>)AMci</p>
        <p>JOmhlboMril JSomrFOTOo iQUheBooit )llr.inHdfliVsrid</p>
        <p>MemHoter(lN7) JIMYoilhatlkn Mem Frontier Days</p>
        <p>AMO</p>
        <p>uam</p>
        <p>VoridlMnernw MMoOonchoeShow IMeWeokWHkDnvldBrMk-</p>
        <p>LeveYoarSkM SportoCMdor amdtf. GaMiy Fin^liodkdml^</p>
        <p>Vh Yea WMe Bare IsmaihMIMnrlMDd eMrli^HnQwM PheeltoNMloi (1) The Meoa Moat The fUM-</p>
        <p>lOoMrol ILeaeYevflkM</p>
        <p>jAMeiyhM;..</p>
        <p>ILookAtMoNew imkSehooiNMC</p>
        <p>m m a a a</p>
        <p>9</p>
        <p>Dp.</p>
        <p>UttMIte</p>
        <p>Mom The Night Of (IfM)</p>
        <p>MMMB</p>
        <p>Hiom Bananas (1171)</p>
        <p>Here are highlights M hM varied career:  '^^1.</p>
        <p>* Rogers hosted TkEtai on the River. a syndieatcd ply variety series with his oh) groop, the First Edition (1971).</p>
        <p>* His actin dehat was in The Dream Makers, a TV movie (1979).</p>
        <p>* Rogers has tamed two of his lMest muMcal hits iMo four TV (ffodnctiooa: The Gambler (1980), Coward of the County  (INI), The Gam-Uo- Part n The Adventure Continues (1993) and this wedis The (bmbler HI -</p>
        <p>MM</p>
        <p>Oaford Hues (1M4)  ^</p>
        <p>smOOpoiFarBndnem O The Nompoychology Of WsmtOsMrol</p>
        <p> Mem Minier By Death (IWI)</p>
        <p>Mem Midnight Mad-ness(lNO&amp;gt;</p>
        <p>gjF) Panpeettves On Ndil-ttonhLatorlMmey  ___</p>
        <p>(NCT) Daddy. rmThsir</p>
        <p>New</p>
        <p>(INN)PwfonnaaeePMB (IMA)GhnekItOM!</p>
        <p>His featnre-film dd)M was as a stock-car driver who iMier-its six orphaiB in Six Pack (1992).</p>
        <p>S</p>
        <p>IMBOiMbon</p>
        <p>NoMok a Bnthar</p>
        <p>(DO) Mem Ifarplqrs Romance (19M)</p>
        <p>ABMriean gpom Mofs-dM</p>
        <p>t;U(MAl)Mem Big Tmable b Little CUaa (INI) tJPDChowhfABmMos ODtaaSndS lUooYevlkM</p>
        <p>NEW LOCATION</p>
        <p>SIWSINQLE VISION LENSES</p>
        <p>IMMSnVKE</p>
        <p>mmm</p>
        <p>vtM.acii</p>
        <p>OnwQogdThniNM.aiMW ,m5</p>
        <p>opmmmomn. LMiNn. ar apl</p>
        <p>OK.*iUMnili|ln,aliHU*a</p>
        <p>aiu-vK</p>
        <p>iniCIMB</p>
        <p>Tiim aoa&amp;lt;8TAMrowso,QEoiMUi</p>
        <pb facs="00096780_0124" />
        <p>TV- 7li0rtlylWIstor.QwwMI.M.C. 8MiHtey.Nwwfrt2.m7</p>
        <p>Sunday Evening</p>
        <p>SUNDAY EVENING</p>
        <p>7:00</p>
        <p>Cros^</p>
        <p>OeGrassi</p>
        <p>7:80</p>
        <p>La$lFro(rtier</p>
        <p>Animals</p>
        <p>60 Minutes</p>
        <p>21 Jump Street</p>
        <p>Our House</p>
        <p>60 Minutes</p>
        <p>8:00  8:30</p>
        <p>Paper Chase</p>
        <p>Nature</p>
        <p>Murder. She Wrote</p>
        <p>FamiyTies</p>
        <p>WtthChMran</p>
        <p>9:00  9:30</p>
        <p>In Touch</p>
        <p>Upstairs, Downstairs</p>
        <p>10:00</p>
        <p>Ben Haden</p>
        <p>10:30</p>
        <p>RockAtve</p>
        <p>Masterpiece Theatre</p>
        <p>Movte 1110 Gambler HI: The Legend Contlmies'*</p>
        <p>T.UIIman</p>
        <p>Duet</p>
        <p>News</p>
        <p>Movie: "The Empbe Strikes Back</p>
        <p>Murder, She WrrHe</p>
        <p>06</p>
        <p>ESPN</p>
        <p>HBO</p>
        <p>IK</p>
        <p>MAX</p>
        <p>SHOW</p>
        <p>1MC</p>
        <p>USA</p>
        <p>mis</p>
        <p>Movie; The ThanksglvitHi Promise"</p>
        <p>Movie: "Yankee Doodle Dandy"</p>
        <p>NaPrkneTime</p>
        <p>Movie: "The Gambler III: The leflendContinuee"</p>
        <p>Ooiy</p>
        <p>Buck James</p>
        <p>Movie; "How The West Was Won"</p>
        <p>NFL Footbil Miami Dolphins at Dalas Cowboys</p>
        <p>Movie: "Sylvester"</p>
        <p>AMA Video Clinic</p>
        <p>PhysiciansJournal UpdMe</p>
        <p>Movie; John F.Kermady"</p>
        <p>"Strange invaden</p>
        <p>Comedy</p>
        <p>Movie; One Cnzy Summer</p>
        <p>Cardiology</p>
        <p>Medicine</p>
        <p>Obstetrics</p>
        <p>Movie</p>
        <p>Movie; Thais UM"</p>
        <p>Movie: Murphy's Law"</p>
        <p>Movie; "Tex</p>
        <p>Riptide</p>
        <p>Mie Hammer</p>
        <p>Movie; "Duel"</p>
        <p>Movie; "Wise Guys"</p>
        <p>Movie: "The Delta Fbtce</p>
        <p>Cower Story</p>
        <p>Holywood</p>
        <p>Robert KWn Time</p>
        <p>National Geographic Explorer</p>
        <p>MOBig Valley  North CwqUm People S) Wooderfai World ofumer eABCNewag (Bn)Hea Ob Barth</p>
        <p>BOvBoae</p>
        <p>0 Movie "The Thanksgiving Pramiae"(lN) (Ain^DMiedlMoi (BR) OrteliaB Ufoatyk Maga-</p>
        <p>gjiK</p>
        <p>(NKI) C H Where Are Yob?</p>
        <p>(SBOW) Movie "Strange Invaders" (1982)</p>
        <p>NPLPriMfltaM</p>
        <p>^gdv^"(1985)</p>
        <p>)AlnMlf MSOfllaMiBe eSBMDWoBder (ABYB TveaUeth Geatary (BBT) Breath Of Life 9BS) Movie Yankee Doodle Dandy" (1942)</p>
        <p>(ES^SkiWerid</p>
        <p>(UFE B)fperteneieB: No. 1</p>
        <p>miar la Bhick America</p>
        <p>(NlCK)Laiihb</p>
        <p>(WTBS) New Leeve It To Bea*</p>
        <p>7:BOOCh)aabow</p>
        <p>ODeOraeeiJiinlorHigh</p>
        <p>OQMMtniaa</p>
        <p>(DllJanpStieet</p>
        <p>CBMe</p>
        <p>(MAX) Movie "John F. Kennedy; Years Of Lightning, Day Of Dnuns(19S5)</p>
        <p>(MOK) Mad Moviee With The</p>
        <p>ULCOBBeetiea</p>
        <p>(TM(9 Movie "Tex" (1982)</p>
        <p>(INN) Ameiicea Sports Maga-</p>
        <p>Mbo</p>
        <p>(DBA) Riptide</p>
        <p>(W1B8) Movie Doer (1971) TJBeLaetFNaiier OWBd.WiM World Of ABtanals</p>
        <p>out to be Kingsfields danghter. (I hr.)</p>
        <p>O Natare A portrait of the hammer-headed stork. In stereo. g(l hr.)</p>
        <p>OOMmder. She WKIe Jessica poses as a dead woman's sister to investigate her morder. P(lhr.)</p>
        <p>d) Werewolf A greedy heir frames for the mnrder of his wifes wealthy grandmother. In stereo.</p>
        <p>O Fearily TMi Mallory deddes to ran for student bo^ president and Alex offers to be her campaign manager. In stereo.</p>
        <p>(R)i</p>
        <p>IBuHaioBill</p>
        <p>)Smotherel (lMN)IBlldeWimtoo(bpRa^</p>
        <p>tMO Piper Chase Hart becomes romantically involved with a young woman who turns</p>
        <p>(ARn)YoiMeMMlBtalirThe vinass media coaches Jhn Hack-er on how to present his defense strategy on natioBal television. (MAX) ChNDBi Oome4y Blpe^ ImoBt Veteran comedians Shecky Greene, Corbett Monica and Jan Murray on life in the funny business. Host: Garry Marshall. In stereo.</p>
        <p>(TNN) mddOB Anoi Featured: crew chief Dale Armstrong tunes Kenny Bernsteins funny car for the NHRA Winternation-als. In stereo.</p>
        <p>MiaiBToach O uprtain, DowMtali Undercurrents of tension are crented in the household when James escorts Georgina, leaving his father to comfmrt HaxeL (R) (1 hr.) O Movie "The Gambler HI; The Legend Continues (Prem-iere) (Part 1 of 2) Kenny Rogers, Bruce Boxleitner., Brady Hawkes offers to s^ as mediator brtween the and Sioux tribal leaden as tensions rise over a prt^Msed land-reform bill. (Part two ain Tuesday.) g(2hrs.)</p>
        <p>(9 Ttacev UflsBtt Show A &amp;lt;te-livery girt (UUman) swoons at an East Indian store owners (Cheech Marin of Cheech and Chong fame) rendition "Misty. In stereo.</p>
        <p>0 Dolly Dolly ParUm returns home to Sevier County, Tenn., to celebrate Thanksgiving with family and friends. In stereo, g (I hr.)</p>
        <p>(ARI8)DlaBBa Warwick b Lob-dOB Singer Dionne Warwick in Joined in performance by Di-ahann Carroll, Vic Danume and Gregpry Hines. Selections include "Walk on By and "Say a Little Prayer." (Ibr.)</p>
        <p>with Lava Jrt MacUae drivw Roger GHotin.b stereo.</p>
        <p>(DBA) Ho8ywBod hMdw Schedr uled: lUm Selleek ("Tbee Men and a Baby)i Arnrtd Schwar-</p>
        <p>_ BadOB</p>
        <p>0 Maitvplaol Thaatn The Bretts Marthas sprained ankle causes h to lose an important role to Lydia; the Bretts are taken to court. (Part 7 of 8) g (1 hr.)</p>
        <p>(DNews .</p>
        <p>0 Badi hum A man refuses to undergo major surgory because hea afraid to leave his daughter, who has Down syndrome, alone while he recovers. g(Ihr.)</p>
        <p>(AR1B)JaBAtlbe8mllhoeBiaB</p>
        <p>^nger Alberta Hunter co^ ments on, and performs her rep-ertwrertMues.b stereo. (1 hr.) (BST) Jimmy Swaoart</p>
        <p>Obstetrics / Gyaacology</p>
        <p>NFL FUothaD Miami Dolphins at Dallas Cowboys (Live)(3hrs.)</p>
        <p>(LDHQ PbyrtdansJournal Update</p>
        <p>(NICK) GoMsb Afe Of Tslevi-</p>
        <p>aiOB "The Cmneman Mickey Roo^ stars as an egotistical comic who brives as a star by devouring everyone around him. (2hrs.)</p>
        <p>(BBOW) Movie Murphys Law (1986)R'(2hrs.)</p>
        <p>(TNN) Arto Specialty Magasiae (UBAlMetomner IJId) Married... With ChOibeB Kelly 's heau is the son of Peggys old high-school boyfriend. In stereo, g</p>
        <p>O Movie The Empire Strikes Back (19S0) Mark HamiU, Harrison Ford. Rebel fighter Lriie Skywalker interrupts his train-ii^ as a Jedi Knight to rescue his friends from villainous Darth Vader. in stereo, g (2 hrs., 30 min.)</p>
        <p>i</p>
        <p>OFF I</p>
        <p>BtfoTB you purehaat your noxt oyowoar,  J</p>
        <p>bring in your pftscriptton and cowPBfol  |</p>
        <p>FRAMES</p>
        <p>50%</p>
        <p>(AFFORDABLE SECTION)</p>
        <p>&amp;gt;*  ton*    </p>
        <p>Wise Guys (T986)R(lhr.,35min.)</p>
        <p>(TWI) AmirleaB fljporis Maga-xtaw A look at popular spr^ events ranging from bowling to motoruorts. In stereo.</p>
        <p>(DBA) RdbrtXMa Time Guest; three ventriloquists. (1 hr.) llM0ReckAIlvB (BBO) MovieHannah And Her Sisters (1988) PG-13 (1 hr.. 50 min.)</p>
        <p>(UPB) MUeataiea b Madidae</p>
        <p>"SubeiMiocardial Infarction: The Hidden Danger</p>
        <p>(TNN) Ameriea'U Horse The AU-</p>
        <p>American Quarter Hone Congress, from Columbus, Ohio. (Part Irt 2) In stereo.</p>
        <p>ILdtOBargsrac</p>
        <p>000News</p>
        <p>"How The West Was Won (1983)-G(3 hrs.) (BD(9 Movie One Craxy Summer  (1988) PG (1 hr., 30 min.)</p>
        <p>Life!</p>
        <p>(1988)PG-13(2 bn.)</p>
        <p>(IMC) Movie The Delta Force (1988) R(2 hn.. 30 min.)</p>
        <p>(TNN) Wish Yob WSru Here Featured: New Orleans, La. In stereo.</p>
        <p>(USA) Cover Story Scheduled: Ray Charles. (R)</p>
        <p>(WTBS) Nathnal Geopaphic Explorer The wild mustangs of the West; ice boating in New YOTks Hudson Valley; the survival of the saltwater crocodile in Amtralia; monks who embody the Lord of the Dance at a festival in Nepal; the puppeteers of Palermo. Sicily. (2 hn.)</p>
        <p>9*J8(I) Dnet Rictord reacts to pressure from Linda and his father (Robert Reed) about leaving the famify business. (Part 2 of 2) In stereo, g (UFB) tatOTBrt ModklBO Update</p>
        <p>(TNN) Porfonnanct Pluo Featured: behind-the-scenes at the Baja 500; new off-road racing develo|Hnents; an interview</p>
        <p>(SOddCoBplo QCBSNiwi</p>
        <p>(AR^ BvortBg At The bqwov</p>
        <p>) Orthopuodic Surgery Update</p>
        <p>(MAX) Movie  Round Midnight (1986) ;R (2 hn., 15 min.) ffnCX) Smothero Brathon (TNN) Rodeo Mesquite Championship Rodeo from Mesqrtte, Texas. In stereo.</p>
        <p>I) Bow To Make A MUUob iTheStock Market</p>
        <p>WE DO  REPAIR</p>
        <p>Must present coupon for discount, (kiupon ex-1 pireson Decembers. 1967.  ^</p>
        <p>opnoANawc.1</p>
        <p>QreenvMeiquere,iieerK-llert 355*7070  J</p>
        <p>fiieibl|IV.lplNrdey, 10:00 eon. to 0 pJB,  f</p>
        <p>^ WMHai mmm</p>
        <p>immi______</p>
        <p>OOrtteCoadMiShow 0ABCNewsg . llJOOldYoBng OM*A*8B</p>
        <p>(9 Movie The Posbnan Always Rings Twice (1040) Lana Turner, John Garfield. A drifter's affair with the seductive wife of a cafe owner leads to mnrder in this adaptation of James M. Cains Novel. (2 hn.)</p>
        <p>Lawresce goes sUdieeiBg and rock cUanblBg ia Maui. HaweU. testereo. -  ^</p>
        <p>^(USfQPteiBetaiti ^ (WTBS) Jerry FalwiD ll'JI(SBOW) Movie ^^night. Mother (1986)PG-13(1 hr.. 45 min.)</p>
        <p>UrifOMaUuOfBaBteQoM</p>
        <p>ISrOOOLetfyjQlBi</p>
        <p>ODenBmllh</p>
        <p>0 EMBrtatanwet TUi Week</p>
        <p>Actor Steve Gatteaherg discusses his upcomteg,movie Three Men and a Buy. In stereo. (1 hr.) -(ARn)BrtbteBin ^R)FQnvrtYortM (D0 Btek NehoB: A BMher ReomdMn David Neison pays tribute to his brother Rkk. who died on New Years Eve, 1985, featuring home movies, concert footage, and interviews with his mother Harriet and his children. In stereo. (1 Iff.)</p>
        <p>(ESPN) NFL PrimaTtane Scores and highUghts of todays NFL Football games. (1 hr.) (UFDtanomtanh PBdtetrica (NKO Stock Markrt^dao (TNN) Motocnm World T^ ChanqHonshipe, from Unadilla Valley Spcffts Onter in Edmes-ton, N.Y. (Taped) In stereo. (1 hr.)</p>
        <p>(USA) baba Gabor llllODaOM</p>
        <p>VmmOi Movie Murphys Romance (1985)PG-13(1 hr., 50 min.)</p>
        <p>l8JO0JohBa6aaa OSorthrtB^orteBiaB 0JimWhtttiagtea (ARTS) YlAMMMIibter The</p>
        <p>mass media coaches Jim Hacker on bow to present his defense strategy on national television. LoiiMndaBaoy</p>
        <p>0 Don DrtLeba Show Dorn rehearses with John Forsythe, plans are made for Dorns surprise birthday party. Sherman Hemeley, Ed McMahon also guest star.</p>
        <p>(UFB) btoml Modldao Up-</p>
        <p>)Cia'YeBBathiBBer? JWoridToBBOcraw l:80tanwThaLaad 0 WhafI BoppoBlii NowO After breaking up with her boyfriend, Shirl^ sets out to find the perfect man.</p>
        <p>(ARTS) Dtomw Warwick b Lob-</p>
        <p>dOB Singer Dionne Warwick in joined in performance by Di-ahann Carroll, Vic Damone and Gregory Hines. Selections include Walk on By and "Say a Little Prayer. (1 hr.)</p>
        <p>(BBl) (USA) Go Fbr Your Drama</p>
        <p>(N8) Movie The Misadventures Of Merlin Jones (1904) G(2hrs.)</p>
        <p>(ESPN) NFLo Groatoit MomoBts Highlighto of the 1984 Miami Drtp^</p>
        <p>jterortmeut Advisory ) Bdf bqpoovMBirt Amorica Sjpoite Magi-A look at ptfutor sports events rangiiig from bowling to motorspiffts. In stereo.</p>
        <p>Sl^Morio Something Wild (19IO)R(lhr.,55min.)</p>
        <p>(TNN) Citehrily Qrtdoon Featured; singer / actress Carol</p>
        <p>1:1101</p>
        <p>(MAX) Moria Eat And Run  (I986)'R(llff.,30mte.) 1JI(SB0W) Movlo "Blue City (1986)R(I hr., 30 min.) 1JI(IMC) Movlo Joy Of Sex  (1004)R(lhr..35min.) lJI0WrtgbO6Binl (9 FridqyTlolSlkTho Sorteo Mysterious boxing gloves</p>
        <p>(Please Twm toPage 10)</p>
        <p>Hurtmlteo Bpodul</p>
        <p>0*r 100 ohannul* inoluding tcrtmbltd chan-naia. ..unaorambiBdl Comptata ayatam with atarao favorita channal satactlon, remote control and bulltJn video cipher.</p>
        <p>Inotaliod.</p>
        <p>1S9S</p>
        <p>00</p>
        <p>min$uiinTiYB</p>
        <p>QutHly8pmk$ForltMlf.</p>
        <p>I 24 Hour Sarriot NumbBr~7S6*6783  \</p>
        <p>I  OODay^CBOhPteB  I</p>
        <pb facs="00096780_0125" />
        <p>Monday - Friday Daytime</p>
        <p>mm MmI (Mon) "Easy Rider * (IMSMFrI) Ugnoa Heat" (1987)</p>
        <p>(nOV)llNli(Fri) TbeClley enlleSodalCllb(197(Q Mie VtaUMt flUp b Tka AnmffbfH) OWDflrtHr(lSe-M) eCirtoaM</p>
        <p>fUl Umj PNMbi</p>
        <p>But 01 HD</p>
        <p> (Had) Xctloo Outdoors WitkMteBens(PH)</p>
        <p>(DMI Um Tmt ads (IM</p>
        <p>CelWile Prae (Tae) Second Hundred Yeaia(rri)</p>
        <p>SkwscmdMH) MOf WdtttMy</p>
        <p>aBQini&amp;amp;8(Wed) iOfl^(1949)</p>
        <p>Skbd Ifet</p>
        <p>.a*</p>
        <p>IsSS-"</p>
        <p>(UnO PMciMiC bfonnalkiB Gn Tm Bn TUrnT? (liai,TSa^ PM) Love Your Skin (Wed.Thn)</p>
        <p>(WIBQ Gnan Acni (Mot)</p>
        <p>GomerPyle(Tue-FVi) M8(iKm) Movie (Mon) A Home Of Our Own (1975)</p>
        <p>Dudh</p>
        <p>OCBBlbwi</p>
        <p>d) PM Abovt (Mas-Wed) Slar-com (Thu) SyWanian Families (Fri)</p>
        <p>)BatatHHoB</p>
        <p>iGMb</p>
        <p>) (Wed) White Water Sam (197^ (^CuiiolocyUpdalo(Man. M) Family Medicine Update (Tw. Tkn) Sp^y Update: Surgery (Wed)</p>
        <p>------ (Fri)  "Stonnin*</p>
        <p>OB BBC Nest Nnin</p>
        <p> Mivle (Tkn)David Copper-field^(lMS)</p>
        <p>OAdamandltfkMoBayWMd (Mae) McLaugkiin Group (Toe) Modem Maturity (Wed) American Interests (Tku) 0|wn Mind (Fri)</p>
        <p>GMllewe</p>
        <p>3) 8DmiliBksQ(MeB-1bd)</p>
        <p>Woiderfai World Of Disney (Thn.Prt)</p>
        <p>SStkmm</p>
        <p>viMkamkM</p>
        <p>(MAX) Movie (Wed) "Mirades" (1988)</p>
        <p>IToiaylsflpedel )1bdarMlsr(Maii) Movie (Tke) The Bad News Bears Go Tb Japan (1978)</p>
        <p>8J8(m)Bewllekod 948 PBthar Knows Baal</p>
        <p>flMgng</p>
        <p>.,-Jlt!iBSSUert(T^</p>
        <p>PMovieMakem(TlHi)</p>
        <p>. (UH90aadMofy1M(MoS)</p>
        <p>Obstetrics / GynecMogy Update (Wed) Intemai Medicine Update</p>
        <p>(Mas-</p>
        <p>OaeMo(MaB-WM.Plri)CBS</p>
        <p>All-American Thanksgiving Day Parade (Tkn)</p>
        <p>d)ItevaLMy(M0B-WaG Wonderful World Of Disney (Thu. Fri)</p>
        <p>PI (Mon-WW,</p>
        <p>(I8tt) (NimCMoaGeoaie (MOW)ffirkaigWw(liM(lM)</p>
        <p>A Winter Sto^(Thu) (TMQMevie (Fri) My American Cousin (1985)</p>
        <p>(DBA) Ban Te baeean (Mas) Perfect Diet (Tue, Thu) Search For Beauty (Wed) Secret Formula (Fri)</p>
        <p>(WIBMGNNNswe 8M(MA]D Movie (Thu) "The KamteUd Part r (1988) 8cll0ABCIeweg 8(180Jlinaity8wa0Bvt</p>
        <p>SI8S</p>
        <p>ABCNa</p>
        <p>TMjJI^IWOtheok (M (Mas-</p>
        <p>(Toe) Peter Lundy And The Medicine Hat Stallion(1977)</p>
        <p>(nOW)iheAml1Ma1lme7 ~ Blind Midi's Bluff (Fri) Mwt FBbb Sboweane</p>
        <p>Q Mi^'s Thanksgiving Day Parade (Thu)</p>
        <p>O CBS AllAmeriean lhBtAnvliwDnyPnrade(Thn)</p>
        <p>ard*s Bon Voyage (Thu) Mael-strom(Fri) / ^lovuTevMdi run And Ms; KM</p>
        <p>(iMg</p>
        <p>iSpoitaUok</p>
        <p>MBKnWel</p>
        <p>Movie (Toe) Strange bTown(1955)</p>
        <p>(U^Oarto 7JliOBB4yBsetrie(MBii,WU. fMb Hdtnestretch (The. Thu) ManiiinnpaaB aDOXJee(lim-Wod)</p>
        <p>inniiiKMii nopni</p>
        <p>To Poeh Ganar Rock</p>
        <p>WeBy.Mlh (W) Goodbye Mr. Chips (1989) (NICX)Ptowhool (IMC) Movie (Tue)  night. Mother " (1988)(Thn) Alices Adventures In Wonderland (1971)</p>
        <p>^Orook And Chano 94I0BOW) Aiy FHasd Of M-iMcUabybAFrindOf</p>
        <p>(TNN) Crook Anf kdlMBOW) Aiy dholM ittddilby</p>
        <p>little House On The</p>
        <p>(Fri) "The Beast ril.888 Fathoms "(1958) )lb.WlBaifhWorid</p>
        <p>I (Thu) A Home Of Our Own (1975) (MaTheUleGmlMaeSlaiF OIAllBaM|eAleohoHe(Motd (IMG) Movie (Fri) Hotel (1987)</p>
        <p>M80OvnMaOn1boalar</p>
        <p>taBtw(Man-Wad)</p>
        <p>0Movie (Fri) "Jungle Book (1941)</p>
        <p>e OB) (Maai. Wed, Fri) Adult Bask Education (Tim) Todays Special (Thu)</p>
        <p>DaltitdanOf1kelBrtha (Ma^Wod) Wonderful World Of Diey(Thu.Fri) OCB8Nswe(Mia-WM.PH)</p>
        <p>(1988)(Wed)</p>
        <p>(1981)</p>
        <p> OaadMovDpdMndloD</p>
        <p>PhyticiaaB' Journal Update (Toe. Thu) Ohetetrics / Gynecology UpMe (Wed) lidenal Medicine Update (Fri)</p>
        <p>(MAS Mevto (Mon) Claudia AndDuvM'' (1948)rme) Bedtime Story (1941)(Wed) Uea Father TOM Me (1975)</p>
        <p> UtaePriMe</p>
        <p>fkorte Me IhsMn</p>
        <p>iS) M Fbai</p>
        <p>nOMawb (Wed) Thane Gio-ry^ory Den (188l)(Thu) Hie8mtiaiLlfe(198S) (IMA) Mel DM (Man; no k7Th8ueoeae(TW)Ooiiultle Free (Wed) Search For Beauty</p>
        <p>Tan ft bR| Aid Using</p>
        <p> __(Mon) Urban</p>
        <p>Cowboy (1980)(Tne) Pee-wees Big Adventure (1985KWed) "Short Circuit" (1988)(Fri) Uforia(1988)</p>
        <p>jM^ldfiCaueodae:The</p>
        <p>(UPBPaepbbCHrie (MAX) Marie (Mon) 98 Days (1984)(Tue) The Professionab  (1988)(Thu) Plymouth Adventure (1951)</p>
        <p>aacnOaMeIke Manee</p>
        <p>anm im (wed)  night.</p>
        <p>Mother  (1988KFri) Bad Medicine (1985)</p>
        <p>(IMG) Marie (Wed) The Money Pit (1988) ftdlfWllMBeMiUimBilliae ftMGaMbBtnBin-Wod)</p>
        <p> Mhrie (Thu) Pickwick Pa-(1M8)</p>
        <p>jgwMiowel Paopnanbi hWM) Todays Special ^Fri)</p>
        <p>(SIbMMV Prienda</p>
        <p>MoaMM Pieiini (Mai-</p>
        <p>JM)</p>
        <p>Pleedaan Print Fat Ckna OflgoflBOaMar</p>
        <p>IM (Thu) "Somethiity Wicked Thb Way comes (1988) (UPBWnkbglblkar</p>
        <p>(195D(Fri) The Race For The DaubbHaito(1988)</p>
        <p>eUusYnrSkb  ^</p>
        <p>OTapBaaftBoriwdloiO</p>
        <p>Senior PGA GoU (Dm) College BaaketbaU (Wed) NFL Film (Thu) NHL Hockey (Fri) (HBOMorie(Wed) The Cartier Afbir (1984)(Thu) The Bad News Bears Go To</p>
        <p>)Morie(Mon) The Awful Truth (19S7)(Dm) Blood Alley (1955)(Wed) One-Eyed Jacks ' (1981)(1hn) The 7th VoyaieOfSinbad(19S8)</p>
        <p>(Mwi) "Grand (1988)(Dm) Show Boat (1951)(Wed) "The Silver Chalice (1955)(Thn) Ptymoutk Adventure  (1951)(Fri) Damelot  (1987)</p>
        <p>(IMG) Merie (Fri) Detective School Dropoub(19N) lYauCkiBeASbr Merie (Mon) Love And h(1975)(Tue) Manhattan (1979)(Wed) Bananas (1971)(Thu) Caveman (1981)(Fri) "The Blademaster  (1984)</p>
        <p>18ell(WnQGBIPi(Moi)</p>
        <p>(Tue) TheDeli-(1957)(Wed) Guess Whos Coming To Dinner (1987)(Thu) Ali Baba And The Forty Thieves  (1948)(Fri) The Brass Bottle (1984) lft880PriMttunare(Wed) e O Oerd Skarin (Moi-Wed) New Adventures Of Mighty Mouseg(Fri)</p>
        <p>OD I Dream Of Jeaento (Mo</p>
        <p>(lUUt)</p>
        <p>k8t(WTBMCBlPi( (Wni) Marie (D</p>
        <p>cate DeUnquent</p>
        <p>9J8aBnael(^W0d)</p>
        <p>(I)AbtyOrinih(MBWOA</p>
        <p>(mBaKtaBomPhHrPM</p>
        <p>(Dm) American Architecture Now (Wed) (HBtyCBiTMBeMMrf (DM) Merie (Mon) "Child Of Glass (1978MTne) Nadia (1984)(Wed) Solo (1988)(Tho) The Point" (1971)(Fri) My Lit-UePony-TheMovie(1988) (BPltyBOHardB (Man) Scholastic Sports America (Tue) Ski World (Wed) Running And Racing (Thu) Winners Circte Horae Racing Maipoine (Fri)</p>
        <p>(BBO) Marie (Dm) Shattered Vows (1984)</p>
        <p>A TkarinMvftf ^</p>
        <p>i(Mon)</p>
        <p>Tradii</p>
        <p>Merie (Fri) Passions (1984)</p>
        <p>184I0 788 GMb(MoWOd. Fri) 780 Gub Thanksgiving (Thu)</p>
        <p>halririlOMrpNB</p>
        <p>Pri).</p>
        <p>OoMenlnllon (Mon-</p>
        <p>SL.</p>
        <p>Thinking (Wed) Wonderworks (Thu, Fri)</p>
        <p> O MIA88 PmaaH (Mo Wed) Hello Kittyh FMrry Tate Theater (Fri) (!)Bellehod(MaWed)</p>
        <p>0 8eb Of The Oabaiy (Ma INftPri)</p>
        <p>0BovMap0a (Ann) MevIa(Moo) Breakfast For Two (ll87XTOe) Steeping Tiger (19M)(Wed) Sptender (1985)(Thu) "The Big Trees</p>
        <p>BapM</p>
        <p>Last Of The Mohteans</p>
        <p>mm SeoM (Mm) On the line With... (Tue-Fri)</p>
        <p>WbB DiBMy Pmeerii</p>
        <p>lNPLPIIm(Iha)</p>
        <p>(Mon) White Nighb(1985)</p>
        <p>(TNIOPBidBigBObai.WodFH)</p>
        <p>Holiday Gourmet (Dm)</p>
        <p>11480 SI10I Thb (MoWOd. Fri)</p>
        <p>O babieHoiM PNmaariM</p>
        <p>(WaM Bbck MatfcTbuMM? High School Womens Volleyball ChampteaehipsfFri) 0OPrieebBI^(Ma1Nd) CBSStorybreak(Fri) d) Lave Bab (MaWad) Wonderful World Of Dbney (Thu. Fri)</p>
        <p>0WhaolOfPhfbM(MaWOd.</p>
        <p>fheBaaetGI)</p>
        <p>Love Your SUa</p>
        <p>bike WBIowe (Thu)</p>
        <p>Here's Boomer (Fri) (BPR)NPLPItai(1hB)</p>
        <p>(BBO) Maria (Dm)'The Sterile Cuckoo" (1989)</p>
        <p>)PhkaiQuot flkBm. Lob ft Bnmb</p>
        <p>(Mon) Marlowe' (1989)(Dm) Thunder Alley (1985)(lhu) Osford Blues (1984)</p>
        <p>)NmkriDeNew ll48(D0BdboiTwbe(Maai) JCBlPhCHo)</p>
        <p>1148 CD0 Mame Peelory (Wed) ll:UmOW(DN)</p>
        <p>11J80 AiMrieai Bahy (Moi) Doris Day (Die, Wed, Fri) Second Honrnoon (Thu) 00KHdVldBe(Pri)</p>
        <p>0 Wb Loae Or Draw (Mo IbftPW)</p>
        <p>PaMo Homt In Ptaw Brook</p>
        <p>RMdy to mem Mol TMo KMIy lo-caM hoow hw 2 bodraomo, 2 boilw, hoMiMfflpaiKiaireondnionino.com-pMHivaiy pricad In lha aeTo. Land-icupod and odad wHh baauWul pinaa. CMI ua today lor your prtvMo</p>
        <p>Offke 752-2814</p>
        <p>Wbnie Evom, RoaUor, GRI 752-4XX4</p>
        <p>JacfcGasriMi.BralNy</p>
        <p>! frri) aftl44M. </p>
        <p>Merie (Thu) Caseys Shadow (1978) (BBmBaHid1he8eanas(Pri) (MAB Merie (Moo) Araund The World In 88 Days (19S8)(Thu) The Three Worlds (H GnlHver (1988)(Fri) John F. Kennedy: Years Of Ligblning. Day Of Drums (1985)</p>
        <p>GIKX)MiVbToeni(MBa1ha)</p>
        <p>Adventures Of The Uttte Koala (Wed-Fri)</p>
        <p>(IMG) Merie (Wed) Pee-weeh Big Adventure (1985)(Fri) Rabbit. Run (1978) 1148BMHdhleik(W8d) (^1heRhft(Wed)</p>
        <p>Writ Dbmy PNoaab</p>
        <p>11480 BUI Oeoby (MoW8d)</p>
        <p>Laurel And Har^ (Thu)</p>
        <p>0 Merie (Fri) Gullivers Trav-eb"(1939)</p>
        <p>* -*--*a w</p>
        <p>O nmciioMi rih^n (DMi wad) SutUng ^lectacular 1987 (Thu) e018ewe</p>
        <p>d) A Onual Afbb (MaWad)</p>
        <p>WonderbI World Of Disney (Thu, Fri)</p>
        <p>0 News (MaW8d. Pri) NFL</p>
        <p>Live(Thn)</p>
        <p>O Newa (MoWad. Pri) Its Howdy Doody Dme: A 48-Year Celebration (Thu)</p>
        <p>(ARTS) GuHai Age Of Thleri-rim</p>
        <p>(BBT) &amp;lt;Mb Placm (MaWed) Black Classics (Thu) Gospel Magaiine(Fri)</p>
        <p>(BBPN) Aenhles (MaWud)</p>
        <p>Sports Festival (Thu) CBA Basketball (Fri)</p>
        <p>(BBO) Merie (Wed) One Crasy Summer  (19MXFri) Peggy Sue Got Married" (1988) pn9MelkarbDw(MaWaft M) Philade^ fhanksgiving Day Parade (Thu)</p>
        <p>(MAX) Merie (Dm) "Operatioo Pacific (1951)(Wed)  I Ought To Be b Pictures" (1988)</p>
        <p>0Bambi|nabhew(Mm)</p>
        <p>0 Yuum And The RaomaB (Mm Wed) Popeye And Son (Thu)</p>
        <p>0 0 Mevb (Fri) The Home-</p>
        <p>comiBg(1971)</p>
        <p>(SABm^Wed)</p>
        <p>0 SeiAle (Mm-Wud. Pri) NFLFootbaU(Thtt)</p>
        <p>~ YeuM And The Raallam</p>
        <p>IS</p>
        <p>Ifflfcpetuw Qkm, The;</p>
        <p>He) Journey To Adventure (Wed. Pri)</p>
        <p>(HR) Baefc Sheweme (Mae)</p>
        <p>Thb Week b Black Entertainment (Dm. Fri) Bobby Jones (Wed)</p>
        <p>)Merie(Wed)TopGun (1988)</p>
        <p>(11ll(^0saroy(Mai;Tha;</p>
        <p>(INN) Merie (Wed) DaU To San Antone (1947)</p>
        <p>iSSSlSmtyMHila!</p>
        <p>(Mm) Warmly, Leo (Thu) Basics Of Model Railroading (Fri)</p>
        <p>0CB88lMyhnek( . d) Om Div At A Time (Ma</p>
        <p>Mtefs Of Our livm Gb WhftPri)</p>
        <p>OAlHfyGhihbw (ARTS) Amarteen Dream (Mo</p>
        <p>Thu) IhNind Of The BaskerviUes</p>
        <p>(Fri)</p>
        <p>(BBT) Gi^ Magmtae (The)</p>
        <p>Video LP(^)</p>
        <p>Movie (Mon) "Sounder'</p>
        <p>(1972)(Tne) "The L^ Of Lobo (1982XWed) TIm Blue Bird" (1978)(Thu) "Show Boat  (ISSlXFri) Hi. Good Lookin  (1944)</p>
        <p>(BSPN)OellapFaothaD(Mm) Coltege Football: Coachs Corner (Dm) CFL FootbaU (Wed) )BMbdThe8eoMe(Mm) Merie (The) Peggy Sue Got Married (1988) tt</p>
        <p>ST</p>
        <p> __)  Merie  (Dm)  "Love With</p>
        <p>A Perfect Stranger  (1988)(Tlio) Sweet Uberty (1988)</p>
        <p>(UA)Cmftd reman ^SMbSbSCwhd)</p>
        <p>0Merie(Thu) A Tate of Two aties(1971)</p>
        <p>(MAX) Merie (Fri) The Great Santini(1979)</p>
        <p>(SHOW) Merie (Mon) Death Of A Salesman" (1985XFri) Stoo-gemania"(19S5)</p>
        <p>(TMC) Merie (Mon) Jumpin Jack Flash  (19S8)(Dm) Marie" (I985)(Wed) Streets Of GoM" (PbaawTuraToPageft)</p>
        <pb facs="00096780_0126" />
        <p>TV-i TlwPrty WtlHcHr. OwwwWfl.C. SwidifcNewwbwSlil^</p>
        <p>DAYTmE</p>
        <p>(CMlMFtwiPaitS)</p>
        <p>(lfM)(1lM) *11 mkimyt (ItO)</p>
        <p>(1MM) mm (Mob) Tie Big Shnr" (IMT)(fte) "BqrM He Purple HUb'^ (HMXTIm) *'Sier-nSie'(IMl)(FVi)neSiiii</p>
        <p>Hir(lMl)</p>
        <p>(OM^hiADMl MI(I19 Mwii (Mn) Tape</p>
        <p>Pear*' (imKTw) "DefmdiUl RaGer (196l)(Wed) "Ttep (My KiD Their IbHen (IfTIXTlni) ABgel In My Pocket* (lNI)(Pri) blaod Of He Btee DoMhu(19M)</p>
        <p>IJtSMtr Mb (Msb-IIU,</p>
        <p>_ ars's-</p>
        <p>(DUMbOMIM)</p>
        <p>Q BaH AM Hi BhmUM (IMII)</p>
        <p>(BBDVUmM (B8P1I) CollBiB PeotbalL* OoaelAi (Mmt (Hi) ScholMUc Sports AroerlcB (M) (HBQI Msfite (Mob) **Aiid Now For xoeti^ (Mnpleteiy Oif-fercBt (IfnxWed) Bnlbhot (IMSKHi) SeveB Mioates In Heavea(lWt)</p>
        <p>^ I* nth TM dto-</p>
        <p>((Thu) ab Paiw-dise(19M)</p>
        <p>(TMO llBVlB (Fri) 'On He - -(im)</p>
        <p>ariA)FlnrHePBraala|a</p>
        <p>O Mivll (Tha) TMiver Twist" (19)</p>
        <p>OM-lQMaetD(liWM)</p>
        <p>O MmM (Hb) Tather*! Uttle Dividend" (19Sl)(Fri) Three Guys Named Mike (ItSl)</p>
        <p>O As Hi ItaM Thna (Mm-</p>
        <p>(S^bbvs B To Bibw (M Mai) Wooderful WorM Of Disney (Thu, Fri)</p>
        <p> AiMhar arid (MoihtM. W)</p>
        <p>0 As Ha arid Hns (liaB-a^lfcCloBdmM) eOssLifiHUis (AMB MqMnbi Rack (Mas, ad, FH) Rockline From Lob-dOB (He) Footsteps (Thu)</p>
        <p>0)0) Moris (FYi) HoneynMon Lodge" (IMS)</p>
        <p>(WN) CsUsgs FootbsU: Oasdfi Oanwr Ski Worid</p>
        <p>(Has) iBitracttooal Praaraai-miai (He) Sports MMidiw</p>
        <p>CMehaaMk Ipsdsl (Iks) oUerFaotbaB(M) (S1MiAMJiRf^a GUkpfMksl^ iSSmm Mas (Maw</p>
        <p>hAdte(Ha) CsUsfs Postball: (Ha) Skiing</p>
        <p>Maria (Mon) StonniB (ISdSkWed) "He Ballerina AndW BIbos" (1M7)</p>
        <p>00^ Myatariam GWas Of</p>
        <p>Maris (Wed) "Free (imXFri) "The Bad News Bean Go To Ja^ss (1971)</p>
        <p>(INN) Ctook AM Chase (Mob, fMlhi.FH) fflBAlflsiBYsBrLBek iMmDrf(MB%iO SmBoms Aoss ^M.</p>
        <p>m</p>
        <p> Os AM Abari PriMtpsla</p>
        <p>83MilMU^(ilaB-hri (S DiiMinsMaMoe (MaB-ad)</p>
        <p>0 Saria Bmhsn (MoB-sd,</p>
        <p>W)</p>
        <p>0GaMialHsarilal</p>
        <p>(ARTR Maria (Moo) Sleeping Tiger" (19M)CHe) "Splendor (193S)(Wed) "He Big Hees" (19S2XHU) The Race For The Double Helii  (19M)(Fri) Kip-perbang"(1982)</p>
        <p>(D0 DsMMi dram (Ma-Thri Mbn^ Adveirturea Of Onie And Harriet (Fri)</p>
        <p>(ESPN) Am NsOiBg (Ha) Truck And Tractor Pun (Wed) Great American Race (Hu) (HBO) Maris (Mob) "TroU  (1986)(Wed) Airplane! (1980)(Tha) Hannah And Her Sislen (WMXPri) Eleni (19)</p>
        <p>(HBO)HeHoSbla)lhGnM-</p>
        <p>(Tue) Rage (1972)</p>
        <p>iTMaybi^</p>
        <p>1 Baatrirask Basas(Ha) ) Maria (Thu) "Chisum (1979)</p>
        <p>(TMN) Superrian At Hobm iSS Hat Potato</p>
        <p>)AtttiidaB(MoB-ed.N)</p>
        <p>Fannily(Tha)</p>
        <p>(MAX) day Absri Ha Marias: Phoy H Pastara (Hri A</p>
        <p>Blues Session: BA King And Friends (Fri)</p>
        <p>(rtirf)lMria</p>
        <p>(IMC)Moria(Mon) The Impossible Years (196l)(Tue) "Strange Lady In Town (lS)(Wed) The Barretts Of Wimpole Street (19S)(Hb) Caroelot (1967XFri) 1 Am A Camera (19)</p>
        <p>(T|imYMGaBsA8ta(Ma,</p>
        <p>sd-Frt) Holiday Gourmet (TO)</p>
        <p>~ ITleHeDaiM</p>
        <p>fmTjany AM</p>
        <p>lri)ToffiA iving Special</p>
        <p>Jerry (Hu)</p>
        <p>lA (SHOW) UndarShailsr (Mon) (Please Tom to Page 10)</p>
        <p>TV Chatter</p>
        <p>Snpetimdaeer 8Mph J. Cum A-Ham, RsciMM7 M OM of tte UgiMri psctMitafe iwcocM of Iurii0 pilob pictod op M serin. M in m era Mmo balf4oar eomedia ere king, Cennell seems to be backing a trend this season with two boorkmg series, NBTS "JJ. Sterbnck" and CBSs Wiseggjr aJthoogh neither seria is doing weU in the rattogi. Canoen says he doesnl p^ attontton to what format happea to be domi-natiog the airwaoa at any particidar time. "I new wof^ ry aboM trends. When I did The A-Team, it started a trend. If yoare dolnga showright - thats ail yon have to be ooooemed about Yon cant do them like yoare cook-ii ftein a redpe. Yon cant say, Well, if I have a good* hMdng leading man and a pretty girl and get them tat bed and ssasQB it with a pinch of violence and comedy.'It just doesn't work that way. You have to say, This is some-thiiM I care about This turns roe on aa a writer. H you foUow a trend and try to r^ off Moonlighting or Miami Vke,* by the ttane you get it on the air, the trend MU be over.</p>
        <p>y Two Dads, the NBC sitcom about a 12*yeatH)U gtai of doubtful paternity, is one of this seasons few new hits. And much of its succen is doe to Paul Reiiar'9 snappy ddivery u a strait-laced businessman Mw may at may not be the giris fathor. If Reisers timing seam so good, it may be because hes also a successful stand-up comedian. He New York City native began perfMng in comedy dubs in college; a year after graduatioo, he WM a major star at such star-breeding grounds as Catch a Rising Star and the C(Hnic Strip. Within that same yen, Reisa won a rde in toe mimh-praiaed film "Diner. Re ha subsequently anwured in such hit films a "AUens aM both Beverly RUls Cop films. But he hasnt forgot* ten his cmnedy-clnb roots. "Stand-up and TV are brih folfiUing, but stand-iq&amp;gt; is more imnmdiate fun becauM its happeniiM now and if s mwe contained. But he also lika woiting in TV. " My Two Dadf is great because you have more time to wdri[ with the material and develop it AM I love (Elaborating with pecle. Reiser wiU abo be starring in hb own HBO qiecbl aM b writing a cmeif fatare for Dbn^, tentatively set for next spring duriug hb Uatos from "My Two Dads. "Tm writing it so I can act to it be ays. Were ffOt sure whriher thats one hb jokes.</p>
        <p>On ABCs "thirtysonoetoing, the character of Hope (pbyM by MM Haris) bM to deal with an issue famUiar to many 8(b women; She gave up a simcessful publishing career to sti^ at home aM rabe her 9-montlHdd dau^ tar, whUe her husbaM (pbyM hy Ken (Mn) became the familys sob breadwiimer. To help herself better under-staM Hopes maital makeup, Harris cmnposM a biography of her (toaractar gidng aU the way back to childhood. "I see Hopes life in staga, says Harris. "As a Ud she pbyM with Barbie doUs aM chasM boys arouM the bbdL Now she Uka being a motha* aM staying at hmne.</p>
        <p>^NISSAN</p>
        <p>WILSON. N.C.</p>
        <p>1401 UpMmb Rd. (919) 237-4400</p>
        <p>The LEE 500- Is Ontt</p>
        <p>Recsivs huge discounts AND $500 REBATE on ALL vehiclesll</p>
        <p>(excluding model #22057 without ail)</p>
        <p>OVER UMILUON IN INVENTORY TO CHOOSE FROM</p>
        <p>FINANCEREPS</p>
        <p>CMDTUri</p>
        <p>Shoes for Vonno Whitoj A gongster for Poter Folk</p>
        <p>By Cindy Adaas</p>
        <p>Next for Vaau WUte is a line of shoes in her name. Then shell take inano. lessons. Then shell take actk lessons. Vanna was offer $l mil for a beer commercial. She foamed at the mouth at the idea, and said Uh-uh. Tt isnt my image, she told me. So whaf s she want to be someday - a senator? No. Just continue doing what Im doing.</p>
        <p>Peter Falk</p>
        <p>VaaaaWkite</p>
        <p>"Were very selective, says her manager Ray Mil-zella. Vanna was offered the movie Caddyshack II," pbying herself. Playiiig any departure from Vanna is difficult for now, says Manzella. She could only do a real role now with someone like WoMy Altea, whos her fan and who b creative, sensitive, and artistic. Right. And maybe Vanna could teach Mb Hr row to turn letters.</p>
        <p>Ckmiing at us b Lorimars movie Cookie, dire^d by Saaaa Sektefanaa, written by N(wa Epkras. K stars Palsr Fatt as gangster Doariulek Dbo Capbco, whtm sexy, smartrnouth daughter Co(dde Lspo hasnt seen him since she was 7 - but after hes paroled, becomes hb driver and helps wipe out hb erte-my Cannbe Taiaatboi Bciyoh-boy, will Italiam-Anmricans not love thb one.</p>
        <p>I dont know what a Rrba Row Duffy is, except that he attended private schoob in CkHinecticut and has just written the Penguin paperback The Poor Mans Guide to Marrying a Rich Girl. (You meet her at scho&amp;lt;ds that have polo teams.) Movie producers are currently courting this Duffy person, who wants Mkkaei J. F( for the lead. Maybe Mr. Duffy wont end up with a rich girl, but he wont end up a poor schnook either.</p>
        <p>ort jl cQBura</p>
        <p>Frame Itops</p>
        <p> Gallery^ST!</p>
        <p>lt*s A Special November ...With Christmas In Mind At Art A Camera Frame Shap</p>
        <p>1.1st Amual Dock Stamp Priat Giveaway</p>
        <p>imfMRtewMMHrr</p>
        <p>t AattmlOirlatmaaSah</p>
        <p>Am dbrbf tto</p>
        <p>I</p>
        <p>1 imltm</p>
        <p>S20$.Cotaiidit8t ^ridng In rcur OB Evans St 7S2-4620</p>
        <p>m</p>
        <pb facs="00096780_0127" />
        <p>Monday Evening</p>
        <p>BfONDAY EVENING</p>
        <p>e</p>
        <p>&amp;amp;</p>
        <p>d)</p>
        <p>06</p>
        <p>esm</p>
        <p>NBO</p>
        <p>UFE</p>
        <p>MM</p>
        <p>SHOW</p>
        <p>m</p>
        <p>7:00  7:30</p>
        <p>Remington Steele</p>
        <p>BuswssRpt. N.C. People</p>
        <p>CBS News</p>
        <p>FemilyTiee</p>
        <p>Jelfersons</p>
        <p>Good Times</p>
        <p>Movie</p>
        <p>SportsCenier</p>
        <p>EveiAig</p>
        <p>M*A*S*H</p>
        <p>Benson</p>
        <p>LoeeOrDrsM</p>
        <p>Jeopardy!</p>
        <p>Touch</p>
        <p>NFL Monday</p>
        <p>Lyte,Lyie FraggleRock</p>
        <p>Family</p>
        <p>TheGoonies"</p>
        <p>8:00  8:30</p>
        <p>Fattier Murphy</p>
        <p>First Eden</p>
        <p>Franks Place Kaie&amp;amp;Allie</p>
        <p>Redskk</p>
        <p>ALF</p>
        <p>Franks Place KateAAMe</p>
        <p>Current AtWr</p>
        <p>VaTs Family</p>
        <p>MacGyver</p>
        <p>I^Fltcka Boomer</p>
        <p>Matchup NFLMooday</p>
        <p>9:00 I 9:30</p>
        <p>700 Club</p>
        <p>Adams Chronicles</p>
        <p>Newhart D. Women</p>
        <p>National Geogr^ic</p>
        <p>10:00</p>
        <p>straight Talk</p>
        <p>Trying runes Stress</p>
        <p>10:30</p>
        <p>Find Cry</p>
        <p>Cagney&amp;amp;Laoey</p>
        <p>News</p>
        <p>Movie: Lena: My too Children</p>
        <p>Newhart 0. Women I Cagney&amp;amp;Laoey</p>
        <p>NFL Foolbal: Los Angeles Rems at Waalwigton Redskins</p>
        <p>Movie; Tha Pleasure Of His Company</p>
        <p>Aulo Radng: NASCAR Atlanla Journal 500</p>
        <p>Movie; White MgMs"</p>
        <p>LadyBkie</p>
        <p>Movie</p>
        <p>Movie; "The Star Maker</p>
        <p>Movie; 11 KareleNd Part r</p>
        <p>Movie; Mona Uea</p>
        <p>Movie: SomelhlngWlcliedTWs Way Comas"</p>
        <p>HhkM</p>
        <p>AndyGriMh Swiord</p>
        <p>Riptida</p>
        <p>Movie:'The Patriot</p>
        <p>Movie:The MensChib</p>
        <p>Movie: The Great ARgalor</p>
        <p>MovlftFM</p>
        <p>MtaChnUteAPogi 0 MhNiI / Lilir Nmh</p>
        <p>O0eNm</p>
        <p>(SIMO</p>
        <p>Omm</p>
        <p>TCmBbAII</p>
        <p>AMI</p>
        <p>(ARniAMrtelTraBD mitoflt</p>
        <p>Hw Little</p>
        <p>Darby OtSill And (1W)</p>
        <p>iNerthCanUMpMple</p>
        <p>Ms.</p>
        <p>(SM*Am</p>
        <p>(BPN) m MM</p>
        <p>A preview of toirisMs game between the Los Angeles Rams and Wasbtaigtfla Redskins.</p>
        <p> White Nights</p>
        <p>OttX) IM The Goonies  (!)</p>
        <p>OOCPliMnlMpMt mW) Mmte^riie Hoose Of The Seven Hawks (1159) IGMkAiMClm</p>
        <p>JKSfNGkatPbrOoafort NBCNmg O CBS News OABCNnng</p>
        <p>(NKK) NICK RockK VldM&amp;gt; To</p>
        <p>(INFOVMwcetiy MI(W^ New Lam It To</p>
        <p>mmnrni^muu (SifmOjnm</p>
        <p>or</p>
        <p>gOOiillMi</p>
        <p>nmoifMog</p>
        <p>"^NoddMinenLoMdoa MrPMIon</p>
        <p>I^Cboeottotlbo</p>
        <p>OmM^OrOnv SSSi^nfeaB</p>
        <p>)OohigPlneaa IGoltaToKb</p>
        <p>NPL MM Nlibt</p>
        <p>iRoek )IArllMnWarid )HMOM TJlfNnntaMAadta 7:mMMhn</p>
        <p>IMeMhvMM</p>
        <p>OnmUMM efforts to reclaim the Meditcrraaeaas environment from poUntkms ravages. (Part 4 of 4) g(l hr.)</p>
        <p> O fMk% Plieo Despite hurricane warnings, the diez remains open while the gang awaits news from the Rev. Deal. (SReMkhtPlaybook 0 ALF ALF and the Tanner kids give Willie and Kate a second honeymoon, testereo, g 0 MieQyvw MacGyver becomes a one-man bomb squad when he returns to his alma mater to Jadfe a highly competitive physics contest. In stereo.</p>
        <p>g(Ibr)</p>
        <p>(ARn) Mmlo The GetUng Of 1odom"(im)(2hri,Nmin.)</p>
        <p>DolbitOn</p>
        <p>(TMC) Movie Something Wicked This Way Comes (1983)</p>
        <p>PMPnckaWhena captnred sUIKon attacks its captor, FUcka is htemed (or the</p>
        <p>Leonora Harris. A fact-based account &amp;lt;4 Lena Kochkr-Silber-mans efforts to hdp scores oi Jewish onAans escape portwar Poland and find a new life in Israel. In stereo, g (2 hrs.)</p>
        <p>0 NFL FMbaD Los Angeles Rams at Washington Redskins (Uve)g(8hrs.)</p>
        <p>(BET) Video Sow (DM) Movie The Pleasure Of His Company" (IMl) (2 hrs.) (ESPN) AMO Radi NASCAR Atlanta Journal 500. from Georgia. (R) (2 hre.)</p>
        <p>(UF^ Movie The Star Maker </p>
        <p>(1981)(2hrs.)</p>
        <p>(NlCK)My1lne8QH</p>
        <p>(IMC) Movie Marlowe (1949)</p>
        <p>PG(2hrs.)</p>
        <p>(USA) Movie The Great AlUga-</p>
        <p>tor(19ll)(2hrs.) 9&amp;gt;J90ODeei|idi</p>
        <p>iWe</p>
        <p>lAf-</p>
        <p>(19S5)PG-ir(2his.,15min.)</p>
        <p>(UPDLa^jlwo</p>
        <p>(MAX) Movie Tbe Karate Kid Partn(19N)PG(lhrs.) (WggCirHWIwwAwYen? (Om Movie Mona Lisa (1911) R(2 hrs.) (TNN)NaMvllleNow</p>
        <p>mt^SSLritt Fame (I960) (3 Ins.)</p>
        <p>JIO O Kate A AUe When Kate and Allie fall into a pattern of constant bickerinf, theyre encomaged to seek help from a marriage comselor. g (SACvTNlAfbdr 0 Valeries FM The Hogan children have bad dreams after viewing a slasher-type film. In stereo.g</p>
        <p>(D0 8^ Boomer A horse trainer who thinks he lost his Job because of a staUeboy arranges a horse race that the boy cant win. (Parti of 2)</p>
        <p>NFL MM Mght</p>
        <p>IDqrWar</p>
        <p>)MMarU tM07ilCMb</p>
        <p>0 Adame Ghraildm Adams single presidential term is marked by fruttration and controversy. His appointment of Henry Clay as secretary of state provokes rumors of a pWitkal deal.(Part9ofl3)(R)g(lhr.) 0 O Newhart DhA becomes a one-man Mow on a 48-hour telethon to raise money (or tbe financially ailing TV sUtion where he works, g (DNatlooal Geographic 0 Movie Lena: MylOO Chil-(Praniere) Linda Lavin,</p>
        <p>(BR) Soft Notes (U8)MMA ate And Harriot</p>
        <p>(BPN)Tmok0M</p>
        <p>SoSmiiisXb</p>
        <p>(!MC) Movie Top Gun (1918) PG(2hrs.)</p>
        <p>(INN) BdHdoy Gommat Host countiy and piw sii^ Sylvia is Joined by guests Rkky Skaggs and Sharon White to prepare a traditional Thanksgiving meal, testereo.</p>
        <p>1100 DiM Bhtei A nostalgic look at the drive-in movie</p>
        <p>ter meeting a handsome Army officer. Charlene has a dream in which she and the women of Sugarbakers are World War H USO performers, g raCK) Doma Read (INN) Now Oeuwtry Featured; Jai^ Ward. In stereo.</p>
        <p>IMtOStraMITnk 0 Tkyiiflteaee Candice Bergen stars in this Bernard Slade story about a divorcee co|dng with the hazards W moving day. Bruno (ternssi and Keanu Reeves co-star, g O O CB0Ny A Leen Cagney and Lacey suspect that their colleagues in the Major Case Division are on the take, g (1 hr.) (SNewi</p>
        <p>(MAX) Movie The Patriot</p>
        <p>(1988)R(lhr..30mia)</p>
        <p>(I^UMbb</p>
        <p>The Mens Club (1918) R(1 hr^ 45 min.) (nmOuekA^Ckme</p>
        <p>18tl8(HB0) Mevte Urban Cbw-boy(19SB)PG(2hrs.,20min.)</p>
        <p>(ARTB)AABPNvlewAIookat</p>
        <p>(1MN)VHoocM</p>
        <p>1100RanMB Steele 0 DeeteTWhe Tbe Armageddon Fretor The Doctor begins a perilous mtesion to save all humankind from destruction. (Parti of 8)</p>
        <p>00ONewe (SACtenM Affair (ARTDVloteoiKTheTmThon-aa0Di!</p>
        <p>M*A*8^</p>
        <p>Late Stow From Oct 1987. Actor Elliott Gould, Sbalamar and Cande Shaw (editre of Big Beautiful Women nugazine) with host Arsenio Hall. In stereo. (R)(l hr.)</p>
        <p>0 Beet Of Garsaa From Octo-bre 1986. Comics Uly Tomlin and Roy Combs with host John-m Carson. In stereo. (R)(l hr.) O Hunter A full-scale gang war threatens to erupt as Hunter and McCall investigate the murder of a prominent mobster. (R) (1 hr.,10min.)</p>
        <p>(ARTS) BetwMDTto Wan Tbe</p>
        <p>bombing of Pearl Harbor propels the United States into war. HostEhicSevareid.</p>
        <p>(DM) Movie Quarterback Princess (1983) (2 hrs.) (BPN)8porlMer</p>
        <p>hBMWtCmnedian &amp;amp;icBogosian takes a humorous look at Americans drinking habits. In stereo.</p>
        <p>180(WnS) NatteMd GeopM</p>
        <p>EMw The wild mustai^ of the Wesu ice boating in New Yorks Hndstm Valley, the survival of tbe saltwater crocodile in Australia; monks who embody tbe Lord of the Dance at a fesval in Nepal; the puppeteers oi Palermo, Sicily. (2 hrs.)</p>
        <p>ISJBOBsstOfGnmeho</p>
        <p>(SKoJak</p>
        <p>~ Late Night With DnM</p>
        <p>iInstereo.(R)(lhr.)</p>
        <p>10 (SHOW) Movie</p>
        <p>AdvwteneOfOa-</p>
        <p>For the Finest in Sklwear</p>
        <p> CB Sport</p>
        <p> Obermeyer</p>
        <p>Pedigree</p>
        <p> Skyr</p>
        <p> Sun Ice</p>
        <p> Technica</p>
        <p> White Stag</p>
        <p>CORDON'S GOLF &amp;amp; SKI</p>
        <p>Greenville Bivd  756-1003</p>
        <p>Next to Greervillt* TV and App'ijnco</p>
        <p>110 (SHOW) Movie The Emerald Forest (1985) R(2 hrs.) 1200Bn Aid Allan 0 Hater A corrupt wnall-town sherifrs attempt to pm an assault charge on a harmless pickpocket leads to nrarder. (R) (1 hr.. 10 min.)</p>
        <p>0Newe</p>
        <p>(ARTg) Movie The Getting Of Wisdom (1977) (2 hrs., 30 min.) (BR)GotagPteeee (BSPN) NFLa Greatest Mantente Football Symfunny.</p>
        <p>G^^htevteT^arrior Queen" (1987) R(l hr.. 25 min.)</p>
        <p>(USA) Dragnet</p>
        <p>i*N) ' Nfl!?Oreatest</p>
        <p>lante Profiles of former NFL greats Bart Starr and Frank Gifford.</p>
        <p>(NKDOte M, Where An Yon?</p>
        <p>(1984)R(lhr..30min.)</p>
        <p>1200 Partean b Ottea A private detective bequeaths that his two ez-wives inherit his business and his mansk. Loni Anderson and Lynda Carter star in this pilot for the 1984 NBC series. (R)(l hr., 20 min.) L00Jad(BM (BR)FtewvorYonag (UPN) NFLe Greatnt Super Seventies. (1</p>
        <p>hr.)</p>
        <p>tavMtiQMt Advtaofj MklarU</p>
        <p>Jumpin' Jack Flash (1086) R(2 hrs.)</p>
        <p>(TNN) New Oonby Featwed: Jacky Ward, testereo. (U^SsBfdiFlorTBnNRnw LlOO Movie Fast-Walking"</p>
        <p>(1981) James Woods, Tim Mcb-tire.(lkr..20min.)</p>
        <p>(Please Tam To Page 14)</p>
        <p>The THREE STEERS RESTAURANT</p>
        <p> Saving Bieakfut, LukA ft Dinner</p>
        <p> DMlySpedah</p>
        <p> AllABCPeiM</p>
        <p>Now In Our New Location 2826S.NciBorialDr.*756&amp;gt;3414</p>
        <p>k</p>
        <p>SEARS</p>
        <p>penMites</p>
        <p>ay Merry Christmas VtliASinle!</p>
        <p>un WM1M IfFB MHftAlU 10 (0BfMAS KUV0YI</p>
        <p>pMCfNiit |NNll9p9 l-lalge, l-S&amp;gt;7s, ISunBileplne 2 gevtenit ihnvt veenoniceotswsnrtsiisi,</p>
        <p>iwrwii iprlei. er leW tedwmwa</p>
        <p>ftn0DAY.</p>
        <p>ISTK</p>
        <p>homt nol intludW</p>
        <p>No appolnMwnt Mosssary. Um your Ssw* CraOlt CuO or Dttcovor CarUi Adult*  twnllim wticoiM. Eadi SflUoiMl poroon S2.00 In addition to the (wckm* prtc*. Po*M our aMoeUon. WNta, etack and ChrtatmM Bwfcgroonds. OouW* Faalitra and othar Special Elfact* Porlralta not waUaM* n advaitlaad packaga. Um aMHaHe: Inalani Catar Vaaaparl Phot** aad Cam  hMtarallaia'approximata aiie Stwtto howa: Sun. Slot* Mun (!'&amp;gt;*'* itera It eeao): Mon a tua. SNHt opaMiig until a pm. WM Sit. 9tw* oiNning unM OM hour finw la (tow ckuing.</p>
        <p>I</p>
        <p>wntwntte</p>
        <p>:  9  i  i'  M  t  1</p>
        <p>SEARS</p>
        <pb facs="00096780_0128" />
        <p>TV4 The Dally Relleelor,Qieenvllle,N.C. Swiday.NeiieiHher 22,117</p>
        <p>Tuesday Evening</p>
        <p>TUESDAY EVENING</p>
        <p>m 1 7:30</p>
        <p>8:(M)</p>
        <p>8:30</p>
        <p>9:00 1 9:30</p>
        <p>10:00</p>
        <p>10:30</p>
        <p>e</p>
        <p>HlniiiJIOn %hB6I6</p>
        <p>Crossbow</p>
        <p>Butterlly</p>
        <p>TOO Chib</p>
        <p>Straight T1</p>
        <p>Chefs</p>
        <p>o</p>
        <p>Business Rpt.</p>
        <p>Almanac</p>
        <p>Nova</p>
        <p>Ring Of Truth</p>
        <p>01</p>
        <p>o</p>
        <p>CBSNem</p>
        <p>cvHrang</p>
        <p>C. Brown</p>
        <p>C. Brown</p>
        <p>Movia; "The Gambler 6: The Legend Continues"</p>
        <p>(9</p>
        <p>FiniyTias</p>
        <p>MA'S'H</p>
        <p>Movie; "Death Wish"</p>
        <p>News</p>
        <p>m</p>
        <p>JeOarsons</p>
        <p>Benson</p>
        <p>Movia; "The Karate Kid"</p>
        <p>MneStory</p>
        <p>o</p>
        <p>GoodTimaa</p>
        <p>Lose Or Draw</p>
        <p>C.Brovm</p>
        <p>C. Brown</p>
        <p>Movb "ThoGambler M; The Legend Conlkiues"</p>
        <p>0</p>
        <p> vTnOEl</p>
        <p>---u. j</p>
        <p>JBopvoyr</p>
        <p>Who'aBoas?</p>
        <p>Grow. Pains</p>
        <p>20lh Anniveisary Of RoNng Stone Magazina</p>
        <p>06</p>
        <p>Movie</p>
        <p>Mouselerple.</p>
        <p>Pabnarstown.U.SA</p>
        <p>AAjmA*. 'OawI UrewS** 1 ^ -</p>
        <p>MOVNk nOXIB nin | riHVIHw</p>
        <p>ESI</p>
        <p>SportsCabw</p>
        <p>MagicYri</p>
        <p>BHiards: Team Championships</p>
        <p>SpkttOfAdvanhire</p>
        <p>NBO</p>
        <p>Movia: "Paiaions"</p>
        <p>Movia: ChokeCanyon" IstATan</p>
        <p>Peggy Sue Got Married"</p>
        <p>LR</p>
        <p>Faniy</p>
        <p>Lady Blue</p>
        <p>Movia; "The Star Makar"</p>
        <p>m</p>
        <p>Tha Staking Moon"</p>
        <p>Movie; Tlw Morning Alter</p>
        <p>Movb "A Breed Apwt</p>
        <p>SHOW</p>
        <p>Aretha</p>
        <p>Movie: Love With A Perfect Stranger</p>
        <p>Jumpin'JadiFlaab</p>
        <p>me</p>
        <p>Movie; "TurtaOby</p>
        <p>RBUV^K M00</p>
        <p>USA</p>
        <p>UndaSamMagoo</p>
        <p>rapuQB</p>
        <p>Boxing</p>
        <p>wns</p>
        <p>AndyGriffilh</p>
        <p>Santard</p>
        <p>NBA Basketbal; Detroit Pistons at Houston fkxfcels</p>
        <p>Movie</p>
        <p>MieOinLllnAFn</p>
        <p>OMiNtf/LeimNmnhoir</p>
        <p>O0OeNm</p>
        <p>(Xmnt^CaaBaaj (ARIS) Afflcrkn Draam</p>
        <p>(DB) Mafia GuUiver's Travels'(1&amp;gt;77) qaPN)qportaLoak</p>
        <p>0WhaalOfPoftiaa</p>
        <p>(ARIMMoMreaiRo</p>
        <p>(BEDPMinMrValloH</p>
        <p>^portaOtMar</p>
        <p>as'itr-</p>
        <p>(MAX) Mnia The Sulking Moon"(19U) (NKX)rMmIaairs (TNN)OookABdaaae (U8)Girta MI(im)Alioa '</p>
        <p>1:11(1180) Movla Passions (1984)</p>
        <p>UKDTMOawParGointet NBCNawag OCBSNaws eABCNmg (UnOhThaLtaeWUk.. P^MBATMqr gW flKX Roekt: VHao To</p>
        <p>(SHOW) Mf Pint Smdlah</p>
        <p>A1</p>
        <p>TrWORantaigUiBSIada</p>
        <p>rBBriaaaaRaiNft</p>
        <p>Do That Oh</p>
        <p>(SilOW)Antta</p>
        <p>(TIM? Movie Turtle Diary (1M)</p>
        <p>(TNN)Yi(huiBaA8ti</p>
        <p>liSgmMjoSm</p>
        <p>TJimChrilifarlilGiny</p>
        <p>(IR) Thia Weak b Black Eh-</p>
        <p>(TWW)VMaocoimlry</p>
        <p>Cud Barnett</p>
        <p>tMaiicTainh Shafts MCK)lnaKAWa^</p>
        <p>7n%lSSNAadSoh</p>
        <p>MIO Ckantoh Gessla and Tell are imprisoned by Gaston, who wants them to fight to the death for the enjoymoh (rf Ms</p>
        <p>(DPhnilyTloa</p>
        <p>OieffnoM</p>
        <p>OOoodTtaaa</p>
        <p>O ova Asurvey d Wyomings wildlife, focusing on the breeding. migration and survival patterns of the RoiAy MounUin elk.(R)g(lhr.)</p>
        <p>o o Charlie Brown</p>
        <p>naakiglviif This Emmy Award-winning animated sp^ cial features the Peanuts" characters sharing an unusual Thanksgiving meal around a Ping-Pong Uble.(R)g (S Movie "Death Wish (1974)</p>
        <p>PhtaMrsloha.UB^</p>
        <p>N) Bffliardi Team Championships. mixed doubles, from AtlanUc City. NJ. (Taped) (2 hrs.)</p>
        <p>(HBO) Movie *Choke Canyon (I9M)P(r(lhr,,30min.)</p>
        <p>I LIFE) Lady Bine IMAJQ Movie The Morning After" (191)R(2 hrs.)</p>
        <p>Gar M. Where Alt Ym?</p>
        <p>) Movie Love With A</p>
        <p>_________j  NBA  Baairrthall De-</p>
        <p>troit PistMs at Houston Rock^ (Live) (2 hrs.. IS mb.)</p>
        <p>MIO BnttanQy Uihd Greg and Jackie discover t)ie dog that bit Paddy aeons to be very sick.</p>
        <p>YES OR NO?</p>
        <p>People are different. So are (lb Jobe we re asked to fill. That's why the Manpower System Is so Important. Its a breakthrough In personnel science that takes the guesswork out of matching the right temporary to each assignment. The System is an important reason to call Manpower for temporaries cut out fOryourofflce.</p>
        <p>MANPOWER</p>
        <p>TiMPOV stBvices</p>
        <p>IIIRsndnttmgi Bramivliif; N.C.,,. *  7874100    '</p>
        <p>9mm</p>
        <p>Over 75% Of Our Listings Sell!!</p>
        <p>JLE WHITE</p>
        <p>OUTSTANDING AGENT FOR OaOBER</p>
        <p>aARK-BRANCH,BEALTORS</p>
        <p>200 Arkngton Boulevard. Graenvdlf, N.C.</p>
        <p>^  (919)  358:1000:</p>
        <p>0 O Bh Yuv PM GhvBnBnim Aainatod. Qhu&amp;gt; lie Brown is chbcsn to acort the homecoming queen to the celebration dance, where he must give her a traditional kiss. (R)</p>
        <p>Charla Bronson.</p>
        <p>After three hoodlunu his wife and leave his daughter in a sUte of speechless shock, an enraged New Yorker sets out on a one-man vengeance campaign. (2 hrs.)</p>
        <p>0 Movb The Karate Kid (114) Ralph Macchio, Noriyuki Pat MoriU. After several violent clashes with his California schoolmates, a reluctantly transfrianted New Jersey teoi-agec seeks help from his apartment buildings maintenance man, a karate master. In stereo. (R)g(2hrs.)</p>
        <p>0 WhsfliThe Bom? Tony helps a former Brooklyn neighbor run her family fish market, ta stereo. (</p>
        <p>9j|(HBO)UtAT1:GoMPIor Bnke Billy Cooper steab the gMriend of a nerdy computer whiz; Dr. Death gives a rival team lessons on dirty football; Jakes Place becomes Jethros. Instereo.g . (NKX)DaMnitoed (TUN) Sientan At Hoow Lorianne Crook tours the homes of Hank Williams Jr., Amy Grant and husband, Gary Chapman, b stereo, (lb.) lM80Stni|MTUk O 00 Profiles of wildcatters H.L. Hunt, John Paul Getty and T. Boone Pickens. (1 hr.) (SNtwi</p>
        <p>0 OriBM Stovy Torello and Luca separately search fw WMsbords missing granddaugh-ter.h stereo. g(l hr.)</p>
        <p>(ESPN) Snlrlt Of _______</p>
        <p>Struggle To Survive - Chinas Giant Panda. (Taped) (1 hr.) (HB(? Moob Peny Sue Got Married (191) PG-IJ (l hr.. 45 min.)</p>
        <p>(MAX) Movie A Breed Apart</p>
        <p>(114)R(lhr.,35min.)</p>
        <p>(NiCK)Lai|ib</p>
        <p>BHOW) Mnb Junqiin Jack</p>
        <p>Flash (191)R(2 hn.)</p>
        <p>GrowM Phil Mike heads for New York City to audition for the lead rple in a Broadway revival, g</p>
        <p>(ARTS) ^ Of PIHob Up. Up And Away An examination of the30s fashions of Elsa ScM-(Part4of8)</p>
        <p>lt:tt(DB)DrV</p>
        <p>lM8(WnS) MbM Across The Pacific (1942) (Ihn.)</p>
        <p>IMIO Odma CMl Guests:  CabClHoway, Arlene Francis. (ART^NoslOowaiWlMsAM Tke Cmi Tom Courtenay portrays a homosexual cabaret artist who rdlects on his p^ loves as he lays dying in a Swiss sanatorium. Nkhola McAuliffe, Philip Voss and Robert Glenister also Mar. (1 hr.) (DO)DbMyChaaNlPMvlew (NKQMnkasi</p>
        <p>MOOTICtab</p>
        <p>O RM Of TMh This look at the universe and its origins examines the work of astronomers Cecilia Payne and Vera Rubin. (PartlofO)g(lhr.)</p>
        <p>0O Movb The Gambler ID: The Legend Continues (Premiere) (Part 2 d 2) Keimy Rogers, Bruce Boxleitner. After surviving a massive cattle stampede, Brady and Billy convince an un-trusting Sitting Bull to speak at Sen. Coltons land bill hearings. g(2hrs0</p>
        <p>0 Mtk AnMvecaaiy Of RoUM</p>
        <p>StOM Mngtilno Concert highlights rock greats Jimi Hendrix and Otis Redding are combined with new footage d Tina Turner, Sting. Aretha Franklin and others in this look at the past two decades m rock music. Host: Dennis Hopper, g (2 hrs.)</p>
        <p>(ARTY) Noel Oomitri Star (biMfy Susannah York, Ian Richardson and Peter Chelsom star to Noel Cowards short story about a first-time pbywright</p>
        <p>is only the start^^trou^ (1 hr., 30 min.)</p>
        <p>(BET)VMeo8oM</p>
        <p>(DIY) Movb Roxie Hart (112)</p>
        <p>(1 hr.. 15 min.)</p>
        <p>(UFE) Movb The Star Maker (1981) (2 hrs.) (NKK)lfyTbm8oi (TIK) Movb Marie  (115) PG-13(2hrs.)</p>
        <p>.  . "night. Mother</p>
        <p>(191)PG-13'(2hrs.) (TNN)YMGaaBaA8tar (UBA)Airwotf 11J90 Good NeHbbon Margos wind-break may mean the downfall of the Goods' fruit</p>
        <p>^A*S*H</p>
        <p>d) Lie Show Host: Arsenio Hall. Scheduled: Phyllis Diller. recording artist Grover Washington Jr.. comic Jeff Marder. In stereo. (1 hr.)</p>
        <p>0 TMM SMv Host: Johnny Carson. Scheduled: comic actor Harvey Komnan. b stereo. (1 hr.)</p>
        <p>O Ni|M Hal OBrien and Giambone investigate an illegal infant-adoption scam. (R) (Lhpr, 10 mm.)</p>
        <p>I OohSi Age Of TMevi-</p>
        <p>m An acting troupe brings a bank robbery, a shootout and a nturder trial to a small town b Show Wagon.</p>
        <p>(US) Movb The Barretts Of Wimnote Street (191)(2 hrs.)</p>
        <p>Wild(191)R(lhr..Unain.) 1MS(HB0) M Nmmm^ Tha Nowk *  -</p>
        <p>Spedficany  the Oscars, the Emmys. Broadway, rock videos, Hollywood and cable TV. b stereo. (I hr.)</p>
        <p>IMtOBmAadAlba 0 Dbmoadi Mike and Chris-nas search for the miiiriM body of a friends husband leads them to a corrupt funeral-parlor qwBef.(lhr.,10mta.)</p>
        <p>idebgPbei . N) Aalralba Riby New South Wales vs. Queensland from Long Beach, Calif. (Taped) (Ihr.)</p>
        <p>(UPB^FtaaMagoRoad mi) Rich bnahiW The comedian is joined by guests Mar-</p>
        <p>Dr. Dennis O^eal, Optometrist</p>
        <p>I Now AaaoeiatiNl With</p>
        <p>Greenville Eye riini^.</p>
        <p>#1 Doctors Park</p>
        <p>With Dr. Bill Monroe And Dr, Carl WUIe Honrs By Appointawni * * Open 8:30 A.M..S.-00 FJI.     7584600  Or  7S84166  _</p>
        <p>tha Qubn (former MTV VJ) and David Lander (Lveme and Shirley) for a sobs of vignettes on Anseriean Bfe. b st-eo.</p>
        <p>O Docbr Tfho The Armageddon Factor The Doctor and his companions are trapped on Zeos, whidi  has been programmed to self-destrud. (Part 2of8)</p>
        <p>00O0Ntws</p>
        <p>d)ACBR1AIIUr )8oftNoba</p>
        <p>MWi Adventares Of Osin And Haifbt After Rick loans Wally numey from the fraternity treasury, he worries that loan will remab unpaid when his treasury report is due.</p>
        <p>lIMkAadHctorPil )Oovwlb</p>
        <p>12M(Wm MM* Midnight Lace (191) (2 hrs.) 12i90Bi1OfGnwib (SMnk</p>
        <p>0 Lab Nght With DavM Letbmna Scheduled: comic Jay Leno, actor Dennis Weaver, the Giziard Lady, b stereo. (1 hr.)</p>
        <p>0LaverM8hMav (ARTS) Stacy Of PMtan Up. Up And Away An examination of the SOs fashions of Eba Schi-uarelli.(Part4of6)</p>
        <p>(BEI) Ato Weak hBbckEb</p>
        <p>)Car8.WhmAnYNT I) Movb Creator (1985) *R(Ihr., 55 mb.) (USA)Bd|aOfNigM 12:0 Movb The Skys No limit (191) Sharon Gless, Dee Wallace. (Ihr.. 20 mb) 12:4l(liB(^ Movb Last Resort  (191)R(lhr..1mb.) l0JhekBmr</p>
        <p>(ARTS) Nod Cowards Star</p>
        <p>QnUly Susannah York, bn Richardson and Peter Chelsom star in Nod Cowards short story about a fint-time pbywright who learns that penning the play u ody the start of hb trouhbs. (Ihr, 30 mb.)</p>
        <p>(BEl)BvryboSylMoMy Mat-ten</p>
        <p>)SUTtarid )bveatme1 Advisory ilMarBd (TMC) Movb Mona Lisa (191)R(2 hrs.)</p>
        <p>(TNN) Now CoMry Featured: John Hartford, bstereo. (USA)SaaidiFvTtaiiomw 1:100 Movb Missing Pieces (191) Eliabeth Montgomery, Ron Karabatsos. (1 hr., 20 mb.) IJOOLamlAadlhidly (SThoSabt 0Newa</p>
        <p>(WS) ZoiTO Zorro investigates a murder when revenge appears to be the motive.</p>
        <p>(MAX) Movb Yo^Ladv Chatterley  (1977) R (1 hr., 45 nUn.)</p>
        <p>(NIOQ Doan Raed</p>
        <p>(TNN) Movb Beyond The Pw-</p>
        <p>pbHilb(191)(thr..Mmb.)</p>
        <p>1988</p>
        <p>Date Books &amp;amp; Appointment Calendars</p>
        <p>FsdwI.aiMiSiiM</p>
        <p>wffliiT, MonmY 4 0MtT UCMm</p>
        <p>Shop Now For BeM SHtoctkMi</p>
        <p>Open Mon.-Fri. 9:30-6 PM Saturdays 9:30^5 PM</p>
        <p>INC.</p>
        <p>(Ratloners .,</p>
        <p>IMkOPwilMiaipMllollWFtai</p>
        <p>Tsen .*</p>
        <p>*  *</p>
        <pb facs="00096780_0129" />
        <p>Wednesday Evening</p>
        <p>The Dally Raflactor, Graanvllla, N.C.</p>
        <p>Sunday. Novamber 22.1M7 TV-9</p>
        <p>WEDNESDAY EVENING</p>
        <p>7.*00  7:30</p>
        <p>RgmlngtonStoele</p>
        <p>BudnassRpt.</p>
        <p>CBSNaws</p>
        <p>FMyTiN</p>
        <p>JtMnons</p>
        <p>GoodTimes</p>
        <p>Tony Brown</p>
        <p>Evoning</p>
        <p>Benson</p>
        <p>Lose Or Draw</p>
        <p>Jeopardy!</p>
        <p>"RammOfAmelpe"</p>
        <p>BpotMCenler Scholastic</p>
        <p>Sword 01 Gideon'</p>
        <p>Family</p>
        <p>"Oxford Bkm"</p>
        <p>"nIgM, Mother"</p>
        <p>8:00</p>
        <p>Honeymoon LastFrontier</p>
        <p>8:30  9:00  9:30  10:00  10:30</p>
        <p>Norman Rockwett</p>
        <p>Oldest Rookie</p>
        <p>700 Club</p>
        <p>Straight Talk Snapshots</p>
        <p>American Masters</p>
        <p>Movie; Gandhi"</p>
        <p>Movie; The Breakfast Ckib"</p>
        <p>Highway To Heaven</p>
        <p>Oldest Rookie</p>
        <p>P.Strangers HeadClass</p>
        <p>Edison Twins Danger Bay</p>
        <p>Kmate</p>
        <p>Year In The Life</p>
        <p>News</p>
        <p>Jay Leno's Comedy Hour</p>
        <p>Movie; Gandhi"</p>
        <p>Hooperman SlapMaxweH Dynasty</p>
        <p>Movie; "Ailhur's Hakowed Ground"</p>
        <p>Animals</p>
        <p>Boxing; Larry Alexander vs. Orkn Norris</p>
        <p>Movie; "One Craxy Summer</p>
        <p>LadyBkie</p>
        <p>Movie: Sftort Circuit"</p>
        <p>Movie: Alice's Restaurant"</p>
        <p>Movie: Wanted Dead Or Ave''</p>
        <p>Brothers G.Shandling Movie: "Top Gun</p>
        <p>Movie; An American In Paris''</p>
        <p>AinvoN</p>
        <p>AndyGriffith Sanlord</p>
        <p>Riptide</p>
        <p>Movie; "Codename"</p>
        <p>Movie; The Money Pit"</p>
        <p>Movie</p>
        <p>Movie; A Midsummer Ni^'s Sex Comedy"</p>
        <p>NBA Basketball; Atlanta Hawks at Boston Celtics</p>
        <p>Car Wash"</p>
        <p>.OGhivLilnAfya</p>
        <p>OllMlMi/LdnrNewriiOQr</p>
        <p>OOOONmi</p>
        <p>(ART^AmeriramPrem (US) Movie Return Of The An-(19M)</p>
        <p>IflDortdAwk )lGF01MeB OiAX) Movie Oiford Blues (1M4)  "</p>
        <p>(NK&amp;amp;lWenKe^en (amf) Movie night, Mother" (19N)</p>
        <p>mOBleoee (i^Allee A'M 3) floe Ckee Fdr Comfort NBCllewig OGUNen OABCIfowig</p>
        <p>Rocks: Video To</p>
        <p>IManhulinitlIiiiilii</p>
        <p>os Report</p>
        <p>mmrnm</p>
        <p>ewieo</p>
        <p>0WhoolOfPortNg</p>
        <p>)MM3anlw</p>
        <p>DolhotOn</p>
        <p>aris'dBSI)</p>
        <p>"An Americu In</p>
        <p>gNN)YoiCnBeA8lm</p>
        <p>(U^AMf</p>
        <p>7(WI)AM|jrQrlfffih</p>
        <p>MTIERMITES?</p>
        <p>OUlKNOmUIMU</p>
        <p>fT</p>
        <p>^ * a</p>
        <p>r9m VOmnN</p>
        <p>Soetdoe TeohnioiBii</p>
        <p>EVEREHES</p>
        <p>r^STCONinoL</p>
        <p>758-5630 vwwemmii</p>
        <p>7O Toqr Braa% Jovnel OBvcaiiM 3)M*WH</p>
        <p>mm</p>
        <p>QWa,hmOrDnm</p>
        <p>(BSPfOSdnleolle Sports Affle^</p>
        <p>(NKX) Mr. Wlmrfl World (TWN)PAndemo TJlfW^Si^AiidSoo</p>
        <p>MeSeeoodRoiiqnMoa O Normen Rockwell, An Amaricen Porlmlt A profile of artist Norman Rockwell, g (1 hr.)</p>
        <p>O O OMeot Rookie Ike and Tony start their own investigation to learn why Lt. Zaga has been placed under police surveillance. g(l hr.)</p>
        <p>3) Movie The Breakfast aub (1985) Emilio Estevex. Molly Ringwald. Five teen-agers converge at an all-day detention session and make strides toward mutual understanding and i-sp^. (2 hrs.)</p>
        <p>O Hlfhwny To Honvon</p>
        <p>Jonathan 'frhtot fnr letfilitiwi that would reunite women inmates with their families. In stereo. g(l hr.)</p>
        <p>O Perfect Streiori In a</p>
        <p>dream sequence. 40 yean have passed and Larrys the worlds oldest cub reporter, sufferii^ from a ease of unrequited love. (Postponed from an earlier date.)g</p>
        <p>(ART^ Air Powar The United States clean the central Pacific of the enemy. Host: Walter Cronkite.</p>
        <p>(BET) BoMnr JOom (DM) BdlMioTwIm The baby elephant escapes again, wearing a valuable jeweled harness. (Part 2ofS)</p>
        <p>(BSPN) WKA Karate U S Ught-weight Championship, from Las V^. Nev, (taped) (1 hr.)</p>
        <p>(HBO) Moida One Craiy Summer" (1918) PC'(I hr.. 30 min.) (mudrBtaa &amp;lt;MA1) Mono "Wanted Dead Or Alive  (1987) R'(2 hn.)</p>
        <p>ICtfSiWhanAioYoa?</p>
        <p>MaiwiO 8Miy Slap</p>
        <p>hrs.)</p>
        <p>MIO Mu Mur</p>
        <p>suspects Uiat a potentiarbwyw for the Ledger is a con artist In</p>
        <p>^nO) Movie ' Short drcuH ' (1988)PG'(2hn.) ncanoad</p>
        <p>New Ooutry Featured; ,  .V...  Jopat.  In  stereo.'</p>
        <p>'lltMiailralgMTMk.,</p>
        <p>(1988)'P</p>
        <p>Ki</p>
        <p>&amp;gt; Tom Wo</p>
        <p>stability of (^arlies students.</p>
        <p>g</p>
        <p>(ARTS) Twentieth Century The</p>
        <p>Allies capture Cherbourg. Host: Walter Cronkite. (Part 2 M 2) (DM) Dangtr Baj A French xoology student accidentally lets a poisonous frog escape from the aquarium. In stereo, g (NMXIIflMarBd hit Qutf Show Grant wins a trip to Hollywood in a poetry contest and decides to sit in on a taping of Garrys show. In stereo, g MieTMCM O American Maatan "Buster Keaton; A Hard Act to Follow' This look at Keatons comeback during the 50s and early 60s includes interviews with Allen Flint and Dbnald OComior. (Part 3 of 3) g(2 hrs.)</p>
        <p>O O Movie "Gandhi  (1982) (Part 1 of 2) Ben Kingsley. Candice Bergen. Richard Attenboroughs e^ tracing the life M Mohandas K. Gandhi, from his early career as a lawyer through his demonstration of ^ p^ve reslatance to gain indfe. pinaencelorIndia.g(2lirs.)</p>
        <p> Year b The Ufa Foul weather and family feuds lead to a fowl-free "Thainksgiving at the Gardnns borne. In stereo. (Ibr.)</p>
        <p>a Booparman In stereo, g (ARTS) Divided Uidaa The Union forces are victorious at Gettysburg in 1883. Narrator: George Peppard. (Part 3 of 5) (1 hr.)</p>
        <p>(BBDVMsoSool (DM) Movie '"Arthurs Hallowed Ground" (1988) (1 hr., 30 min.) (RBPN) Top Riak Boii^ Urry Aleiander vs. Orlin Norris fw the NABF Heavyweight title, scheduled for 18 roumb, from Las Vegas. Nev. (Uve) (2 hrs.) (UPIQ Movie Alices ResUu-rant(1989)(2hrs.) (raODlblbieaw MHOW) Movto "Top Gun  (1988) PGdhrs.)</p>
        <p>(fm Movb The Money PH  (1968)'PG(lhr..30min.)</p>
        <p>(USA) Movla A Mibummer Night's Sex CMnedy" (1988) (2</p>
        <p>- O Jay hmt/t FuaOf Comedy Hour Beatrice Arthur. Brian Bonsall, Barbara Billingsley, Susan Ruttan. Florence Henderson and Anne Schedeen join Jay Leno for a humorous look at American families. In stereo. (1 hr.)</p>
        <p>0 Dynasty Sean seeks damaging information about the Carringtons; Blake divests himself of controlling interest in Denver Carrington; Sammy Jo lies to Steven. g(l hr.)</p>
        <p>(ARTR Ronmd Premiere. A profile of Erwin Rommel (The Desert Fox"), field marshal of the German army, who took his own life when accused by Hitler in an assassination plot in July, 1944.(1 hr.)</p>
        <p>(MAX) Movla ""Codename; Wildgeese (1986) "f. (l hr.. 45 min.)</p>
        <p>.lb</p>
        <p>188(WTB8) Movie "Car Wash (1976) (2 hrs.)</p>
        <p>18-J8 O American Snapdwts (DM) Aalmali b Aetloa Featured; how different species use their legs.</p>
        <p>(NKX)lbokees (TMC) Movie "Friday The 13th. Part VI: Jason Lives  (1986) R (1 hr.. 40 min.) (TNFQIHdeocooHry</p>
        <p>881888.;</p>
        <p>kd8(W^ Mo</p>
        <p>llddOReml^</p>
        <p>O Doctor WM The Armageddon Factor The Doctor discovers the bixarre truth about the Zeom.(Part3of6) O0O0News (DACamntAttalr (AMM Evei^ At The taaprov (BET) Soft Notes (DM) Mliring Adventnreo Of Calle And Harriet When the Dean discovers the fraternity is throwing a party without his permission, they try to convince him that hes the surprise guest of honor.</p>
        <p>(ESPN) NHL Hpckqy Chicago Blackhawks at Los Angeles (Uve) (3 hrs.)</p>
        <p>Movie Patricia (1980) (1 hr. 45 min.) (Hm)YottCanBeAStar (USA) AlrwoUThe AirwoH team must prevent a group of antiwar pacifists from using nucle</p>
        <p>ar missiles to fmce total disar-' manKnt. (1 hr.) lldOQ Trying Thnm Candice Bergen stars in this Bernard Slade story about a divorcee o)ping with the hazards of moving day. Bruno Gerussi and Keanu Reeves co-star, g OM*A*S*H</p>
        <p>3) Late Show Host; Arsenio Hall. Scheduled: actor Greg Evi-gan ("My Two Dads '), actress Sheryl Lee Ralph, syndicated columnist Cleveland Amory, comic Lenny Gark. In stereo. (1 hr.)</p>
        <p>O Tonight Show Host; Johnny Carson. Scheduled; comic Jonathan Winters. In stereo. (1 hr.)</p>
        <p>O Addirty Greenspan asks Adderly to find his missing maid. (1 hr., 10 min.) 0NlghtUneg</p>
        <p>(DIS) Movie "Mr Belvedere Goes To College" (1949) (1 hr., 30 nun.)</p>
        <p>(BBO) Movie Airplane!" (1980) PG(I hr.. 30 min.)</p>
        <p>(I^I^BrilleNow 11:45(MAX) Movie The Clan (H The Cave Bear" (1986) "R (1 hr., 40 min.)</p>
        <p>18480 Bum Aid Allen O Adderly Adderly's sent to Ireland to prevent the kidnapping of a valuable stud horse. (I hr, 10 min.)</p>
        <p>0AIIee</p>
        <p>(ARTS) Air Power The United Sutes clears the central Pacific of the enany Host: Walter  Cronkite.</p>
        <p>(BET) Going Places  (UFE) Flamingo Road (USA)Drapet 18:18 (TMQ Movie When Father Was Away On Business " (1985) 'R' (2 hrs., SO min.)</p>
        <p>1840 (WTBS) Movie The Ust De-Uil"(1974)(2hrs.)</p>
        <p>18:800 Best Of Graocho S)KoJak</p>
        <p>O Ute Night WHh Dnvid Uttennan Scheduled; actress Ch'i'stine Lahti, White House diei Henrv Haller, In stereo. (1 hr.)</p>
        <p>0 Lveme A adrley (ARTS) Twentieth Centnry The</p>
        <p>Allies capture Cherbourg. Host: Wajter Cronkite. (Part 2 of 2) (BET) Urban Scene</p>
        <p>ffHOD Car 54. Where Are Yon?</p>
        <p>(USA) Edge Of Night</p>
        <p>11400 Movie "The Thief Who Came To Dinner ' (1973) Ryan O'Neal. Jacqueline Bisset (1 hr.</p>
        <p>20 min.)</p>
        <p>18:45 (SHCiW) Super Dave Super Dave Osborne (Bob Einstein) of "Bizarre.  joined by guest Ray Charles, brinp his "death-defying" stunts to this new spin-off series. Tonight: the Super Dave Players spoof safe sex. g</p>
        <p>1400 Jack Ibnny (ARTM Divided Unh The Union forces are victorious at (kt-tysburg in 1863 Narrator:</p>
        <p>George Peppard. (Part 3 of 5) (1 hr.)</p>
        <p>(BET)KeyiToSuccem (DB) Movie "The Blue Bird'</p>
        <p>(1976)'G'(2 hrs.)</p>
        <p>(HBO) Movie "Hollywood Vice Squa(1986)R'(lhr..45min.)  ^</p>
        <p>O^bveitment Advisory</p>
        <p>(NICK) Milter Ed (TNN) New Omntry Featured: Tom Wopat In stereo.</p>
        <p>(USA) Search For Tomorrow 1:100 Movie "SUrk Mirror Image  (1986) Nicolas Surovy. Pat Corley. (1 hr. 20 min.) 1:15(SH0W) Movie "Richard Pryor - Here And Now" (1983) R'(l hr.. 40 min)</p>
        <p>145 (MAX) Movie "Young Lady Chatterley II" (1985) (1 hr.. 35 min.)</p>
        <p>1400 Laurel And Hardy 3)neSaint ONewi</p>
        <p>(BEI)FocmOnSoccen (NHX) Donna Reed (TWf) Movie Trail To San An-tone"|1947)(lhr.. 30 min.)</p>
        <p>(USA) WWF Prime Time Wrei-tling SD (Special Deliverv) Jones meets Boris Zhukov aiid Cowboy Bob Orton clashes with Hacksaw Jim Duggan in feature bouts. (R) (2 hrs.)</p>
        <p>1400780Onb Oraghtwatch</p>
        <p>(ART$ Rommel A profile of Erwin Rommel (The Desert Fox"), field marshal of the German army, who took his own life when accused by Hitler in an assassination plot in July. 1944 (1 hr.)</p>
        <p>(KT)lfflndpower (ESPN)SportiLook (NICK) Laugh b</p>
        <p>FREE PIZZA-FREE PIZZA</p>
        <p>BUY ONE</p>
        <p>nzzA...</p>
        <p>GETONEFREEI</p>
        <p>Buy any size Original Rounij pizza at regular price, get identical pizza FREE!</p>
        <p>Pito MlM d(MfMing on fin tnd iMMr of leppmu ofdffM VtM Mh oupon ai MfHepHne uWf Cftm</p>
        <p>CfffV Out Only</p>
        <p>Wfer Good Thru Nov. 30,1987</p>
        <p>BUY ONE</p>
        <p>getgSeoi</p>
        <p>LttMa Caesars</p>
        <p>2 Smell</p>
        <p>2 Item Pizzas..</p>
        <p>SnMlI</p>
        <p>Pizzas</p>
        <p>For</p>
        <p>NO WMimmgM M ouTnw ***  *  PfiNfViNil urn Cmmt</p>
        <p>OntOMfMPltCMlMW.</p>
        <p>Carry OM Only</p>
        <p>Otter Good Thru Nov. 30,1987</p>
        <p>4l(Wni) NBA BmkMball Atlante Hawks at Boston Celtics (Live)(2hrs., 15 min.)</p>
        <p>I4IO Lait PTeottor Dr. Richard Winterbottom and the team study the reasons behind shark attacks..  , .</p>
        <p>O Hand Of The Oaai A pay -Cholpgist tests ih)qotitolal'</p>
        <p>6"!</p>
        <p>I  j  iSitai I</p>
        <p>HHi ilHI HHIHH HIH flrfl HI</p>
        <p>"""  'Sa|</p>
        <p>AiMrica&amp;gt;biseg*CanyOurPizaM .</p>
        <pb facs="00096780_0130" />
        <p>TV-10 TIm Daily RflMtor.GrMmlll*,N.C. Sunday. November atlW</p>
        <p>SUNDAY</p>
        <p>(Continued From Page 4)</p>
        <p>transform a down-and-out fight-ers hands into deadly weapons, a hr.)</p>
        <p>(ES*N) Surfer llafUiM (TNN) Wiak You Wure Here</p>
        <p>Featured; New Orleans, La. In stereo.</p>
        <p>IKM 0704 dub (ARTS) Jan At The Sniaionian Singer Alberta Hunter comments on. and performs her repertoire of blues. In stereo. (1 hr.)</p>
        <p>I liUUoB Dollar Secret )&amp;amp;NctaOnlar (NKX) WTle Johnny An(^l (1945)(2hrs.)</p>
        <p>(TMN) Celabrlty Outdoon Featured: singer / actress Carol Lawrence goes sightseeing and rock climbing in Maui. Hawaii. In stereo.</p>
        <p>(USA) Consumer Chidleaie Btn-blodier</p>
        <p>(WTBS) Christian ChlMrena Fund</p>
        <p>111 (HBO) Joe Ptacopo Comedian Joe Piscopo of "Saturday Night Live" fame portrays his many characters in a live stage performance on October 31. 1987. In stereo. (I hr.) l:ONlAtatch 8:M(E&amp;gt;m Flteakie With The</p>
        <p>&amp;gt;:tf(IIAX) lloTle At Close Range" (1986) R' (2 hrs.) 2:9e(SHOW) Movie Hardbodies 2"(1986) R (1 hr..30min.) 8:000 Movie "His Girl Friday" (1940) Cary Grant. Rosalind Russell. (2 hrs.)</p>
        <p>(ARTS) Evening At The Improv (BETlVldoo^UoM (DIS) Movie Yankee Doodle Dandy" (1942) (2 hrs., 10 min.) (TMC) Movie "She's Gotta Have It" (1986) R'd hr.. 45 min.) (USA) Chrlatiaa ChihhUBa nmd (WTK)Save The Odkiren S:10(HBO) Movie Hollywood Vice Squad" (1986) 'R' (Ihr.. 45 min.)</p>
        <p>8:80(ESPN) CbUefo Baahethnll</p>
        <p>North Carolina vs. Syracuse in Hall Of Fame Tip-Off Classic, from Springfield. Mass. (R) (2 hrs.)</p>
        <p>(U8A)PlayenClah (WTBS) Movie A Man Could Get Killed" (1900) (2 hrs.)</p>
        <p>4:00 (LIFE) lavestmsBt Advisory (raCK) Movie Made For Each Other" (1939)(2 hrs.)</p>
        <p>(USA) Coosumer Challenge; Blu-</p>
        <p>I Rodeo Mesquite Championship Rodeo from Mesquite, Texas. In stereo.</p>
        <p>(USA) Consumer Challen^: MDR Vitamin (WTBS) Larry Jons</p>
        <p>4iO(SHOW) Movie Young And Free" (1979) PG (Ihr. 30 min.)</p>
        <p>4J0(USA) Oonumer (Mkm MDR Vitamina</p>
        <p>4:(MAX) Movie John F. Kennedy; Years Of Lightning. Day Of Drums" (1905) (1 hr. 45 min.) (TMC) Movie Hotel" (1967) PG' (2 hrs.. 15 min.)</p>
        <p>TV CIRCLES</p>
        <p>By 6ayl Disco*</p>
        <p>Words in the list below appear across, up, down, backwards and diagonally in the diagram. Find each word and circle it Some circled letters appear in more than one word. Letters that form answers are left over. Arrange them in order to arrive at answer.</p>
        <p>Cluo: A HAPUSS INHiRnOR</p>
        <p>HMMB NEOA RBR I OEQO RUGG E E I Z RNTR GOAT RPM I AHOU NN ST SAPU Y AME C A I U P LGP</p>
        <p>RUH N I N U^GC ARE CME TSL T A I T I N I I R RM CN A I AR AE</p>
        <p>HAN</p>
        <p>EOS CT Y NT I KB A USS Z I CNN CCD ENL PCA NST HA I TOE RT J D Y T</p>
        <p>PTPNO RSRMC F E I L I T I ARS PRCEC ESHAO LT I RP OA I DS EERTL NMNDA R AOM I NF ATR. RRNUT DOL AA TEBES</p>
        <p>(SOLUTION: 9 lottors, 1 word )</p>
        <p>Apartments. Betty, Bobo," Boris Pntzger. Captain C Z Stern. Clarence McNeil. Cops, Crisp. Dispatch, Drama. Engaging. Gay, Handy, Harry, Hero. Human, Humor, Imp, John Ritter, Maureen DeMott, Orientate. Pacify. Plainclothes, Rick Silardi, Rule, San Francisco, Susan, Tenants, Trials, Tribulations, unique</p>
        <p>C  Inc.</p>
        <p>Ben Kingsley pl^s the tttle role in the Academy Award-wlnnlng flhn "Gandhi." Part one airs Wednesday. Nov. 25 on CBS; part two airs Thursday. Nov. 26.</p>
        <p>DAniMI</p>
        <p>(Contliiued From Page 6)</p>
        <p>hMfl nyliM Nm (Mn-Wed, Fri)</p>
        <p>O Movie (Thu) Huckteberry Finn" (1972)</p>
        <p>O GO) (Mob, The, Thu) Aduh Basic Education (Wed) 0ONFLThdn(Thi) d) FMMilaaii MoibWud) (BET)VldeoVlhrMlMi (MS) WeicooN To Pooh Cormr (Moa-Thu) Blissing Adventures Of Ozzie And Harriet (Fri) (IBni) Drag Radof (Tiu) World Sport Special (Wed)</p>
        <p>Movie (^^Girls Just Want To Have Fun" (1905) (NlCI)bneetorGM (iraOFttduaio (UBA)Jueimot</p>
        <p>4J0eHiid^Wed,m)</p>
        <p>O Wehffer (Moa-Wed) NFL</p>
        <p>Football (Thu)</p>
        <p>d) Real Ghoatbusten (Moa-</p>
        <p>WOd) Wonderful World Of Disney (Thu. Fri)</p>
        <p>0 Silver ^pouaa</p>
        <p>0 Love GouaectlM (Moa-Wed) NFL Football (Thu) 0Opnhmiey</p>
        <p>(DM) MkkeyMottoeChih (Moa-Thu) Missing Adventures (H Qx-xie And Harriet (Fri)</p>
        <p>1 ESPN) AWA Chomploaohip WnhIbi (Mea, Tao) World Class Champhmship Wrestling (Wed) Spirit Of Adventure (Thu) (UFB) Movie (Moo) Improper Channels" (1981)(Toe) A Matter 01 Life And Death (1980KWed)  Young Pioneers  (1976XThu)  The Marriage Bed" (1986KFri) The Uttle Prince" (1974)</p>
        <p>OiAI) Movie (Mon) "Quick-sUver (190C)(Tue) "The Pleasure Of His Company (1901XWed) "The Rat Race (1960XFri) Thats Ufe!" (1986)  1 Yoa Cut Do That On</p>
        <p>(8B0W) BUad MatfO Bluff (Mon) (SHOW) Movie (Tue) "The Bad News Bears Go To Japan" (1078) ^</p>
        <p>(SHOW) NMw And Tbi Nerd (Wed) Faerie tale Theatre (Thu) My First Swedish Bcrnibehell (Fri)</p>
        <p>(TNN)NMhvUleNow</p>
        <p>(UBAHlalBRaaclloo</p>
        <p>(WT^FUaWeaai</p>
        <p>UOeFMhorKnonsBeM(Moa-</p>
        <p>WOd,Frl)</p>
        <p>O Whare HappcnhM Noun (MohWM)  </p>
        <p>d) DmkTilee (Moa-Wed) ^FacleOfUfe</p>
        <p>rOwrt(Mon-Wd)</p>
        <p>Of Tin MoMcaae</p>
        <p>unuMUdoOH :aMSNV</p>
        <p>(HBO) Movie (Toe) A Challenge For Roto Hood" (1968)</p>
        <p> Workta Ihr</p>
        <p>lMovfe(Wed)"GoIdyU: the Saga Of The Golden Bear" (1986XFri) Peter Lundy And The Medicine Hat Stallion" (1977)</p>
        <p>lAOOMgVallay (Moa-Wed, Fti) 0 Movie (Thn) The Magic Of Lassie" (1978) 0MialMrlloim(R)</p>
        <p>O Senfoid And Son (Mon-Wod) (DSBvnrSpoom 0DlvneOovt OTbeJndli (Moa-Wed) OGimaieABni!</p>
        <p>(ARTS) Golden Age Of Televi-eion</p>
        <p>(BBT)indeoLP</p>
        <p>(D0 nde beonorafed (Men, Wed) I Know A Secret (Ttte) A Tale Of Four Wishes (Thu) Missing Adventures Of Oxzie And Harriet (Fri)</p>
        <p>(0PN)Auto] CoUegeBasketbaU(Fri)</p>
        <p>(HBO) Movie (Mon) Id Sir With Love" (I967)(Thu) Ordinary Heroes" (1980)(Fri) "Sylvestw (1985)</p>
        <p>(MAI) Movlt(Thu) The Karate Kid Part H" (1986) (NlCnDoaniBThoManaoe (SHOW) Aay FMoad Of Nlcholae NkUahy b A Frtoad Of Miao (Ita) A Thanlugiving Tale (Thu)</p>
        <p>(TMO Shod Film flloncaie</p>
        <p>ffijoMbvIe(Tue) 1 Ought To Be In Pictures" (1982XWed) Trading Places (1983)</p>
        <p>(USA) Danct Party WA 540 (WTBS) Maaaten 540Oaman0mTlaviikin OAady Griffith (Moa-Wad) ODGIimaeABraak! ONiwlywudGaB</p>
        <p>. . fV..</p>
        <p>1 ^</p>
        <p>2</p>
        <p>3</p>
        <p>4</p>
        <p>9</p>
        <p>6</p>
        <p>rj</p>
        <p>13</p>
        <p>1</p>
        <p>15</p>
        <p>16</p>
        <p>18</p>
        <p>19^0</p>
        <p>20</p>
        <p>24</p>
        <p>ISO</p>
        <p>m</p>
        <p>47</p>
        <p>m</p>
        <p>99</p>
        <p>60</p>
        <p>03</p>
        <p>97</p>
        <p>1 Actor Granger 8 Don, Maud or Mason</p>
        <p>13 Singer Cole</p>
        <p>14 TVs predecessor</p>
        <p>15 Gold; Sp.</p>
        <p>16 Ideology</p>
        <p>17 Concerning</p>
        <p>18 Word with book, note or roll</p>
        <p>20 Govt. agcy.</p>
        <p>22 Travelers' stops</p>
        <p>BY DANIEL M. MARVIN</p>
        <p>ACROSS</p>
        <p>23 - the World Turns 25 One  to Live</p>
        <p>27 Singer Tucker 30 Stan on The Golden Girls 34 Mother sheep 35Switinits.</p>
        <p>37  Elsewhere</p>
        <p>38 Some</p>
        <p>39 Dana or Julie 42 Miss Graff 44 Bhutans</p>
        <p>continent</p>
        <p>1 Snooty one</p>
        <p>2 Actress Buckman</p>
        <p>3 Kind of jacket</p>
        <p>4 Radio Days prod.: intts.</p>
        <p>5 Miss MacGraw</p>
        <p>6 Opera director Stevens</p>
        <p>7 Shirley -</p>
        <p>8 Altar constellations</p>
        <p>9 Actor Travanti</p>
        <p>to Capital of Yemen</p>
        <p>31 82 3)</p>
        <p>43</p>
        <p>91  92  98  94</p>
        <p>45 Yes: Russian</p>
        <p>46 Basra's country</p>
        <p>49 Gamma, Rho, Gamma</p>
        <p>51 Decorated wall part</p>
        <p>55 Actress ONeal</p>
        <p>57MHdoath</p>
        <p>59 Excavate</p>
        <p>60 Penetrate</p>
        <p>81 Sir Laurence</p>
        <p>63 Heavy hammers</p>
        <p>64 Miss Fabray</p>
        <p>DOWN</p>
        <p>11 Neighbor of Wise.</p>
        <p>12 Drunkards 19 - OBrien</p>
        <p>21 Helps 24 Comedian Soupy</p>
        <p>26 Putrid</p>
        <p>27 Beverage</p>
        <p>28 Plant baard</p>
        <p>29 A Beatty</p>
        <p>31 The late Miss West</p>
        <p>32  Margret</p>
        <p>33 Humorist Louis</p>
        <p>36 Great gulp;</p>
        <p>slang 40 Miss Welch</p>
        <p>Anawen On Page 14</p>
        <p>41 Ancient Assyrian king 43 Young man</p>
        <p>46 Bit of news</p>
        <p>47 Frog genus</p>
        <p>48 One of the Aleutiara</p>
        <p>50 Festive</p>
        <p>52 Mine entrance</p>
        <p>53 Food intake</p>
        <p>54 Monster 56 Scarecrow</p>
        <p>and -King 58 Clamor 62 Inits. tor an Edwards</p>
        <p>DndE</p>
        <p>Thi) Misting Adventures</p>
        <p>Christmas Is Almost Hem!</p>
        <p>We have forks, knives, plates, napkins and piastic cups In beautiful holiday col-ors sure to make your parties and family get-togethers more festive!</p>
        <p>WE HA VE SANTA COSTUMES FOR RENT</p>
        <p>S*t S-2</p>
        <pb facs="00096780_0131" />
        <p>A-</p>
        <p>'-- -a,</p>
        <p>m.</p>
        <p>'k</p>
        <p>Movie Break-Out</p>
        <p>T|Ml^|IMtoetor,QrfMNM*,N^^^  Sundey. November 22,1W7  TV-11</p>
        <p>mamy</p>
        <p>rnmamu^m &amp;lt; DAymaMom &amp;gt;</p>
        <p>mgrDey Rider (69)</p>
        <p>A Home O Oer</p>
        <p>Oim"(lf75)</p>
        <p>JI0A1) ClaiHlrAiid Deviir</p>
        <p>&amp;lt;)  .  W</p>
        <p>"Urban Cowboy"</p>
        <p>Kg^,,</p>
        <p>pCdn-vlSS BiealtBtForTwo-</p>
        <p>"Tie Awfnl Tmlh</p>
        <p>OintPr*fli)</p>
        <p>" Aiid Death (197S) bite Nights (IMS) Marlowe (IMS) 'iMmd The World b (IWI)</p>
        <p>*Soander(lf72)</p>
        <p>Death Of A Satesman</p>
        <p>Jumpln* "jack Plash</p>
        <p>Him Big Show (1937)</p>
        <p>) "Cape Pear (190)</p>
        <p>, "And Now Por Something Completely nUerent (1972)</p>
        <p>1M01I1) Stormin Home (9M)</p>
        <p>^^(AilTS) Sleeping Tiger</p>
        <p> (1984)</p>
        <p>)"TroH(19M)</p>
        <p>The Impossible Years</p>
        <p>The MeAcine Rat StaHhm (1977)  -</p>
        <p>(TMC) Strange Udy b Town (IMS)</p>
        <p>MI(HBO) Pee-wee's Big Adeen-tre(l9l5)</p>
        <p>(MAX) The Profettionab (19M)_</p>
        <p>NiSMTW) "The Bad News BeanGoTobpan;^1978)</p>
        <p>P-Nm Nadia" (1M4)</p>
        <p>(HMM Shattered Vows" a984) 1M9(ARTS) Sleeping Tiger (1984)  !;</p>
        <p>(MAB Blood Alley" (1988) WW) Show Boat (IMl). (^Manhattan'(1979)  . 10M(WTBi9 The Delicate Oeiin-qent"(19S7)  ^  f  ^</p>
        <p>1149(HB0) The Sterile Cackoo^ (1M9)</p>
        <p>(TMC) "Thwider Alley'(1998) imarnu OperaUon Patflc (1951)</p>
        <p>b)ve With A Peibct</p>
        <p>4*0(1191) Imfvoper Channels</p>
        <p>(IMl)</p>
        <p>fc2fSq{</p>
        <p>_JQnlcksUver"(1998) SOfflBO) To Sir With Love (1967)</p>
        <p>8:99(niO DetecUve^ool Dropouts (19W)</p>
        <p>1VESDAY</p>
        <p>N0VEMBBRM.1N7 DAYTDIE MOVIES</p>
        <p>W9(MAX) "Bedtime Story (IMl)  ^</p>
        <p>749WV) Pettt* Lundy And</p>
        <p>l:il(DIS) The Legend Of Lobo (1962)  ^</p>
        <p>(HB(&amp;gt;) Peggy Sue Got Married (1986)</p>
        <p>(TMC) Marie(1985)</p>
        <p>(TNN) Bqrand The Pnrple Hills (1950)</p>
        <p>Downhill Racer</p>
        <p>(1969)</p>
        <p>180(MAX)Rage(1972) 8.*N(ARTS) Splendor (1935) (TMQ Strain La^ b TWn (1955)</p>
        <p>4r89(UPR)  A Matter Of Uf And Death" (1989)</p>
        <p>(MAX) The Pleasore Of His Company (1961)</p>
        <p>^ffiOW) The Bml News Bears Go To Japan (1978)</p>
        <p>436(HB(^ A Challenge Por Robin Hood" (1968)</p>
        <p>8.-69 (TMO I Ought To Be b Pictures (1M2)</p>
        <p>WEDNESDAY</p>
        <p>NOVEMBER 11,1917 DAYTIME MOVn</p>
        <p>8:18(SBOW)  DucheM Of Idaho (1949)</p>
        <p>6:89(HB0) White Water Sam (1977)</p>
        <p>Have A</p>
        <p>Wonderul Thanksgiving!</p>
        <p>Loealvcl I AMi^ton Soulmrd 2V4 By Pass Graiwilla</p>
        <p>"(UJI)</p>
        <p>Glory Glory</p>
        <p>Circuit (1996) jg5irj^.MotbBr(lM6)</p>
        <p>JfMQ^  Pit (1986)</p>
        <p>^tl6M^Miracles(1986) i!l6taSolo(lM8) '</p>
        <p>l*6|im Splendor  (19) 0OO) The Cartier Affair (1M)</p>
        <p>(^One-Eyed Jacb  (IMl) gaOm) The SHver daAee  (IMS)</p>
        <p>166(WBM fbess Whos Coming To Dinner.(lN7) lU6(nK9 Pee-wees Big Adventure (19)</p>
        <p>13M(HB0) One Craay Sununo*  (1986)</p>
        <p>(MAI)  I Ought To Be b Pictures (1M2)</p>
        <p>UMOTOW) Top Gun" (1986) (INN) Trail To San Antone (1947)</p>
        <p>1:66(D9) The Blue Bird (1976) (niK) "Streete Of Gold (19M) l:66(WnS)  They Only KUl Their Masters (1972) l^(HBgBulIshot(lM3) 8J9(Ma15 -Tlie Ballerina And The Blues (1M7) asanviyjree Spirit" (1978) 846(A^ Thii Big T 11952)</p>
        <p>crag "Airplane! (1980)</p>
        <p>(TMO The Barretts Of Wim-</p>
        <p>Davki Cbpperfiehf</p>
        <p>IMfSBOH) A Home Of Our Own" (1975)</p>
        <p>846(MA]Q Plymouth Adventure (1952)</p>
        <p>U6S "Pickwick Paj^(19) Dg Wicked</p>
        <p>FRIDAY r</p>
        <p>NOVEMBER 17.1967 daytime MOVIEB</p>
        <p>4W9 Laguna Heat (IM7) MMOW) Die Cheyenne Social Club (1970)</p>
        <p>W6(MAX) Stormin Home  (1M5)</p>
        <p>(TMO "My American Cousin" (IM5)</p>
        <p>7J6(MAX) The Beast From 20,000 Patboins(l3)</p>
        <p>(TMO Hotel (1M7)</p>
        <p>6:660 "JungleBook(1942) (M())Uforia(1986)</p>
        <p>.  Medicine    (1M5)</p>
        <p>646 (MAX) Goodbye Mr. Chips (1969)</p>
        <p>946(DiS) My Uttle Pony - The Movie (19M)</p>
        <p>946 (HBO "PasMons (1M4) 1646(ART0 The Race For The Double Helix (1986) ^W)Camelot(lM7)</p>
        <p>(TMO  Detective School Dropouts" (1986)</p>
        <p>(USA) The Blademaster (1984) 1646 (WTB8) The Brass Bottle " (1964)</p>
        <p>1146 (MAX) John F. Kennedy Years Of Lightning. Day Of Drums (1965)</p>
        <p>.  ,   .  .kicked  This</p>
        <p>WayComes(19M)</p>
        <p>946(TMO 'Alices Adventures b Wonderland (1972)</p>
        <p>"The Point" (1971)</p>
        <p>The</p>
        <p>Dees"</p>
        <p>1646(</p>
        <p>(1952)</p>
        <p>(HB(9 The Bad News Bears Go. To Japan" (1978)</p>
        <p>(MAlO 'The 7th Voyage Of Sin-bad(1958)  .</p>
        <p>(SBDW) Plymouth Adventure (12)</p>
        <p>(USA) Cavenan (1981) 1646(WTR8) AU Baba And The Fo^ Thieves" (1943)</p>
        <p>M:66 flMa Oxford Blues (1984) 1146 (HBO) 'Casey's Shadow" (1978)</p>
        <p>(MAX) The Three Worlds Of Gulliver" (I960)</p>
        <p>1246(SHOW)  Sweet Liberty (19M)  ^</p>
        <p>13460 A Tale of Two Oti</p>
        <p>(1971)</p>
        <p>146(^ Show Boat (IMl) (TMQ "The Hideaways (1973) (TNN) Sierra Sue" (1941) 146(WTR0  Angel b My Pocket (1969)</p>
        <p>146 (HBO) Seven Minutes b Heaven (19M)</p>
        <p>(MAX) aub Paradise (19M) 3.460 "(Miver Twist (1982)</p>
        <p>O  Fathers Ute Dividend" (IMl)</p>
        <p>(8H(HW"Chisum" (1970) 346(ART0 The Race For The Doubte Helix" (19M)</p>
        <p>(HBO) Hannah And Her Sisters (1986)</p>
        <p>(TMO Camelot (1967)</p>
        <p>3460 Huckleberry Finn (1972)</p>
        <p>(MAX) Girls Just Want To Have Fun (19)</p>
        <p>446(L1919 The Marriage Bed (1986)  ^</p>
        <p>6460 The Magic Of Lassie" (1978)</p>
        <p>"irsrWis</p>
        <p>H(1986)</p>
        <p>pole Street (1956)</p>
        <p>446(LIFE) Young Pioneers (1976)</p>
        <p>(MAIQ The Rat Race (1960) 446(8H0W)  GoWy II: The Saga OfTheG&amp;lt;ddenBear(19M) 646imC) Trading Places  (19M)  ^  ,</p>
        <p>646(HB0) Sword Of Gideon (19M)  ,</p>
        <p>THURSDAY</p>
        <p>NOVEMBER M.1N7 DAYTIMB MOVIEB</p>
        <p>6.46(MAX) The Karate Kid Part U(19N)</p>
        <p>646(TM(9 "This Sporting Life (19U)  ^</p>
        <p>25% off</p>
        <p>Jumpsuits</p>
        <p>JUk.'n UiHfnnn</p>
        <p>iTosw.Miteram  Tsb-mi</p>
        <p>Janet Bowser &amp;amp; Associates</p>
        <p>WiBi</p>
        <p>Feafmof the Week</p>
        <p>9264 LANDMARK G-1. SHERATON VILUGE. Thme b^rwm townhouse In SHERATON VILCAQE. Compllmsnt-d with large-sized rooms, walk-in closeti. separate laundry room, pantry in kitchen, and fireplace. Erid unit, which</p>
        <p>non-qualipyino</p>
        <p>ASSUMPTIONI Priced at only 9S6,000. (Contact  ----- JAhfET BOWSER V A</p>
        <p>f' &amp;gt;</p>
        <p>imm</p>
        <p>nvJ9umrnvvi rnceo at oniy it ^el Bowser, CENTURY^ 2t, JAhfE ASSOCIATES, 396^ at 7S6560. aSQ,</p>
        <p> '</p>
        <p>;:^'</p>
        <p>(TMQ Rabhit. Run" (1970) 13460 Gullivers Traveh"</p>
        <p>(HBO) Peggy Sue Got Married * (19H)</p>
        <p>134IO0 The Homecoming" (1971)  *</p>
        <p>1.46 (DQ) Hi. Good Lookin  (1944)</p>
        <p>(MAX) The Great Santini" (1979)</p>
        <p>(SHOif) 'Stoogcmania (1988) (TWN) The Singing HiU" (1941) 145(WTBQ -Istend Of The Blue Dolphins" (1964)</p>
        <p>146(111(5 "On The Edge" (19) 3460 . Three Guys Named Mike(1951)</p>
        <p>(DI8) "Hoaeymaon Lodge' (1943)</p>
        <p>2'46(8B0W) "The Bad News Bears Go ToJapan"(1978) 348(8JBTIB Kipperbang  (1982) (HBO) Eleni" (1985)</p>
        <p>(TMC) I Am A Canwra" (1955) 446 (LBE) Die Uttle Prince" (1974)</p>
        <p>(MAIO That's Ufe! ( 1986) 4*^H0W) "Peter Lundv And The Medicine Hat Stallion" (1977)</p>
        <p>8.46 (HBO) "Sylvester" (1985) 5:M(TMC) Tex "(1982)</p>
        <p>Subject: The Gambler III-The Legend Continues'</p>
        <p> The most popular TV movie of the 1979-80 season was not inspired by a newspaper headline or a topical disease; It was inspired by a song title. Kenny Rogers hit single "The Gambler was turned into the highest rated TV movie of the season. also called "The (bmbler, wite Rogers in the UUe role. This was followed by a two-parter, The Gambler - The Adventure Continues (1983), which ranked among the top five TV movies for that season. With the success of those two ventures, another sequel was assured. Now Kenny Rogers is back in the miniseries The Gambler III - The Ugend Continues." It airs Sunday. Nov.</p>
        <p>22 and Tuesday, Nov. 24, on CBS.</p>
        <p>Rogers remains philosophical about the latest sequel. In the four years or so since we last made a Gambler movie ... we didnt feel (co-star) Bruce Box-leitner and I ought to just go running through the desert again." says Rogers. We wanted something of substance to sustain IB through the film." What Ri^rs and company selected was a historical piece where their characters could interact with real historical figures. Sitting Bull (George American Horse) and Buffalo Bill (Jeffrey Jones) are among the characters in "The Gambler III.</p>
        <p>Atteadon</p>
        <p>SoteWte IV Viewers!</p>
        <p>Satellite PEOgniBI Packages Available</p>
        <p>SHoo</p>
        <p>I \r ptr month Package consists of:</p>
        <p>CNN Headline News</p>
        <p>The Discovery Channel WPIX  Nashville</p>
        <p>USA Network Lifetime Nickelodeon The Learning Channel MTV  VHI</p>
        <p>HBO, Showtims, Movie Channel, Cinemex elso evallable!</p>
        <p>DMOdart Are Now Availabiel</p>
        <p>REVS CABLE TV</p>
        <p>amAMhWtetewmeAawWi, Hmlkn^mmn$Counlln</p>
        <p>Home Avt. A Fountain Nwy.  Ftmivllle, N.C.</p>
        <p>:  .  7S9-B074</p>
        <p>ESPN</p>
        <p>CBN</p>
        <p>VVTBS</p>
        <p>CNN</p>
        <p>WOR</p>
        <p>WGN</p>
        <pb facs="00096780_0132" />
        <p>'" \</p>
        <p>^TV-ia  TtfPiHvItoWclor.OiwHl.W.C.  mhiy.Nwmt&amp;gt;f2a.H&amp;gt;y</p>
        <p>Thursday Evening</p>
        <p>limJKSDAY</p>
        <p>EVENING</p>
        <p>&amp;gt; </p>
        <p>^-T</p>
        <p>7:00 1</p>
        <p>7:30 1</p>
        <p>8:00 1</p>
        <p>8:80</p>
        <p>9:00 9:30</p>
        <p>10:00</p>
        <p>10:30</p>
        <p>nil</p>
        <p>RamiiKitonSteeto 1</p>
        <p>Had Town</p>
        <p>TOO Chib</p>
        <p>straight Talk</p>
        <p>Outdoors</p>
        <p>i M\</p>
        <p>ai</p>
        <p>Business Rpt.</p>
        <p>Stateline</p>
        <p>North Carolina Is My Homo</p>
        <p>Mystery*</p>
        <p>First Eden</p>
        <p>tel</p>
        <p>News</p>
        <p>CBS News</p>
        <p>Bugs Bunny</p>
        <p>DdyDuck</p>
        <p>Movie; -Gandhi"</p>
        <p>711</p>
        <p>Family Ties</p>
        <p>MAS'H</p>
        <p>Movir "The Love Bus'*</p>
        <p>News</p>
        <p>^1</p>
        <p>jeltarsons</p>
        <p>Benson</p>
        <p>Cosby Show</p>
        <p>Oifl.WoM</p>
        <p>Cheers Meme-sBey</p>
        <p>TMslsYourLile</p>
        <p>Good Tunes</p>
        <p>Lose Or Drew</p>
        <p>Bugs Bunny</p>
        <p>DafyOWk</p>
        <p>Movie: "Gandhi"</p>
        <p>irni</p>
        <p>Wlwal '</p>
        <p>Jeopardy*</p>
        <p>Mouse On The MsyBcunr</p>
        <p>Movie:--Missing In Action I The Beginning''</p>
        <p>Movie</p>
        <p>Mousaierpie.</p>
        <p>Best 01 Watt OUndfPminii</p>
        <p>Movie;-Ptymouth Adventure "</p>
        <p>S3</p>
        <p>SpoftsCemar</p>
        <p>SchoMic</p>
        <p>Codaoa Footbal: TwWMtfeRtt AIM</p>
        <p>_a</p>
        <p>la</p>
        <p>MovW.-'While 1</p>
        <p>Niohts"</p>
        <p>Movie: "Laguna Heal" I</p>
        <p>5-</p>
        <p>ThwkKPvinaPwadc Generations</p>
        <p>Family</p>
        <p>I Family</p>
        <p>m</p>
        <p>Movie The Jiwii Of The lie''</p>
        <p>Movie: Chib Paradise"</p>
        <p>Movie</p>
        <p>ti. \te0'</p>
        <p>Homo Of Our Own "</p>
        <p>1 Movie: "Sweet Libwty*'</p>
        <p>Movie: "SometMngWW" I</p>
        <p>If -whiii</p>
        <p>ca</p>
        <p>Movil</p>
        <p>Movie;-Blue Skies Again"</p>
        <p>1 Movie: "Oxford BkNB"</p>
        <p>m</p>
        <p>Airwoll</p>
        <p>1 Riptide</p>
        <p>WWF Primo Time Wresting</p>
        <p>za</p>
        <p>AndyGrilfith</p>
        <p>Sinford</p>
        <p>Movie: "The Great Race" 1</p>
        <p>mmmmt "smm mmtr, Jfl^Wdln.)</p>
        <p>&amp;lt;mN|MMDN ^</p>
        <p>IUGe(lM5)(Sin., ISmiii.)</p>
        <p>fcHOODfbM^liHli*</p>
        <p>ParOMif AnuMted. Daffy decides to cdebrate tke koUday by giving Us f ans a cbance to lAow their appreciation of UataUids.</p>
        <p>(R)g</p>
        <p>(i) Thraai Company O0Nea (ARTS) Hoaad Of The Bate vUka</p>
        <p>(DB) Mofia "The Gnome-Mo-he'aMf)</p>
        <p>(ESPN)SportaLook (Un) PUladUpUa Thaakiflv-'^riBgDfy Parada MOQ Hadan Kaapara ^OW) Movie -A ilome O Our s'Own" (1975)</p>
        <p>: (WC) Novia The Quinns -:^7(ltn)</p>
        <p>i^imiQCftokAadChaaa</p>
        <p>&amp;lt;dl(!)ToaClaaaFar Comfort IMBCNawag )ABCNawag -lOaTbaLNaWUh...</p>
        <p>WUoari Orela Bono a</p>
        <p>WUte Nights</p>
        <p>(1985)</p>
        <p>(NKK) NKX RoekK Vldoo To Go</p>
        <p>TMOlliBBiMlonStoala O NgNfyBaainam Report ONawa GDFandfylloa OMiinoaa OGoodllmoa</p>
        <p>pgPW)flebalMHr porta Amor lea</p>
        <p>(NKaQMr.mmid^WoiM (TMO Novia "Blue Skies</p>
        <p>Again (1983)</p>
        <p>INrFmNoaa</p>
        <p>(NAX) llovN The Jewel Of The Nile (1915)</p>
        <p>(NKK) Yon Caal Do That Ob</p>
        <p>QflB.LmaOrDraw</p>
        <p>(IRS) Nomalavplaea naatar</p>
        <p>/ ,</p>
        <p>RCil Model VMT295</p>
        <p>RCA Stereo Video Cassette Recorder</p>
        <p> Infrared remote control</p>
        <p> Linear stereo sound with Dolbyt Noise Reduction</p>
        <p> Up to 14 day, 2-event programmer</p>
        <p> 107-channel, 80-position broadcast/cable tuner*</p>
        <p> New image-sharpening High Quality VHS (HQ)</p>
        <p>^ Dolby IS &amp;gt; Irademark ol Dolby Laboratonet Licensing Corp ' Cbeck your local cable company i compatibility requirements</p>
        <p>Only349*</p>
        <p>plus PUCE iDOviM In our VMso RonUJ Club.</p>
        <p>We Aeeap* MatlerearO, Vlaa, American lapreie. Oteeoeery</p>
        <p>AvallaWa At</p>
        <p>Cexwmdee</p>
        <p>Owned And Operated By Rudy Cox Mil aeuM MamarM Orkra, OraaneWa, N.C.</p>
        <p>Nauta: Monday Tbfouoh Friday I t:W am-TM p.m.</p>
        <p>Saturday  IBM aJS-TM pm.</p>
        <p>OUmt Thnaa Sy Appolatmant TM-7S11 7M4110 IPbaMrrBiMmnMBnlWinariaSarWiuUlBariltidU*</p>
        <p>AadSoa</p>
        <p>kW0HsUTMm</p>
        <p>ONarthCunUMblfyHoiM</p>
        <p>O O BH9 Bte Ankaflv-</p>
        <p>DM In this special combining new animation with classic cartoons. Dr. Bumiy dispenses advice for avoiding holiday gluttony. (R)Q</p>
        <p>(D NpvN The Love Bug (19IN) Dean Jones. Buddy Hnck-Ut. A racing driver and Us mechanic take charge of HerUe. an independently nnded Volkswagen which prefers to take cfcargeofitself.dhrs.) OUbarflUm In stereo. </p>
        <p>. 0 Nsmt OB na N^fioMr AUnuted. A brave rodent stows away on the famous vessel bound for the New WorM. (1 br.) (ARTS) Last Of Thi NUdcaai His tribe defeated. Nagua le-captures Cora and flees with Uncas at bis heeb and Hawk-eye's party closing fast behind. (Part 13 of 13)</p>
        <p>(DlS)BmtOIWaRDlMyi^</p>
        <p>amla</p>
        <p>(BPN) Goilnia PoolbaD Texas</p>
        <p>at Texas AM (Uve) (3 brs., 30 roin.)</p>
        <p>(Ui^ Geamatloni The role of women throughout American history, featuring four generations of women from the same (amily who provide insight on how values have changed. (1 hr.) (NKX) Cm H. WiMn Aft Yoa?</p>
        <p>acpMBb. hast Ralph Edwards</p>
        <p>smipriaes a fonr-Uroe Emmy winner and a two-time Grammy ' wkmer when he chroaiela their lives. In stereo. g(lbr.) flMPhmIfy (fOmUiMb (U^nKvlt "Something Wild"(19M)'R(2hn.) (IMIOamkAMClmn im0OwatAmmlrin&amp;lt;Mdoma (NAX) NmlBRiBiBlng Scared (19M)R'(lhr..50min.)</p>
        <p>reflect on their Heak fulares, and King Richard b ta|pm prisoner by Leopold of AaUria. (Part9ofl2)</p>
        <p>(MCK)NMmlt^ 007MCMh .</p>
        <p>O Nytefi Dorothy L. Sayers Lord Pater hasflr" Harriet b attackedafier she begins investigatli the malicioBs evenb at Shreinlwry College. (Part2f3)g(lhr.)</p>
        <p>0 O Nmrli "Gaadhi (1912) (Part 2 of 2) Bea Ki^tei ^</p>
        <p>dice Bergen. Ridiard Attete-oughs e^ tracta^ the life Nohandas K. Gamfiii, from Us early career as a lawyer through Us demontratkMis of passive resbtance to gain huie-pendence for India.g(2 hrs.)</p>
        <p>0 Chaaif Woody, dressed as Mark Twain for a local production, walks into the bar d captures the heart of a senkir citizen. In stereo, g 0Novli"MbsingInAction2: The Beginning (1985) Chuck Norris, Soon-Teck Oh. An American cohNid, held prisoner by sadbtic Vietnamese captors, makes a bid for freedom for Umself and Us fellow POWs. (2 hrs.)  y</p>
        <p>(iI^ BaUariaa Promicre. Part two d tUs tribafe to the baHerina eaUUed "The Great Tradition.' examines past and present forms d dance with Natalia Makarova. (2 hn.) (BET)VidaoSoal (DB)M0vln PlymoBth Adventure" (1952) (2 krs.)</p>
        <p>(RBO) NavN Laguna Heat (1987) (2 hrs.)</p>
        <p>(UR)P8mify</p>
        <p>(MAX) Navli "Club Paradbe (1986)PG-lS'(lhr.,Nmia.) (TONfThfaafloBB jniC) IfavlB "Oxford Bines' (1984)PG-19'(2his.) (lA)WWP Primo TtatWraa-ttai The UitiaMie Warrlor meeto Rip Oliver and the Bolsheviks take on the Young Stallions in tag team action. (Taped) (2 hrs.)</p>
        <p>9JI0 Nimab Boy In stereo, g qqqQDmpiBmd I INN) New CUadry Featured; UU Monroe. la stereo. lMI08tnliMTUk O Pint lami Man's efforb to reclaim the Mediterranean's environment from poilation's ravages. (Part 4 of 4) g (1 hr.) (DNmri</p>
        <p>01HiliYaUiiliisaparate</p>
        <p>jVNneomMry 11001limlMMilMi</p>
        <p>IDodrnfAo</p>
        <p>DIET MOUNTAIN DEW!</p>
        <p>Qraal Mountain Daw Tanta</p>
        <p>Swaatanad With 100% Nutra Swaat*</p>
        <p>h* Carohaa Country Coail</p>
        <p>TRYIT!</p>
        <p>BOniEO OY PEPSI-I</p>
        <p>O Dodm Who The Armageddon Fbctor^ Armageddon approaches as BOtUng I stand in the way d the darhi</p>
        <p>NuhIows 4d8)</p>
        <p>(SAGbmNAIMr (ABIB) Afeka African naUons re led to war in their stn^ fUr independence. Host Basil Davidsoa(llir.)</p>
        <p>(BR)8altNNm</p>
        <p>0)MMlMAdveBtmeBOfOB-</p>
        <p>MAMimiM</p>
        <p>(HBOl IMillhB NfL Hosts: Len Dawson. Nick BuoniconU. h8tereo.(l hr.)</p>
        <p>~ )WOlfBraadway VAmiSolhini</p>
        <p>Under Fbe (1983)R*(2hn.,10min.) (1NN)YaBGnBaA8lar (D8A)Alrwolf llMiWm NmIi The Music Man (1982) (3 hrs.. ISmin.) 11:810 Baneallie bam OM*A*8^</p>
        <p>(D LMa how Host Arsenio Hail Scheduled: actress Gloria Loring, singer Glint Holmes, comic Dave Dugan. In stereo. (1 hr.)</p>
        <p>0 Tmright haw Host JoUwy Carsoaln stereo. (1 hr.)</p>
        <p>O 9M Emd Kirkwood finds UmMd in danger when a pre-sumerMead South American rebel leader uses Us oM friends newspaper column to announce hb survival. (1 hr., Idmin.) 0N04HBig</p>
        <p>m Mwk "Goodbye Mr. (1989)G'(2hrs..30min.)</p>
        <p>iNaw</p>
        <p>1100BmiiABdAlln 0 N0I Haat Giambooe and OBrien feel angry at having to protect the Ufe d a mohstnr-turned-idormant. (1 hr., 10 min.)</p>
        <p>0AHee</p>
        <p>(ARTS) Lmt Of Thn MoHcmb</p>
        <p>Hb tribe defeated, Magna recaptures Cora and flees with Uncas at his heeb and Hawk-</p>
        <p>eyes parfy doeUg fast beUad. (PartlSdM)  ^</p>
        <p>, ,^firS!nahAndHer</p>
        <p>Sbters(19N)PG-lS(lhr..50</p>
        <p>min.)</p>
        <p>(UR) Dr. RMh haw Guest: comedian Jackie Mason. (1 hr.) (SBOM) Movli "Wbe Guys (19M)R(lhr.,35miD.)</p>
        <p>ItSSiSoStoili Crossroads (19M)Uve(lhr..40min.) lUlOBmlOfGnadM (Si^ik</p>
        <p>0 biB NVA m OmM LstMnMa la stereo. (1 hr.) OLavaniABhM</p>
        <p>Tin Li|mI Of Rohii</p>
        <p>M Friar Tuck and Uttfe John reflect on their bkak fntares, and Wag Richard b taken prisoner Leopdd d Austria. (Part9d 12) ^</p>
        <p>(IBPN) UR Mens Wortd Pro from AqiSB,</p>
        <p>Colo.(</p>
        <p>OtfSilhmtAmYaa? lOfMR llrflO liwU  Hones</p>
        <p>(1985) Kenny Rogers, Pam Dawber.(lhr..20min.) IMeJhckBmay (ARTS) BnUsriaa Premiere. Part two of tUs tribde to the ballerina entitled The Great Tradition, examines past and present forms d dance with Natalia Makarova. (2 hrs.)</p>
        <p>WdgMLomMadilR ~ AadraltM Rdm PM-PreUminary Final (R) (1 br.) _</p>
        <p>I ImMiiml AdvMiy MiiMH</p>
        <p>Nsw Osmrtiy Featured; BiU Monroe. In stereo. (IBA)lliOfNRt 1:190 Mte "High School UB.A. (1883) Mkhaei J. Fox. Nancy McKcoo. (1 hr.. 20 min.) (TIK9llBvlBAtLast,AlLaat (1977)R(I hr.. 59 mill.) lJ90LamlAB9BBrf|y (DIhnSiM 0NIWS</p>
        <p>(Bra919991yPlreBon (WObDinaai (TNN) Mavla Sierra Sue  (1941)(lhr..a9min.)</p>
        <p>(U8A) aaieh Pior Tomflirow 1(BW) Mavla The Mens aub(ll98)R(lhr..50min.) 149(HB0) Mavli Hd Resort" (1985) R'd hr . 35 min.) 14907990*</p>
        <p>ONMMwaldi</p>
        <p>(BR)Evybof|filiteliU-</p>
        <p>Ian</p>
        <p>(DO) Mavla Show Boat (1951) (2 hrs.)</p>
        <p>(BFN)RMiOak (PlwaswTwniToPait 14)</p>
        <p>Congratulations To j Sue Dunn</p>
        <p>Top Salesperson For The Month Of Ootober</p>
        <p>Alcliid^L</p>
        <p>Southcrlatul</p>
        <p>Realtors</p>
        <pb facs="00096780_0133" />
        <p>Friday Evening</p>
        <p>FRIDAY EVENING</p>
        <p>7:00  7:00</p>
        <p>I Remington Steele</p>
        <p>Businessl^. N.Carollmi</p>
        <p>CBSNem</p>
        <p>FamHyTiei</p>
        <p>Jelfersons</p>
        <p>iGood Times</p>
        <p>Wheel</p>
        <p>Evening</p>
        <p>Benson</p>
        <p>LoseOrOrm</p>
        <p>JeofMrdyl</p>
        <p>Aime Of Oreen Gables</p>
        <p>8:00  8:30</p>
        <p>Paper Chase</p>
        <p>Wash. Week WaNSt.Wk</p>
        <p>Beauty And The Beast</p>
        <p>Addan Fam. Andy Griffith</p>
        <p>Disney World Celeb. Circus</p>
        <p>Beauty And The Beast</p>
        <p>FuMHouse MarriedDora</p>
        <p>Anne Of Green Gables</p>
        <p>9:00  9:30</p>
        <p>700 Chib</p>
        <p>10:00  10:30</p>
        <p>Strait^tTalfc</p>
        <p>Purely Gershwin</p>
        <p>Places</p>
        <p>Follow-Up News</p>
        <p>Last Frontier</p>
        <p>Dinosaurs</p>
        <p>Falcon Crest</p>
        <p>Movie: "Police Academy"</p>
        <p>Dallas</p>
        <p>Belvedere Pursuit 20/K</p>
        <p>Falcon Crest</p>
        <p>Movie:'Jtie Boy Who Could Fly"</p>
        <p>SportsCenter [colegeBasketbah: Syracuse vs. Ahrtit-Afll^^</p>
        <p>Inside The NFL</p>
        <p>Family</p>
        <p>Movie: "90 Days"</p>
        <p>"Bad Medicine"</p>
        <p>College Basketbtil: Miami vi Michigan</p>
        <p>Movie: "Back To The Fiilute"</p>
        <p>Lady Blue</p>
        <p>"Peggy Sue Got Married"</p>
        <p>Movie: One-Trick Pony"</p>
        <p>Movie: True Stories"</p>
        <p>Movie: "Stoogemania"</p>
        <p>Comedy</p>
        <p>Super Dave</p>
        <p>Movie fMovie:"DBtectiveSchoolDropoutt" [Movie: "American Ntnja</p>
        <p>Movie: "Eat And Run"</p>
        <p>Brothers</p>
        <p>G.Shandling</p>
        <p>Colege BMketba: Big Apple N.I.T. Semifinal</p>
        <p>College Basketba: Big Apple NJ.T.</p>
        <p>AndyGritllth Sanford  NBA Baskatbalfc Chicago Bulls at DMIas Mavericks</p>
        <p>It's Heroes</p>
        <p>TUI</p>
        <p>_ _  CM Ridianl</p>
        <p>aiib an old friend (Lauren Hutton) and ends up owning a ball team; Lances life is jer^rdized as he tries to bring the real killer tojusUce.g(l hr.) (SNews 020/Mg</p>
        <p>(AR^ Startstniea An award-</p>
        <p>winning comedy Crmiing On; Robin Williams is a crmiedian trying to make a comeback in Just For Laughs." (1 hr.)</p>
        <p>(HBO) Movie Peggy Sue Got Married (198S) PG-13 (1 hr.. 45min.)</p>
        <p>(MAX) Movie Eat And Run (!986)R(lhr.,30min.)</p>
        <p>(Si^ Brotiien Joe closes the bar for a week and the Waters brothers set out for their annual winter vacation to a Mexican resort, g</p>
        <p>(TronCriMk And Chase lOM (WTBS) Hogan's Banes lOMO Last Frimtier Dr. Richard Winterbottom and the team study the reasons behind shark attacks.</p>
        <p>O nalai Diaooanrs This look at how dinosaur bones are found explores how these creatures lived and why they became extinct.</p>
        <p>The Dally Reflector, Qreenvllle, N.C.  Sunday, November 22,1087  T\M1</p>
        <p>rLiheAPWi</p>
        <p> l/LehnrNevahow;</p>
        <p>O0O0NMS (SIhnO'kOQBapaiiv (ARTS) Hondtt W Baaker-vfflas</p>
        <p>m Rkk Nalsoii: A Bnlher</p>
        <p>70 BRamlnilm Steele</p>
        <p>(Un}Xsjr01rian</p>
        <p>) Movie 90 Days (1984) inadsnKeepen</p>
        <p>Bad Medicine" (1085)</p>
        <p>(TTIN)CriNk And Chase (WA)Csstoo MKtns^Alloe 0 (S Voo ClQis Phr OMBftrt ONBCNewsg OCMNews * BABCNewsg</p>
        <p> )Urban8cene</p>
        <p>NICK Rocks: Video Tb</p>
        <p>And</p>
        <p>_ INews</p>
        <p>sssEr</p>
        <p>W ilClliflOOl</p>
        <p>OGood Times 0Rhssl Of Fortune g (ARTQMontnniRoi PT) Faaldoo Fhlr rashkns ) Anne Of Gnen Gables</p>
        <p>9 The NFL (LP^FtoUfy</p>
        <p>(raC0 Ym iMiT Do Hat On</p>
        <p>a,a I a I</p>
        <p>TSievlBlOO</p>
        <p>(TNN)YonGsnBeA8tar (UBA)CeBageBnMathaM 70 (WnB) Andy Griffith 70ONoithGnmina This Week OBvuatag (!)M*A%</p>
        <p>OBsnaon</p>
        <p>OWia, Lose Or Draw</p>
        <p>Basketball World</p>
        <p>Detective School</p>
        <p>S^FtoiS</p>
        <p>70 (WmteidM And Son 70(SHOW) Comedy Club Net-wuifc</p>
        <p>0O Paper CbSM A member of Harts study group secretly obtains a copy of the previous year's midterm exam. (1 hr .)</p>
        <p>0 WaaUafUm Weak b Rmriew</p>
        <p>1 O Beamy And The Beast</p>
        <p>Chandler's investigation of a voodoo-related death leaiM her to a terrifying demon whose vis-ual likeness is similar to that of</p>
        <p>CD Addama Family 0 WaR OtaN^orM OsMrity</p>
        <p>Orela iBUdights indode appearances by Makolm-Jamal Warner and Jim Ernest Varney as well as performances by clown Denis Lactmibe, the Berousek Bears, trapne artist Mark Lots, and the award-winning Winn Troupe daredevils. In stereo. g(l hr.)</p>
        <p>0 Faffl HiMoe Reprise of the series {wemiere. A musician and a comic help a widower raise his three children. (R)g (ARTS) Mnvia he SbooUng Pm^(I984)(2hrs.)</p>
        <p>(BET) This Wash b Bbck Bn-tartabnnait</p>
        <p>(DIS) Anoa (M Graan Gablas</p>
        <p>Aime accidentally ^ her best friend, Diana, drunk at a tea party and therefore causes the letters mother to forbid their friendship. (Part 2 of 4) g (1 hr.) (HBO) Movie Back To The Future (1985)PG(I hrs.)</p>
        <p>(LIFE) Ladv Blue (MAX) Movia True Stories (1988)PG(lhr..J0min.) (NKX) Car M, Whara An Yon? (0OW) Movia Stoogemania (1985)PG(lhr.,30min.) (TNN)NashviOaNow I0(WTBS) NBA BaakmbnD Chicago Bulls at Dallas Mavericks (Uve) (2 hrs., 15min.) l:MO WaU |tnet Waak 'Best Mutual Funds Guest CEO William E. Donoghue, W.E. Do-noghueACo.,Inc. (SAndyGriflHh BIMairladDong (BET) Video LP (NHX)MlaterEd 9007MCInb pPmnlyOanhwta bterviews with family and friends and a performance by Leslie Uggams capture the life and music of George (krshwin. Featured songs include Someone to Watch Over Me and Summertime." William Hurt hosts. (1 hr.. 30 min.)</p>
        <p>0 O Dallas Dandy takes hostages in an effort to keep his drilling rig open; J R. continues to pursue Kimberly Cryder. g (Ihr.)</p>
        <p>(S Ihndar Placas A youngster suffers psychological and emotional problenu when his parents divorce. With Jean Stapleton, Frederick Koehler.</p>
        <p>0 Movia Police Academy" (1984) Steve Guttenberg, Kim Cattrall. When forced to comply with an open admissions poly, a police academy copes with a motley crew of misfits. (Rjjn</p>
        <p>0 Mr. Balvadara Belvedere is moonliiditiag and it begins to adversdy effect his work at the Owenshome, g</p>
        <p>PVHsaSoal</p>
        <p>Movb The Boy Who Could Fly (1988) *PG(2 hrs.) -(UF0 Movb "One-Trick Pony  (1980) (2 hrs.) (NKPMyTbwSoao (TMOMovb American Ninja (1985)11(2 hrs.)</p>
        <p>90d) FoBovf-I^ Ob Far Kids</p>
        <p>BPamttOfBaniiiassg (ESPN) CoOeia Baslwi^ Miami vs. Michigan. Great Alaska Shootout Quarterfinal Game. (Uve) (2 hrs, 30 min.)</p>
        <p>(MAX) Ctaamax Ckmiedy Eiper-taMrt Judge Reinhold and Demi Moore are "suburbanites who invent bixaite methods of dealing with the neighborhoods barking dogs. In stereo, g (Niqn Dobbs Read (SHOW) Sqwr Dave Super Dave Osborne (Bob Einstein) of Bi-urre, joined by guest Ray Charles, brings his death-defying stunts to this new spin-off series. Tonight; the Super Dave Players spoof safe sex. g (Tim) Naur Country Featured: Christmas music from the Judds, Alabama and Ronnie Milsap. b stereo.</p>
        <p>(USA) GoDofa BaakatbaU Big Apple N.I.T., semifinal game. (Uve) (Subject to blackout) (2 hrs.)</p>
        <p>110ORaalBitonStaab OTbaPriaoQer O0O0(BEI}Nawa ODACuiTaBtAflBlr (ARR) Alas Soiith A JOaaa British comedians Mel Smith and Griff Rhys Jones spoof American trends.</p>
        <p>(DM) Mlaaing Adventuns Of Oi-sb And Harrbt After the Nelsons dine away on Thank^iving Day. Oaie misses the left-overs. (LE) Way Off Broadway (NKX)An8olham (SHOW) Movia Invasion U.S.A.(1985)R(2hrs.)</p>
        <p>(TMC) Movb "Joy Of Sex (1984) R(Ihr,45min.) (TNN)YouCanBaAStar 110OM*A*8*H d) Late Show Host: Arsenio Hall. Scheduled: actresses Shari Belafonte-Harper (Hotel). Emma Samms ("Dynasty "), singer Marlon Jackson. In stereo. (1 hr.)</p>
        <p>0 Ttedt Show Host: Johnny Carson. Kheduled: actor-direc-tor David Steinberg. In stereo. (Ihr.)</p>
        <p>OTopOfThaPopa</p>
        <p>dkxisimoA</p>
        <p>Gold rings, chains, charms, mountod coins, pendants, diamonds, earrings, etc.</p>
        <p>Layaway for Christmas</p>
        <p>Corntr Of 10th i Dickinson Sts.</p>
        <p>Wt buy. Mil, trad and maha toan on all typM of lliaarma.</p>
        <p>WE MAKE INSTANT LOANS ON ITEMS OF VALUE</p>
        <p>Woaay</p>
        <p>ooMaaawr</p>
        <p>NwmTSMS</p>
        <p>Man.-niltoa.aaLttol</p>
        <p>MDay</p>
        <p>, Ifa Gany Shaadlbra</p>
        <p>r When Nancy gets amnesia and falb for Garry, he b faMB between helping ho- recover or pursuing a romantic rebtion-ship. In stereo, g (TNN)Vhteocountry iS0(W^ Night TTaeka: Power</p>
        <p> Rodi Included; Kim Wilde and the Beastie Boys. In stereo.</p>
        <p>(BET) Video LP</p>
        <p>(DB)Movte Electric Dreams" (1984) PG(Ihr.,35min.)</p>
        <p>(MAX) Movb "Alieni (1986) R' (2 hrs., 20 min.)</p>
        <p>(NICK)lSpy (TNN)NaahvUbNow (USA) Kenny Everett Video Show Musical guest; B.A. Robinson.</p>
        <p>I1:4S(HB0) Movb Jumpin Jack Flash(1986) R(Ihr..50min.) ll:M(W1BS)Ni|btTTacta Included; Men Without Hats (Pop Goes the World); Jimmy Davb and Junction (Kick the Wall); Terence Trit DArby (If You Let Me Stay). In stereo. (1 hr.)</p>
        <p>lS0OBurBoABdAlbB</p>
        <p>OTopOfThaPO|ia 0 Friday The ISth: The Serbs (ARTS) Movb The Shooting Party (1984) (2 hrs.) (BET)MldBlghtLovo (ESPN) GoDage BaMathall Vil-lanova vs. Nebraska. Maui aas-sic. from Hawaii. (Uve) (2 hrs.) (LIFE) Dr. Rath Smw Guest: orthopedic surgeon / bodybuilder Dr. Lynn Pirie. (1 hr.)</p>
        <p>(USA) Night Flight Night Flight Goes To The Movies &amp;amp; Coming Attractions</p>
        <p>1200Beat Of Gnneho (SKajak</p>
        <p>0 Late Ni^ Wltb David Lattannaa Scheduled; Ron Wood of the Rolling Stones. In stereo. (1 hr.)</p>
        <p>O Movb The World According To Garp (1982) Robin WiUiams. Mary Beth Hurt. (2 hn.. 30 min.) (NKX) Car 66, Whara Are Yob? (USA) Night FUght  Take Off To Sports Features sports film clips and Dire Straits (Walk Of Life).</p>
        <p>12:41 (TMC) Movb Greaser's Palace" (1972) (1 hr., 30 min.)</p>
        <p>120 (WTB8) Night TReka LMOJackBaflBy O Kolchak, The Night Striker</p>
        <p>Kolchak fears that a witch may be briiind a series o murders in the fashion industry. (R) (l hr.. 10 min.)</p>
        <p>(BET)  Monay  Mht-</p>
        <p>teri</p>
        <p>)lflsterBd (SHOW) Movb Warrior Queen'</p>
        <p>(1987) R'(Ihr., 15min.)</p>
        <p>(TNN) New Coatiy Featured: Christmas music from the Judds. Alabama and Ronnie Milsap. testereo.</p>
        <p>(USA) Movie Railroaded </p>
        <p>(1947) (1 hr. 30 min.)</p>
        <p>10(DIS) Dtaaay Channel vbw</p>
        <p>10 0Laurd And Hardy </p>
        <p>3) Movb Botany Bay  (1953)</p>
        <p>Alan Ladd. James Mason. (2</p>
        <p>hrs.)</p>
        <p>O Friday Night Vidaoa In stereo. (Ihr.)</p>
        <p>(DB)Movb Hi. Good Lookin "</p>
        <p>(1944) (Ihr.)</p>
        <p>(NKX) Donna Reed  %</p>
        <p>(TNN) Movb  The Singing HiR</p>
        <p>(1941) (Ihr., 30 min.)</p>
        <p>10(HBO) iBBida The NFL Hoius; len Dawson. Nick Buoniconti In stereo. (Ihr.)</p>
        <p>10(MAX) Movia  Warrior Queen (1987)R (Ihr.. 25 miiLl</p>
        <p>(AR^ Shortiterbo An award-winning comedy "Coming (Jn";</p>
        <p>Robin Williams is a comedian trying to make a comeback in Just For Laii^. (1 hr.)</p>
        <p>(BET)Dbcover  </p>
        <p>(BBPN)8gofteLook (NKK)Lai0b 2:160CNn7^</p>
        <p>2:18 (SHOW) Movb Creator</p>
        <p>(1985)R (Ihr., 50 min.)</p>
        <p>(TMC) Short Film Showcase 2:26 (BET) Slim FOr Ufa (DIS) Movia "Honeymoon Lodge" (1943) (Ihr)</p>
        <p>(NKStjl</p>
        <p>(USA) Night Flight "Regioori</p>
        <p>Rock</p>
        <p>(Please Turn To Page 14)</p>
        <p>Hi</p>
        <p>Talk to your Form Bureau Insurance 24-Hour Agent" about yow</p>
        <p>new car and truck insurancol</p>
        <p>Your Farm Bureau Insurance 24-Hour Agent is ready when you are to discuss insurance for your new car or equipment. He's available with insurwice service when its convenient for you, 24-hours a day.</p>
        <p>The Fann Bwiau Insurance 2AHow AgeM,. roundMock service, for that good feeling of saourlty.</p>
        <p>IMTIfaiMUU</p>
        <p>EES</p>
        <p>FARM _ BUREAU</p>
        <p>402 GratnvilM Blvd. QrMnvill, N.C.</p>
        <p>756-3165</p>
        <p>...for farm Bureau Members</p>
        <p>5BW</p>
        <pb facs="00096780_0134" />
        <p>TV&amp;lt;14 Th*OaRyfMlMlor,OrMfliN,N.C.</p>
        <p>rvniDNi</p>
        <p>EmvlMr</p>
        <p>AkMkat</p>
        <p>tilWgKSCMiWwr</p>
        <p>Sunday. Novemberia,.lW</p>
        <p>fiMY</p>
        <p>(GMtbMNd Fiwi Psfi 7)</p>
        <p>IJKMAZ) IM LadjP CSatter-</p>
        <p>leys Lover"  hr-.</p>
        <p>lJI0LMrlAidllaH|y ITteSrtid , *</p>
        <p>INm IZnZMOthv</p>
        <p>Soundtf" (72) ^=fe(2hrs.) imDiMalMLi.</p>
        <p>- tom HvH* "The Big Siiow"</p>
        <p>' 'fflBAlDlKOMr .</p>
        <p>iSSknr) mmh  of a</p>
        <p>Sdesman  (IMSl (2  20</p>
        <p>ilMIMCM .</p>
        <p>i</p>
        <p>iSpoftAook</p>
        <p>. ^SMlnlnGSb'</p>
        <p>2:11000) MbiH Ttw eoca^la ^IW(105)Ratenill.)</p>
        <p>(TB8) IM Tor Tali Men" fl)(21irs.)</p>
        <p>- IMONI^ralGfe</p>
        <p>(DI1M.IMPII1I</p>
        <p>' CunB)AAir shows.</p>
        <p>ForUlo</p>
        <p>MMkllli</p>
        <p>Yom fcilOMMBealOMlir (ARTS) VietDan: The TnThoa-OMlDayWar ^SoRNqIm</p>
        <p>CoDi|i rOtlMl Holy atViIIaiNiva(R)(2hrs..30 minj^</p>
        <p>was. Detective School Dropouts" (19M) PG (1 hr. 45 min.)</p>
        <p>(OBA)CntalFM</p>
        <p>RIKMAX) Movie "Richard Pryor live On The Sens^ Strip" (1M2) v R" a hr.. 25 milt.)</p>
        <p>r SMOOTS) BatmiB Ihe Wan</p>
        <p> The bombing of Pearl Harbor jROpeb the United States into war. Host EmSevartid.</p>
        <p>MeMeWio Ptaswe Of r(lHl)(2hrs.) Ysmif Por</p>
        <p>Mi(HBO) Mevle Moiittaintop Motel Massacre" (llM) 'Getting ( U hr. 35 min.)</p>
        <p>4MO8t0M]rBirka (UmVMwVlbnttaai ^ qj^bvntmegtAdvlMnr</p>
        <p>aaao IM TI Scarlet Pbnpenier(1235)(2hrs.)</p>
        <p>&amp;gt; K (SHOW) MrtiModa Lisa" UNI) R'd hr . 55 milk) (WlBQCNNNewi</p>
        <p>. lOTQmioiOOWflOw</p>
        <p>THURSDAY</p>
        <p>(CitiMMBFnMBPaflel2)</p>
        <p>(MAX) Mffle aub Paradise" (19t5)PO13(lhr..35iiiin.)</p>
        <p>^^^StoTanane 2JI0li|0wite&amp;gt; (SUIMNPM</p>
        <p>i(MAX)levte"Spiker"(19t5)</p>
        <p>R'd hr.. 55min.) 44S(TMC)MilaTrack Of The</p>
        <p>Cat"d#54)dhr..45min.)</p>
        <p>Unit "Red T(</p>
        <p>"Red Tomahawk"</p>
        <p>20%SitLte''CryPorltop-</p>
        <p>py"(1Ml)(2hn.,15mia.)  &amp;gt;</p>
        <p>3JI0MadhadOMiar (DIHMIIRSfnaM (AMO AMn African natkw .are led to emr in their strag^ for iaiepBdence. Rost Basil Davin4(lhr.)</p>
        <p>WkMW'i Gtada Bone</p>
        <p>(CortiadFiwPl&amp;gt;hB)</p>
        <p>ievie "Easy Rider" lhr.,Mmin.) tTMhi rOnMr</p>
        <p>)AlMSiMII*JaMiBrit. Me) Smith and GMff Rhys Jones spoof Ameri-itrends.</p>
        <p>ISalt Nelli lOdMiPoottdlTeias irTcias AIM</p>
        <p>(R) (S bn.. 30</p>
        <p>&amp;gt;I%gF</p>
        <p>(fllQlMl "American Jns&amp;gt; tke"(lNi)R'(lhr..45miii.) SiKHBO^IMe "Night Patrol" dOM) R'd hr.. 30min.)</p>
        <p>(BBOW) Movie "Girls School Screamen" (IMS) R (1 hr., 30 min.)</p>
        <p>kSO(EffN) Aaorkaa</p>
        <p>CMobu Cometiy Bi&amp;gt; pirtPMd Veteran comedians Shecky Greene, Corbett Monica and Jan Mmray on life in the fanny busineas. Host; Garry Marshall. In stereo. 1-OOeaiOMyBehi (BBf)VMooVIhratloM (DIB) Movie "nymouth Adventure" (1M2) (2 hrs.)</p>
        <p>(UHD kveetmem Advieecy OaaQMev) "Cyrano De Bergerac "(1950) (2 hn.)</p>
        <p>4:10(liAX) Movie The Patriot' (lsi^'Rdhr..50min.) 4J0(BSPN) Tmek And IWd Sbanwock Games, from Worcester, Mass. (R)</p>
        <p>(VBMIhBwmtm^ltiMM i-49(niQlM The Quinns" (1977)(lhr..l5min.) i-M(WTBB)CNNNem</p>
        <p>Head Of Doble Gillis</p>
        <p>Dwayne Hickman and Bob Denver will Mar tat Kring Me the Head of Doble cmUs." a CBS movie scheduled to air neit spring on CBS. The pair are re-creating their roles from the (dd s^es The Many Loves of Dobie Gillis. which aired on CBS from 19S9 to IMS. Hick-man plays a grown-up Gillis, and Denver playa the still-lackadaisical Maynard 6. Krebs.</p>
        <p>If Saving Money On Your Next Cor Or Truck Does Not nterest You...Then Do Not Shop</p>
        <p>JIM _</p>
        <p>SMITH</p>
        <p>Hwy. '''4 8y-Pass, Farmville 1 800-523-700f.  753-3122</p>
        <p>dN7)'G'(3hrs.)</p>
        <p>4:U(1D0) Movii Pever Pitch (1915) R'd hr..45min.) 4#(BBA)ragHn)0t Take Off To Sports" Features sports film clips and Dire Straits fWalk Of life").</p>
        <p>0Wl8M*</p>
        <p>(nR)Mivlt"Tei"d982)PG ' tki..45mia)</p>
        <p>4M(MAX) CkMmai OMMfr Bi-irtMM J4p Rmshold and Demi Moore m "suburbanHcs who invent bixarre methods of dedtng with the neighborhoods barking dogs. In Wereo. p (VTBMNghtTncka</p>
        <p>HEIDBCIDQ SKHDQCkl BDaDDB EIDOE] GDQ QDE2 QQDDE! QQQB OIQO) QQCin G mm</p>
        <p>BdBilD SQBdQQQ  06 SB S!2EI DGBSSS odoa SSDB SQ SddD aQS EDddS OdSdd dSD Em (SflSQd aOBdOdd SD DdddBOS</p>
        <p>ftil Widtat M# Br ils</p>
        <p>IVsKINiMyFNsMls</p>
        <p>Mevle Railroaded" (1947)</p>
        <p>IJiqttZ) Movie "True Stories"</p>
        <p>Ml</p>
        <p>Ml</p>
        <p>Ml</p>
        <p>Ml</p>
        <p>PrmcriklBg BdtMus*</p>
        <p>I "Americm fm^a" dMDRd hr..45miii.) 1)11^ PB0I Take Off To &amp;gt; jKlotiMn" Artists mclude:</p>
        <p>Amrnica"); Plain Wkite Rappen CUbe^Rap').</p>
        <p>*a0b M&amp;gt;Y)e "A Bed Apnrd9M)Rdhr..S5iiiin.)</p>
        <p>&amp;gt;  Movis Crack b The</p>
        <p> Wortd (1995) Daaa Andrews. jmtteScott.(2lin..30miii.) (AiriB) Momnsi Reek bclwi-cd; Ktan Wilde and the Beaslie Bins, b stereo.</p>
        <p>(DEQ Movte The Gnome-Mo-bile"d9&amp;lt;7)G'dlir..9eniin.) dHA) Kmoj Bwratt VMao</p>
        <p>Mow Musical guest; B.A. Robin-</p>
        <p>fcM(Wn8)N^TYaeks MIlBBMBayiiiki</p>
        <p>L  .  _  .A*----</p>
        <p>I VWiD VWf lUOBi I SfWIIMI MfBOVy</p>
        <p>} Moris "Cbeers For Miss^ Bisbop"d941)(2brs.)</p>
        <p>(DBA) Ni0t FBlkt Night Fngbt Goes To The Movies 4 Coming Attractions mam MovM Camelot"</p>
        <p>I a I</p>
        <p>mcD _MsA8*8 ||M.ritmB0srt JbnFlMifMt</p>
        <p>"The Sterile</p>
        <p>1Mb WMd YovDissw</p>
        <p>IMA</p>
        <p>mm---^ *----*  Wfc-</p>
        <p>wKKKnmKfimm</p>
        <p>igf"-.</p>
        <p>- iIimm.</p>
        <p>)YldisWhrattaM IDickPlisM</p>
        <p>"Rascals And Robbers: The Secret Advemma Of TomSawyer And Hock nnn"</p>
        <p>nbWiflMs jGNNNnn</p>
        <p>Ml</p>
        <p>SlittlsibaeikAMFriindi (MiaptfM</p>
        <p>IBBbWmB</p>
        <p>iSAVMaoaiile ^ NICK Bockic VMm To</p>
        <p>Morio The Impearible rears" (1911)</p>
        <p>SlS^LmlhoLbm</p>
        <p>7M0&amp;lt;Wraaerab</p>
        <p>OGBD</p>
        <p>fbfBoDew</p>
        <p>(SNoMhM</p>
        <p>ABM^.r</p>
        <p>OBMLoon</p>
        <p>iCMYooBilhhHNrr</p>
        <p>"Critttd9M)</p>
        <p>cm at</p>
        <p>rHoiookOonMr</p>
        <p>ITnnlWWHOT</p>
        <p>n MNb The Rouse Of tSwmsHairtW(!959) l)BMMi Gmdnir )SiMi&amp;gt;irimii</p>
        <p>Qeographie</p>
        <p>IBoW</p>
        <p>(nPN)PlNridaVldi1holJi-</p>
        <p>wril</p>
        <p>(MAX) Morio Start The Revo-latioaWitlMnrtMe"(1970)</p>
        <p>)fltiaMMr</p>
        <p>rS^</p>
        <p>LMAadlM DudtPNOMb IU0 Bnt Of BID</p>
        <p>oStPwriMlHHihRo-</p>
        <p>lIMfKLometAnlBaidy</p>
        <p>74I(8B(0V) Movit Dra-foadaycr"(1991) 7Jia0voYo8kb (W)rttoOMnt(IOQ ejMk&amp;gt; Any Tria</p>
        <p>(SVWgMriM</p>
        <p>WiMMj wooononr</p>
        <p>SONdta GlJea</p>
        <p>DWtaAtBtae^ )Y&amp;lt;oAadm,tM ) ImistflMM Advloofy SOMOfOMlNl lO 0 frimii Ou Vtarim</p>
        <p>OM Crino (R)p Mri (SnmAniJrify 0 PMiii Advririmm Of Tho Qinilnina O BHb wit* mjr Mt</p>
        <p>0AlvbAM1loGM|BsMi</p>
        <p>MBiaiqhirikMiq</p>
        <p>ettreBaaisFamtiyp  (BBOW)</p>
        <p>S</p>
        <p>UM0]</p>
        <p>AkFriNT blholUlowi AMvRofMg VMMWoleh BodBmBwo.</p>
        <p>Movb "Untamed"</p>
        <p>KEOAMfENKtMM ti a Tanj Smu?</p>
        <p>*Ncw Facility Available *Can Accommodate 10*100 People Thirteen Break*out Rooms Available Refreshments and Meals Prepared Very Reasonable Rates</p>
        <p>)LA.Jw ,ifVOYwadi</p>
        <p>IlNb "(bilivWs Drav-Mo ..</p>
        <p>(BBC) Morio "Poe-wne&amp;gt; Hg Adymrig^</p>
        <p>)SSi</p>
        <p>1M "Boort Of tin Wa-Mkmcwb.-</p>
        <p>SSISSrfVMVUn*'</p>
        <p>lUM</p>
        <p>sssgsar*^-</p>
        <p>. foinn iMBHif</p>
        <p>BhMBgiiiMgrlBfws</p>
        <p>IbMlilhollMoeo^</p>
        <p>DM 0 '</p>
        <p>UMnwytAntalndie-</p>
        <p>~</p>
        <p>(D&amp;lt;3tBM4yBov</p>
        <p>A</p>
        <p>eURbWMl</p>
        <p>~jJrinyTsAdvnbri</p>
        <p>IMtAMIbeiorPUD iThiNPi</p>
        <p>_ b Big Trouble In IMChb8(19t^ g^i|jr^AM1hiSB</p>
        <p>am fmWrnkh OriMry</p>
        <p>Of</p>
        <p>08tar8MMk</p>
        <p>(AIM) Morio "Tho Shooting</p>
        <p>*(HW)</p>
        <p>)VM10 Mount Morio "Oxford Bhies"</p>
        <p>Yn Crib Do not On</p>
        <p>am Morio Donth Of A SalMmao(19l5)</p>
        <p>riJSA i"GodiUtaVsTlie Set Homier" (1M7)</p>
        <p>iMir</p>
        <p>laCriiMitrirwwti</p>
        <p>IAbMIM</p>
        <p>Mad-</p>
        <p>diM) httlbilt NICX BtekK VMm To</p>
        <p>Morio. King Sriomons (IMS)</p>
        <p>AirimiNMkvfflo</p>
        <p>sss</p>
        <p>PMchbAdiai</p>
        <p>Of</p>
        <p> QftabFonrAnilhoj dMsOtniPMm</p>
        <p>0 Mwb "The Anrityville Horror(1979)</p>
        <p>(00 Morio The Gang's AH Hero (1943)</p>
        <p>noiDWrim WHNr</p>
        <p>IriMkhAdlrii lbs ItriNOriBliisllgl</p>
        <p>MoritlOughtToBeb "(1912)</p>
        <p>(IbiuI fltehm LsooYhrirWi Bshbv-</p>
        <p>lOffcn^msfW</p>
        <p>JteBfMBsDMialtock</p>
        <p>fWriewKMsp</p>
        <p>)OrikpBmB</p>
        <p>)Xsy^Bri j Morio "The Prafamkw-ab"(l9N)</p>
        <p>(PboaoTmToPOfiSI)</p>
        <p>SACHS Chain Saws</p>
        <p>DOLMAR</p>
        <p>as low as</p>
        <p>179</p>
        <p>Selos, Parts and Bttrioo</p>
        <p>iSTAirs aoE cann, inc.</p>
        <p>aiOWMlOfMavlltoBlmi QfftnvHto. N.C. 7S7-0S92</p>
        <pb facs="00096780_0135" />
        <p>pmSrnBsasam^aet^fsmss</p>
        <p>rSATDRDAY SlNINQ</p>
        <p>Saturday Evening</p>
        <p>m</p>
        <p>7:00</p>
        <p>bmim%</p>
        <p>MhlAiMrlca</p>
        <p>Cmlna</p>
        <p>TwdOM Ftt^TlN</p>
        <p>cu a</p>
        <p>El</p>
        <p>a</p>
        <p>I_</p>
        <p>dESHaasa</p>
        <p>n</p>
        <p>7:30</p>
        <p>SoHQoidlnCanovt</p>
        <p>8:00  8:30  9:00  9:30</p>
        <p>lioiteThyWwThat4^WyAmiTiMl-iM^</p>
        <p>CouMuOdyiMy</p>
        <p>Bayond2000</p>
        <p>Ml*</p>
        <p>FictlOflll</p>
        <p>ULPraiidani</p>
        <p>227</p>
        <p>BMWBMar</p>
        <p>GoMnGMi</p>
        <p>Saa Chinee</p>
        <p>IlMli; "OggmOiiWlrtMirtirlnThweAde"</p>
        <p>SMrTnk</p>
        <p>UMlKThiHMMSchoor</p>
        <p>Ohn</p>
        <p>10:00  10:30</p>
        <p>PwChaM</p>
        <p>AudkiCllyLMIt</p>
        <p>WMtSTIh</p>
        <p>WMSTIh</p>
        <p>HOM</p>
        <p>Modft'*ynliaeOooiliOMdf</p>
        <p>FMM jColagBftcttdlTiwelebienHOMiceJ</p>
        <p>rnoridiSlnili''</p>
        <p>hopDtfonPaeSc"</p>
        <p>|"DriiondR!ir'</p>
        <p>&amp;amp;MM Ugrtolmi</p>
        <p>MiTta ia&amp;gt;*iiaSny</p>
        <p>MrORBraeSNy</p>
        <p>I Our Group</p>
        <p>UtoiK'HHT^oablilBUMIiChlna"</p>
        <p>Movie: ChHrmOIAUiMr God</p>
        <p>ItodicTopGm"</p>
        <p>Mie Hammer</p>
        <p>IULmI ffOnB</p>
        <p>"WMidDiadOrAlM'</p>
        <p>WHdRaoordiAI-Slan</p>
        <p>M&amp;lt;wlKiqno8olcmoBaliiei"</p>
        <p>HNchcock aBradbuiy  CdageBediaibal: Big Apple aiT.Rnd</p>
        <p>MovIk</p>
        <p>PortmiOIAmirice</p>
        <p>**Ain't That a Shame and more. Taped at the Universal Amphitheater in Los Angeles. In stereo. (1 hr.)</p>
        <p>(IBA) OoilafB BiMdl Big</p>
        <p>Appir N.LT., final game (Live) (Subject to Uackoot) (2 hrs., SO min.)</p>
        <p>MBS) Saeasd Ctaaet Charles saves Chas from a potentially dangeros tenting acddnt In stereo.</p>
        <p> Abm (Part 2 of 2) In stereo.</p>
        <p>1st t fK Gate fte</p>
        <p>Billy Cooper s^ the</p>
        <p>girifriend of a n^ whls; Dr. Death'giveh a rival team lessons on dirty football; Jake's Place becomes Jethros. bstcreo.Q (MlhiOeite mikmmi  A</p>
        <p>of Barts study group secretly obtain a copy of the i</p>
        <p>weiteteWtes</p>
        <p>(SOtenAMd</p>
        <p>ffi)il!ul5rate</p>
        <p>iDO^MteMAAvoteniOfO</p>
        <p>BiAilMet</p>
        <p>(HBO) Mnla IHorida Straits (IMf)</p>
        <p>(MAS Mote "Operation Pacific (1151</p>
        <p>AadTteSuu</p>
        <p>(nW) Mute "Dragonslayer  (IMl)</p>
        <p>(1MN) Rkky Nebon And Fate</p>
        <p>Ml(WTaB</p>
        <p>WorU Champtetep</p>
        <p>JieBnoM</p>
        <p>( Threes Coo^Muiy IpCNuwi</p>
        <p>MPGoBeratloiis rIteudPlkka ritek )9aHTftn8kmcm 7MCnptiil)i OBBdAmerte Nmn</p>
        <p>(DTOo don Par Comfort BsuBnr 08olldGoldbOow9irt 0 WWF aupantes of Wroo-</p>
        <p>OoUen Age Of TUbvt-</p>
        <p>olon</p>
        <p>fflR)IoytTo8Meeoe (DB) Itote ' The Haunted School (IBM)</p>
        <p>M K: for Kldi By</p>
        <p>(monote'Top Gun(1986) mOouteylttteu</p>
        <p>mm ~</p>
        <p>mmkkrikmrn aiiM,llldoridOfi gCteltelUteiuy (SBteQrllii (AWaAtecbte DBIUtei</p>
        <p>EBnoOoiteiFMban NnQMI^Boin TNN) IMS Weak b Ooteqr kite</p>
        <p>BM0 Mete Hiey Went Tkat-A-Way And That-A-Way (1B7I) Tim Conway, Chuck McCann. Two bopdessly inqA PoUcemen are sent to prto to conduct an undercover search for a ca^e ofaMmmoiHp.din.)'' ' aOouteouOdtef e O Mote "Agatha Christies Murder In lliree Acts  (IBM) Peter U^inov, Tony Curtis. Acapulco serves as a backibop for murder as ace detective Hercide Poirot investigates the poisoning (d a minister at a retired actor's palatial estate. (R) g(2hrs.)</p>
        <p>GD Mr. Pnoident The frustra-Uons of pubUc life force the first lady to leave Sam. (Part 1 of 2) b stereo. (R)</p>
        <p> FUte^Of Ltfo Blair is stunned when her law-cho(d study partner falls for Beverly Ann. b stereo.  eSteTtefclloNoitOaaart-ttai Riker becomes the major pbyer in a deadly game masterminded by the dangerous and pow^ul Oentity. g(l hr.) WoridWtfl</p>
        <p>Cohen^ eiperienee n an bradi apy Inside S^jte. Abo starrbg QlWilbeh.p(lhr.,Nmiii.) inSMokmtewn</p>
        <p>Unto "Big TrouUe b (IBM)PG-IS(2</p>
        <p>MABMiuI Jttte China</p>
        <p>(ARfBlUiU (BEI)VMio1 (TOtamoikHnflpy.</p>
        <p>C'Misitel portrays Elie COhen b this docudrama based on</p>
        <p>r John Shea</p>
        <p>omestead Funeral Home</p>
        <p>Tour Cbotor for Qunlfy Ssrvfce</p>
        <p>Atebbb *1,790.00* 20-Gauge Steel</p>
        <p>Select from uMfor ufacturere iadudian Ban Several etylM ud colon to dMoee trau. IB-UusDfotectlueetoelcMliotaud</p>
        <p>ceaplele rimeral Sendee.....................$1.BB0.00*</p>
        <p>1H.  Sm BM kMliU* cMke  MMN.</p>
        <p>830*0648  Gwenvtlle</p>
        <p>aSmSXm</p>
        <p>Lai^h</p>
        <p>Xbildren Of A God(lBM)R(2hn) Gnad Ob Opiy Lte</p>
        <p> u- g^,</p>
        <p>BwCgCOCK</p>
        <p>BBB(WnB) Mate Night Pas-iage(ll57)(2l.) iteg) JipHiitei</p>
        <p>Meg has left Sam, her sister (MadeUue Kahn) becomes the chUdrens governess and Sams hostess for sUte functions. (Part 2 of 2) b stereo (R)</p>
        <p>0 227 b stereo, g</p>
        <p>(ARTS) Batwuea The Wan An examination &amp;lt;A the emergence of Communist Russia. Host; ErkSevateid.</p>
        <p>(UFg) A Gift To Laat An embittered dd man, touched by his grandsons gift, shares with the boy hii memories of delights and disappointments on a Christinas Day nearly BB years</p>
        <p>iScSqMbteld</p>
        <p>iIWIOGniMObOpiyLivu</p>
        <p>1 DBA) Ray Bndbury Thaate An</p>
        <p>eccentric film (ttrector tells a young writer a spine-tinglbg ghost story that comes true. Peter OToole stars.</p>
        <p>1:41(1X8) Dhney Chanaal Pra-vter</p>
        <p>BABO Bepond 2BBB Topics include: a computerized railway b Lille, Franor, Deep Rover, a million-dolbr acrylic divbg dome; a diagnostic bone scaaner,(l hr.)</p>
        <p>(D New Advetena (X Baani Baite When Scooter u accused ol sdlbg drugs, Beans seb out to clear his name, b stereo, g GaHnGlrbb stereo, g gOhma In stereo. g(l hr.)</p>
        <p>BMi Of ^ Worid Premiere A three-part doca-mentory Uuit spans the globe (or an eumbatioo of hirtb. First, the penguins, puffins and ke-fishbg birds of the Arctic and Antarctic. (1 hr.)</p>
        <p>(DO) Mote Yankee Doodle Dmidy (1B42) 'bgraphy (2 hrs.. Smb.)</p>
        <p>IMTlhoaaSete</p>
        <p>"Kbg Sotomoos PO^</p>
        <p>r(lMB)'PG-ll(2hrs.) (TNN) Rkhy Nteii Ate FUb DoteM b this IMS concert, the two etertainas perform Gar-</p>
        <p>m.</p>
        <p>ltte(WTBQ Fortratt (X America Ohio" HighUghto of this state include the Smacker's factory, the Wright-Patterson Air Force Bas^ academic bstitutions and sports teams. Narrator Hal Holbiookdhr.) lBJB(Uno Oar Group Featmed: aa ex-police officer te difficulty wHh hb feeUagi aboat hb</p>
        <p>O Bbkte T Both anarmed, Gnataaster Blake and Travb come face to face b a maxe of taaaeb. (1 hr.)</p>
        <p>years midtenn eiam. ( hr.) e Aatei Oty Uteb TNggta Up Bones and "IBM ue performed by Randy Travb; Kathy Mattea sbgsTlalk the Way the Wind Blows and "Do Yon M Your Fields. b stereo. (R) (1 hr.)</p>
        <p>QWWITIh</p>
        <p>QDNeav</p>
        <p>0 Haate Saspiciom are aroused whea a Bel Air bouse-wib bafts at ideotifybg the man who stote her milliOfHtof br neckbce. b stereo. (1 hr.)</p>
        <p>0 How Chrbtine receives a marriage proposal from a presidential candidate who b an aa-sassbsUrgetg(lhr.) (ARTnUbAteUmaOfAlha DovQ Ruth takes her revenge at the expense of her husband and hb lover. (Part 4 iX 4)(1 hr.) (Bn) OoDip FoothaD Howard atDebwaieState(R)(Shrs.) (BBO) SpaMbg Onr-Tteon Gf Ftaoiait Tte humaroaa aad pintea of bqptag a house accordbg to comedian Spalding Gray. In stereo, g (1 hr.)</p>
        <p>(MAX) Movte Wanted Dead Or AUve(IB87)R(l hr., SO min.)</p>
        <p>iLd Ibeote AB-Stea; Fran lte Boy LolUpop TO The Joohai lte Tbe^tbh record company celebrates ib 2Sth anniversary with a retro-qiective of rodi 'n' roll, including artbts Steve Winwood, Robert Palmer and U2. b stereo. (1</p>
        <p>- (TNN) Coooiry Xitchen Featured; Rudy Gatlin prepares chicken enchilada casserole, b stereo.</p>
        <p>12te0YoMgAndi 0aLQW:GorgioaiItebiO( WiuoIBh</p>
        <p>(ARn^oridWarl</p>
        <p>Grand Ob Opcy live</p>
        <p>(SBTbI.</p>
        <p>(ARffl) Gate IhM Cte Fea-tarte; Bob Sarbtte; Teresa Th-dareCitySection. (BH^OalkBiKtettaD Northern lUbob at Nevada-Las (Uve) (Iks.)</p>
        <p>(HBO) Mate One Crazy Saro-roer(IBM)'PG(lk.,SSinb.)</p>
        <p> Lo^Bkm</p>
        <p>Mad Movte WHh Tha</p>
        <p>roer (I</p>
        <p>(nOW) Mote "Haidbodies 2 (IBM)'Rd hr.. 30 mb.)</p>
        <p>(IMQ Mote Rmaway Trab (IBM)R(2 hrs.)</p>
        <p>ILM(DI8) Cetktn Bowl B7 Teams; Geocgb Tech vi Uai-verbty of Califorab, Irvine, b stereo.</p>
        <p>(WIBM ra^ Tteki: Chartbaa-</p>
        <p>Iiai0tarls8tetey 0ABCNteig llJI0ZataLtet 0 NWA Chaapbaririp Wte-</p>
        <p>GDFHdoyThil2(h:Tha8octe</p>
        <p>08otateyNlihflMataBvaBt</p>
        <p>b stereo. (1 hr.. M mb.)</p>
        <p>0 Gaocfi Sehbttkh Ooaaedy GWb Scheduled: Tommy Blaze. Chrb Rock, John Twomey, Lob Bromfbld, Carl Wolfson, Raspy-ni Brothers, Chrb Verweil. (ARTS) GoUba Ago Of TObvi-tei DeFOrest Kel% stars as an attorney who helps hb client beat a rap b 333 Montgomery. Written and produced by Gene Roddenberry, the creator of Star Trek.</p>
        <p>(DBA) Migk Video Profile: Fbher And Preackman  Artbb bdude: Suicidal Tendencies (lutitntionalixed");</p>
        <p>Fteh Cyb); The Rttnones ("Somethiiu To Believe la).</p>
        <p>0 Mote The Great Trab Robbery (1B7B) Sean Connery. Donald Sntherbad. (2 hn.) g) Movb "Jinxed! (1BI2) Bette Midler. Km Wahl. (2 hrs.) (ARTS) Boftmi Tho Wars An ezambbiOB of the emergence (X Coonmmst Rossb. Hob; EricSeviffid.</p>
        <p>WtedTiaaonnw Mote 'Mnrphys Uw (lSM)*R(lhr..45inb) (IMN)GmiObOpryUvo (UBA) M|ht F^ Video Flashtracb Artbto include: the Bodeans: Red Hot Chili Peppers; tts Immaterial. UJICBBO) Movb Last Resort" (lBM)*R'(lhr..SOmb.) llteOIWA ChamploasUp</p>
        <p>iSmSh Love Your Bkb</p>
        <p>! Nadines upset about her widowed mother's plans to remarry. Guest WUUeiyier.</p>
        <p>(ARTS) BM Of The World A three-part documentary that spans the globe for an examina tkm of birds. First, the penguins, puffins and ice-fbbng birds of the ArcMc and Antarctic. (1 br.) (DO) Movb The Gang's AU Here(lB43)(2hrs.)</p>
        <p>Thb Wiak b Coantry</p>
        <p>(USA) Night FUght Take Off To Comedy VIII" Comedians include. Billy Crystal (You Look Marvelous"); Jackie Mason, Emo Phillips (Downer's Groove"). llte(DIS) Mote Sounder" (1B72) 'G()hr,2Smb.) ILttOSoalTtea ll.-N(MAX) Mote At Gose Range" (1986) R'(2 bn.)</p>
        <p>(TMC) Mote-She's Gotu I It(1886)'R'(2hn.)</p>
        <p>(INN) Movb Heart Of The Rockies(lBSl)(lhr.,30inb.) (USA) Movb ' Ricochef' (1962) (1 hr.. 30 mb.) lte (WTB^Wght Tracks IteeblteeAaAMwar? 0Nawi (BET)VldooLP</p>
        <p>lte (MAX) Movb Black Moon Ruing" (1986) R'd hr . 45 mb.) BteOJowtahVobo (ARTS) Life Ate Lovoi Of A She</p>
        <p>DovO Ruth takes her revenge at the expense of her husband and hb lover. (Part 4 of 4) (1 hr.) (BBT) Video Soul (ES^SportaCentar</p>
        <p>Why worry about medical e)(penses?</p>
        <p>IM/EtnaCare!</p>
        <p>^"aCie sar jVjaw</p>
        <p>*oiti a.' ol 0W3 M exfirses # Wi/ex, ttil togcf'neajti iMr s fglK br ytx- Anu g^ves .C. leatjie, d.y3 lo save you &amp;lt;rone&amp;gt; ano I ytt. Sleep a rvgiM</p>
        <p> unkmMMatmebeneM</p>
        <p> ln(ydKOunl</p>
        <p> ndeiangeoKMucBUn</p>
        <p> opkoMlbwwltitoraiXiadnwbMy</p>
        <p> andmoro</p>
        <p>CMusMayiasenaifteanacrieacajpon) to earn ^ ^MaCaie can cake ffie Mooy Our or you meote*'e*oem</p>
        <p>MUIiiMMtaM*wayCompwy</p>
        <p>Mao.a</p>
        <p>ra. I MM to fnd oU how AMCm Mm W yuony 4 of nwucu NnMi</p>
        <p>Hooker &amp;amp; BachaMB. inc. 509 Evnna Street</p>
        <p>N.C 27834</p>
        <p>nx;</p>
        <p>BeGU</p>
        <p>niuMr</p>
        <p>Xlu'</p>
        <p>David L. Harrell</p>
        <p>Hooker &amp;amp; Buchanan, Inc.</p>
        <p>lB8rancc*&amp;gt;</p>
        <p>SOBEvaeaSlieet Douvatoeni Greuevllb 751-4184</p>
        <pb facs="00096780_0136" />
        <p>TV&amp;gt;ie  TU* Dally ltallfetor,QrMiwM^N.C.</p>
        <p>Sunday. NwawSf aa, iM7</p>
        <p>Sports This Week</p>
        <p>SUNDVSSPQIIR</p>
        <p>H0VBMBBRII.1N7</p>
        <p>ftHODdkiPMIdl</p>
        <p>tMSDIekSMte</p>
        <p>immnACarn</p>
        <p>UJIO NPL Un NFL pregame show hosted hy Bob Costas, with , Ahmad Rashad. Paul Maguire i and Prank Deford.</p>
        <p>IIMO NPl PoMteD Pittsburgh j Steelers at Cincinnati Ben^ ! (Live)(3hrs.)</p>
        <p> 4MO NFL PoQtttO New York ! Gianu at New Orteans Saints (Live) (3 hrs.)</p>
        <p>IB NPL FootbaO Denver Bron-im at Los Aisles Raiders</p>
        <p>t</p>
        <p>' DaasSBiWi</p>
        <p>rauRSDAirsiFOim</p>
        <p>N0VDIBBRII1IIT</p>
        <p>IMIB WL Uve NFL iwegame showlwslcd by Bob Costas, with Ahmad Raskad, Paul Maguire and Frank DefonL. tkllB NPL PtattMl Kansas City Chiefs at Detroit Lions (Uve)^his.,SOmln.)</p>
        <p>SJIB NPL Todqr NFL pregame show hosted by Brent Mas-burger with Irv Cross and Jimmy The Greek Sn^. i-MB NPL Poolball MinnesoU Vikings at Dallas Cowboys (Live) (3 hrs.) PMDAYVSPOiin NOVDffiraST.lMT</p>
        <p>SMB OoOili P'oMMB Aubnm vs. Alabama, from Birmin^iam, Ala. (Uve) (3 hrs., SO min.)</p>
        <p>SATimOATSSPQBm</p>
        <p>novimbbrii,int</p>
        <p>gcMBMbmMnn</p>
        <p>UMB OoDiia nMWI Teams to be ammnced. (Uve) (3 hrs., SOmin.)</p>
        <p>MIB FBA BrnrihM USO.MO Budweber Opea (Taped) (1 hr., SOmin.)</p>
        <p>IJIB OoOl|i Poolball Teams</p>
        <p>to be annoimced. (Uve) (3 hrs., SOmia)</p>
        <p>a SkMs On Golf Lee Trevino, Arnold Pabnn-, Jack Nick-laus and Fussy Zoelter cmnpete, from PGA West in La Quinta, Calif. (Uve)(2 hrs., 30 min.) 11:11 B8pli8idW llB NWA ChampioMhlp IMn</p>
        <p>B taMp Niibt^ Mata Bvwd</p>
        <p>In stereo. (1 hr., SOmia)</p>
        <p>It*s A Week Of Football And More Football</p>
        <p>By Marty Uoalian</p>
        <p>' Thanksgiving is coining up, and what would Thanksgiving be without football? Without that handy excuse to pop (nit of the dining area the minute the meal is over and the cleanup is about to begin - jit to see how the games going?</p>
        <p>After all, you would like to see how Tony Dorsett is playing, wouldn't you? And just happens to be showing the Min-nesota Vikings taking on Dor-setts Dallas Cowboys on Thanksgiving, Nov. 26. Minnesota should give Dallas, which has fallen on hard times, real fits, but the Cowboys have tend-ed to play well on Thanksgiving when theyre at home. .</p>
        <p>' * Over on NBC, meanwhile, the Detroit Lions will be hosting the Kansas City Chiefs. Like the Cowboys, the Lions have en-joynl a real borne advantage on past Thanksgiviiigs. but it probably will take a lot more than |that to help the Uons this year.Alabama Battles Auburn Friday</p>
        <p>FRIDAY, NOV. 17 ; College FootbaU (CBS) Alabama at AuIniiii. One oftbebestofthetraditk-jal college rivalries. If Bama can shut down Auburn QB Jeff Burger, the No. 3 passer in the nation, then BUI Curry wUl be forgiven almost about anything in Tide country.</p>
        <p>SATURDAY, NOV. 28 CoUege FootbaU (ESPN)</p>
        <p>I California vs. Washing- ton sute in the Coca-Cbla , Bowl, live fnm Tokyo, Ja-F ^pan. You think we were i fhaking this one up? Just because these are two of the lesser Ugbts of the Pac-^ 10? Just because the Bears * were 1-5-1 and the Cougars 3-4 at press time? Not calculated to give the Japanese a favorable impression of American college football, we woiUdsay.*^</p>
        <p>* Casual fans who are planning to use footbaU to duck the cleanup deUil on Thanksgiving had best sUrt warming up on Sunday, Nov. 22  just to get everyone used to the fact Uiat theres a rabid football fan in Uie house. Both CBS and NBC are presenting a full complement of regional games on Sunday afternoon. And if you have cable, you can top six-plus hours of afternoon viewing off with ESPNs Sunday-evening offering; the Miami Dol|diis vs. the Dallas Cowboys. And anyone who can sit Uirough all that deserves to be excused from cleanup duty!</p>
        <p>* On Friday, Nov. 27, the college boys take over with Alabama at Auburn, a hot re^onal rivalry in which Alabama usually has come out on U. On Saturday, Nov. 28, ESPN pre</p>
        <p>sets a not-so-hot rivalry, California vs. Washington State, which is of interest mdy because it is being played in Tokyo Tokyo in Japan) and has been dubbed the 0x;a-Cola Bowl. There will undoubtedly be better matchups on both CBS and ABC, but the networks, as usual, are playing their cards close to the vest.</p>
        <p> And. yes! The is something besides football, if you look hard enough. Professi(al basketball has gotten underway, and Tuesday, Nov. 24, on T^ fam can catch the Detroit Pistons at the Houston Rockets. No, its not the Lakers vs. the Celtics, but you have to start somewhere. In this case, were starting from the middle. Both teams look reasonably good, but neither is expected to bean NBA standout.SATUROAY</p>
        <p>(GontiBiMd Fioa Page 14)</p>
        <p>(raOQMMrle Snow Treasure (1367)</p>
        <p>gV^Rkky Nakoo And PMi</p>
        <p>(MAD MOV "Hookytonk Man</p>
        <p>(USA) Met "Motel Hell (1380) (WTBI) Mae "Acron The Pacific (1042)</p>
        <p>3J0(HB0) MOV One Oaay Summer (1186)</p>
        <p>&amp;amp;</p>
        <p>(SBDW) MOV Young And Free(1373)</p>
        <p>(TMC)IMe "Mariowe" (1363) 34IBBIiVallw BPhOMMMll</p>
        <p>(Mov DickTraCT'(13S7)</p>
        <p>BOMMplbotbaU^(AmAelor</p>
        <p>(BR)LovoYowr8MD</p>
        <p>(DM) MOV "Child Of Glate"</p>
        <p>(1378)</p>
        <p>(UPDLMIrBlno (TNN)CoHOtryKltdMn 3:30 a PhMMOMMl World BOBGoOofoPbolball OSktao Gama Golf</p>
        <p>Yon (kit Do That Ou</p>
        <p>MHOW) Mov "Straage Invaden (1382)</p>
        <p>(INN) MOV Heart Of The Rockies (1351)</p>
        <p>(U8A)GM(aN (WTBDBomm 4:3lOAknHie</p>
        <p>)OHiYeiBo1htaMrT IMov "The Point (1371) ^Mr.WharflWorM Mov "Young Sherlock Holmes" (1385)</p>
        <p>346 B Wagon Tridn BWOodwrighFiShop (i)flBDWond fflBnLovnYonrakta (UPD Mov Auntie Marne"</p>
        <p>(BR)MaMttrtm (TNN)</p>
        <p>11 Weak In Countiy (DSOnr</p>
        <p>(1358)</p>
        <p>(lOCDMonkn (USA) Chock It Ouli (Wm Andy Griffith 5dOB1U Old Boon</p>
        <p>440BLnndo OVtetaryGardon (BBT) Love Your Skin (iSPN)CoifoPootball (HBO) Mov To Sir With Uve" (1367)</p>
        <p>(UPD Jack And MHttS</p>
        <p>MyMeriom Cltn Of</p>
        <p>) Wrap Around Naahvll SandesOfBolAlr BevirlyBillhtlliaa .</p>
        <p>Iiry-T'  -</p>
        <p>Between now and December 31, you can consider yourself lucky to own a diesel cor.</p>
        <p>Because olt you need do is show us proof of diesel ownership (no matter what the moke) and we'll take $4,000 off the purchose price of onyj^ Beugeot 505 gasoline model From the powerful Turbo sedon Of wi^ to the refined S TXV6.</p>
        <p>So bnng us your diesel proof of ownership and be KOOO closer to owning o hi^-performonce Peugeot</p>
        <p>PEUGEOT 505</p>
        <p>NOTHING ELSE FEELS LIKE IT.</p>
        <p>*$4,000 contribution consitii o(53.000from PMA ond SIjKXI from riw Dtdivr. **0liwry must bv tokw by Ovcembvr31.1987. Offm good whi lo suppliw lost, ond is not oxtvndid in con|unction with any otbor promoiionai oHir. Not ndoMiobio for codk Void Art prohibHod. Soo usior conditions of Hit oHir. *19W FlNSNt Motors of Amorico, bK.JOE CIILLIPHER34011. MmwfW Orhn, OfMovNto, NX. TStXIM</p>
        <pb facs="00096780_0137" />
        <p>Newspaper Advertising Supplement Sunday, November 22,1987</p>
        <p>buBt OUP%f</p>
        <p>l-DOZEN 8UPEIIBRAND GRADE *A* WHITE MEDIUM</p>
        <p>EGGS</p>
        <p>PllM,</p>
        <p>1-LB. PKG./ INQTRS.</p>
        <p>LEND 0' SUNSHINE BUTTER</p>
        <p>Instant Cash, Coupon Savings, plus WIN up to $1,000!</p>
        <p>Ybu caa be an instant winner as soon as you open your game card</p>
        <p>NEW GAME EVERY WEEK NEW WINNERS EVERY WEEK</p>
        <p>cm</p>
        <p>n^r Wheel of Pmrtttne evenings Monday through Friday on these stations:</p>
        <p>TIMB (MON-FRI)</p>
        <p>Play right along with the evening Wheel of Fortune TV game show telecast at 7:00 or 7:30 P.M. (Mon. thru Fri.)</p>
        <p>Now for the first time, you can win at home, not just watch.</p>
        <p>MSTANTCASHI</p>
        <p>Evny ttaiK you open your game card, you can bean InsUnt cash</p>
        <p>COUPON SAMNQSI Most</p>
        <p>game cards contain a valuable coupon providing savings on the brands and products yousfant most.</p>
        <p>8TATK&amp;gt;N</p>
        <p>Durham</p>
        <p>Richmond</p>
        <p>WDBJ.TV</p>
        <p>WTVD-TV</p>
        <p>WCTI.TV</p>
        <p>WXEX-TV</p>
        <p>7iOO&amp;gt;7!30PM 7i30dPM 7dX&amp;gt;7i30FM 7t00'7s30 PM</p>
        <p>America's favorite game show. If any puzzle solution on your game card exactly matches a puule solution appearing on a WHEEL OFFORTUNE evening TV show telecast at 7KX&amp;gt;or 7:30 P.M. Monday through Friday you win the amount indicated on your game card...</p>
        <p>IMPORTANT! ;</p>
        <p>All winning puzzle solutions will be posted each morning for the previous Monday throu|h Friday^hows. Potential winning cards may only be verified after die winning solutions are posted. Instant winners may be veriRw at any time.</p>
        <p> PICK UP YOUR FREE TICKET TODAY</p>
        <p> NO PURCHASE NECESSARY</p>
        <p> ADULTS ONLY</p>
        <p>MERV GRIFFINS WHEEL OF FORTUNE - PROGRAM WD-19S OOOS CHART</p>
        <p>USM</p>
        <p>mn-</p>
        <p>NUMISOI</p>
        <p>VMKS</p>
        <p>UKIW</p>
        <p>OWSIOM</p>
        <p>Vll</p>
        <p>USIOM</p>
        <p>V8IR</p>
        <p>w</p>
        <p>turn</p>
        <p>1</p>
        <p>u rs f01</p>
        <p>IN 101</p>
        <p>{I3T0I</p>
        <p>ttao</p>
        <p>IIIKIOI</p>
        <p>1441 to 1</p>
        <p>IWTOI</p>
        <p>tts</p>
        <p>ntn</p>
        <p>tUIOI</p>
        <p>47T0I</p>
        <p>mot</p>
        <p>u</p>
        <p>nm</p>
        <p>WIOi</p>
        <p>4} 101</p>
        <p>11 lot</p>
        <p>loiu</p>
        <p>luin,</p>
        <p>nt 101</p>
        <p>MOI</p>
        <p>tSICI</p>
        <p>W;)VGWIMSMll(|f fOHIUW MOCMMtM IKHM6Vl*iOSIMI SIOMSMINISUIISOiGilWM WSIHCNIOIW tOUlN</p>
        <p>itsmutMMTi jMMMvn a.____</p>
        <p>tots GWII OStmiO IV MWH6 * S</p>
        <p>UMMTMS ??0IfMlGI(MVUM WUV</p>
        <p>You don't have to watch Wheel of Fortune to win!</p>
        <p>It's more fun if you watch, but if you don't | or if you miss a show, simply check your game card against the winners' poster each Saturday!</p>
        <p>I *</p>
        <p> %</p>
        <p>A</p>
        <p>MANUFACTURERS of</p>
        <p>sponsoring our exdting 'WlwEL RTNE-' II</p>
        <p>are</p>
        <p>FOR</p>
        <p>ucts</p>
        <p>OF Look for</p>
        <p>tbeir coupons or adi on ''WHEEL OF PORTUOT^ pme caidtiSEE STORE FOR COMPLETE GAME RULES</p>
        <pb facs="00096780_0138" />
        <p>wiwtSipai</p>
        <p>Americas Supermarket</p>
        <p>T.M.</p>
        <p>V000</p>
        <p>iPNmCES</p>
        <p>PRICES GOOD THRU MED., NOVEMRER 25TH!</p>
        <p>NONE TO DEALERS *WE RESERVE THE , RIGHT TO LIMIT QUANTITIES COPYRIGHT 1987.</p>
        <p>Have your Thanksgiving Pictures and Share Them, Too!</p>
        <p>2nd Set of</p>
        <p>Color Prints FREE</p>
        <p>Rtctlvt two prints Irom sssry nsgtUvs. 0ns tst to</p>
        <p>kssp,onsssttoslMrt.</p>
        <p>The 2nd set is absolutely free! Its our thanks to you.</p>
        <p>Oftorgoetfen110,l2S,</p>
        <p>WMNtSDOOE</p>
        <p>America's Supeimafkel</p>
        <p>Fisherman's Wharf</p>
        <p>8-OZ. BTL. UQUIO</p>
        <p>PEPTO-</p>
        <p>BISMOL</p>
        <p>10Q.CT. BTL.</p>
        <p>ADVIL</p>
        <p>CAPLETS</p>
        <p>OR</p>
        <p>TABLETS</p>
        <p>HEADLESS PINK</p>
        <p>MEDIUM SHRIMP</p>
        <p>1-PT. JAR STANDARD</p>
        <p>SELECT</p>
        <p>OYSTERS</p>
        <p>SO W. UfCNIN Ml SlOOl M. $f.ff</p>
        <p>1/1V4-LB. CHIX SIXE</p>
        <p>LIUS LODSTSRS</p>
        <p>j|99 5</p>
        <p>AVAIUUNJI IN LOCATIONS tMITN nSHBRMAirS WHARF</p>
        <p>MNMMaJSBHttSlSSSSBiSSiMM. N</p>
        <pb facs="00096780_0139" />
        <p>Relax, And Let A Winn-Dixie Deli Cook Your Thanksgiving Dinner...</p>
        <p>FflffSN BAKED 2402. 8IIB</p>
        <p>PUMPKIM OR APPLE PIES</p>
        <p>SIZE OLD FA8HIONEO</p>
        <p>CHOCOUTE</p>
        <p>CAKES</p>
        <p>COMPLETE BAKED TUKKEV DIMMER:</p>
        <p>YOUNG HEN TURKEY (11/12-LB. RAW WEIGHT)</p>
        <p>a^LBS. CORN BREAD DRESSING 1-LB. TURKEY CAVY 2-DOZ. DINNER ROLLS 24-OE. PUMPKIN OR APPLE PIE</p>
        <p>FOR</p>
        <p>COMPLETE RAKED TURKEY RREAST DIMMER:</p>
        <p>WHOLE BAKED TURKEY BREAST 1-LB. TURKEY GRAVY D02. DINNER ROLLS 24-OZ. PUMPKIN OR</p>
        <p>apple pie</p>
        <p>2-LBS. CORNBREAD DRESSING</p>
        <p>19</p>
        <p>COMPLETE RAKED HAM DIMMER:</p>
        <p>BAKED VIRCUNIA HAM</p>
        <p>(3V&amp;gt;LBS.)</p>
        <p>2-LBS. SOUTHERN STYLE POTATO SALAD 2-DOZ. DINNER ROLLS 24-OZ. PUMPKIN OR APPLE PIE</p>
        <p>19</p>
        <p>.PAK JMMBO</p>
        <p>KAISER ROLLS</p>
        <p>EA.</p>
        <p>599</p>
        <p>PLACE YOUR ORDERS NOW! AVAILABLE IN DEU BAKERY STORES ONLY</p>
        <p>74BS. TOTAL WEIGHT</p>
        <p>ROUDAV PARTY TRAY TURKEY-RAM-CHEESE</p>
        <p>1-LB. SUCED TURKEY 1V.LB. SUCED HAM 1.LB. VIRGINIA BAKED HAM 1-LB. AMERICAN CHEESE 1-LB. SWISS CHEESE &amp;gt;^-LB. CHEDDAR CHEESE BAU 1-LB. RIPE OLIVES</p>
        <p>34</p>
        <p>Variety...! We've got it!</p>
        <p>KMBS. B UP SWIFT BUTTERBAU</p>
        <p>TURKEYS  LB..SS</p>
        <p>FIWSH CUT</p>
        <p>turkey RREASTS LB. 1.30 ,</p>
        <p>AVe. W-D BRAND</p>
        <p>PAKIMDNSNSl.. lb..00</p>
        <p>4-LB. SIZE SWIFT HOSTESS</p>
        <p>CAMHSO HAMS . IA.O.SO</p>
        <p>)-LB. ROLL W-D BRAND WHOLE HOG</p>
        <p>P(MR fJlTfftfff</p>
        <p>MAINSON</p>
        <p>TURKEY NAM..</p>
        <p>CURE 81 BONEUSS</p>
        <p>DUPPET RAMS .</p>
        <p>iir-O BRAND PORK SNUEHII talmadgeor</p>
        <p>BMITHPIELO WmOLE</p>
        <p>COUMTRYHAMS lb. 1.90</p>
        <p>1/S4UCED HICKORY MOUNTAIN</p>
        <p>eOUMTRYRAMS lb.E.00</p>
        <p>A. 1.40 LB. 1.40</p>
        <p>LB. 1.40</p>
        <p>WHOLE OR SHANK PORTION</p>
        <p>SMOKED RAMS, u.1.30</p>
        <p>W-O BRAND SELECT LEAN BOSTON BUTT</p>
        <p>PORK ROASTS., lb.1.20</p>
        <p>COUNTRY PRIDE^ '</p>
        <p>GIZZARDS  LB..4S</p>
        <p>W-D BRAND U.8. CHOICE</p>
        <p>UGOPLANW... lb.E.70</p>
        <p>W-O BRAND U.8. CHOICE</p>
        <p>LAMB SMOULDER ROASTS........ LB.  1.40</p>
        <p>1-LB. CUP PALMETTO FARM</p>
        <p>PIMENTDCMEESE. 1.40</p>
        <p>12-OZ. CUP STANDARD</p>
        <p>OYSTERS .......4.00</p>
        <p>W-D BRAND</p>
        <p>SMOKED</p>
        <p>SAUSAGE  LB. 1.09</p>
        <p>HAMILTON'S E-Z CARVE SMOKED</p>
        <p>HAM PORTIONS, lb.2.40</p>
        <p>Quality</p>
        <p>Prime Rib at Home!</p>
        <p>Suy At Home Eat Out~ You don't have to put  wiwdtAww</p>
        <p>I at a Atic</p>
        <p>110 cnioy daUciMfrFlllMe MB!</p>
        <p>&amp;amp;4ktandtcfaaiirW-0Bi^A^ re Rib Rom for a daloctaMc PRIME an that the fitiwt mtaiirani would cavrl</p>
        <p>And right niow they're on tale M an tmbeotablc bw</p>
        <p>W-D BRAND SELECT LEAN FRESH PORK HAMS OR</p>
        <p>U)IN END PORK ROAST</p>
        <pb facs="00096780_0140" />
        <p>WMN</p>
        <p>^ v-f-i</p>
        <p>With over</p>
        <p>Americas Supermarket</p>
        <p>26-OZ. BOX</p>
        <p>MRS. SMITH'S PIES</p>
        <p>PUMPKIN'MINCE</p>
        <p>|99</p>
        <p>6V3 OZ. SIZE CROWLEY</p>
        <p>WNIPPED TOPPING . .99</p>
        <p>8 0Z. CUP BIRDS EYE</p>
        <p>COOL WHIP TOPPING</p>
        <p>8-OZ. CUP LA CREME</p>
        <p>IMNIPPED TOPPING 1.07</p>
        <p>12-OZ. CAN FROZEN 100% PURE FLORIDA MINUTE MAID</p>
        <p>ORANGE JUICE</p>
        <p>.regular*country style</p>
        <p>f15</p>
        <p>64 0Z. CARTON REG.. COUNTRY STYLE OR CALCIUM FORTIFIED 100% PURE FLORIDA MINUTE MAID</p>
        <p>ORANGE JUICE  1.29</p>
        <p>Nvtv N</p>
        <p>10 OZ. BOX FROZEN</p>
        <p>GREEN GIANT VEGETABLES</p>
        <p>BROCCOLI w/CHEESE CAULIFLOWER w/CHEESE</p>
        <p>|14</p>
        <p>/ ........\</p>
        <p>_p^5| Carrot</p>
        <p>.. . ^ Banana</p>
        <p>Bhiebary</p>
        <p>wm</p>
        <p>wTnoi(mt&amp;gt;</p>
        <p>seri*TufonMi/</p>
        <p>i^SSuHi^</p>
        <p>gHIMSSLW*gffllBA</p>
        <p>I</p>
        <p>PUKl 100% ^ VALLINCI/V</p>
        <p>,  ORANC.K</p>
        <p>IIIICF</p>
        <p>12-OZ. CAN rodZEN 100% PURE FLORIDA</p>
        <p>FLORIDAGOLD ORANGE JUICE</p>
        <p>11%-OZ.BOX&amp;lt;</p>
        <p>THE BUDGET GOURMET DINNERS</p>
        <p>AUVAmmES</p>
        <pb facs="00096780_0141" />
        <p>MARGARINE</p>
        <p>Special on Hasbro Ibys with savings</p>
        <p>firbmKRArr.</p>
        <p>1-LB. PKG./IN QTRS.</p>
        <p>PARKAY</p>
        <p>MARGARINE</p>
        <p>Va GAL. JUG 100% PURE FLORIDA</p>
        <p>KRAFT ORANGE JUICE ^</p>
        <p>12-OZ. SIZE KRAFT MILD OR MEDIUM</p>
        <p>CHEDDAR</p>
        <p>CHEESE</p>
        <p>1-LS. size harvest MOON MILDCNEESE .... 2.52</p>
        <p>5 0Z. JAR KRAFT</p>
        <p>CHEESE</p>
        <p>SPREAD</p>
        <p>OLD INQLISH BACOIIHPINIAPPU OUVI MMINTO MMNTO</p>
        <p>O</p>
        <p>o</p>
        <p>O</p>
        <p>o</p>
        <p> 5_3</p>
        <p>6-OZ. PKG. KRAFT</p>
        <p>SLICED</p>
        <p>SWISS</p>
        <p>CHEESE</p>
        <p>Us in store.</p>
        <p>/OPilsburys</p>
        <p>V 7. DUCT.  </p>
        <p>4-OZ.SIZE</p>
        <p>KRAFT</p>
        <p>SHmDOEO</p>
        <p>MOZZARBLLAOR</p>
        <p>SHARP</p>
        <p>CHEDDAR</p>
        <p>CHEESE</p>
        <pb facs="00096780_0142" />
        <p>by</p>
        <p>DAKIN</p>
        <p>Americas ^ipermarket</p>
        <p>With Over</p>
        <p>KMMK)</p>
        <p>BEAR^</p>
        <p>Everybody loves 'eoil</p>
        <p>All Stores will be CLO^D on THANKSGIVING D^Y, Thursday Nov 26th!</p>
        <p>he's</p>
        <p>yOMfS</p>
        <p>fot*</p>
        <p>qqqBI^DDDI</p>
        <p>Get more than one.,.^ everyone in the fandly A will want his own^</p>
        <p>when ytnir iHirihuM* hilat. 25 in u sifiKk* &amp;lt;lny</p>
        <p>M9.99</p>
        <p>without</p>
        <p>purchase</p>
        <p>^20" taU, fluffy tan fur with red bow tie.</p>
        <p>Maiii</p>
        <p>Strands! Rings! Earrings! Enhancers! Many Styles! See Our Display Now!</p>
        <p>An Achievement In Perfection...</p>
        <p>Simulated peark that replicate the incredible lustre, color, and weight of nature's rarest and most expensive pearls. Strands are handknotted; all jewelry pieces are handcrafted^ earrings are hypoallergenic.</p>
        <p>ir Strand 18" Strand 24" Strand 30" Strand</p>
        <p>$499</p>
        <p>$599</p>
        <p>5799</p>
        <p>Ring$, Earrings, Enhancers</p>
        <p>|99</p>
        <p>each plus ta\ with $10 in register tapes. Also Special Promotional Prices \sitliout tapes.</p>
        <p>Buy At Substantial Savings</p>
        <p>Regular Retail $25 - $75</p>
        <p>NOW from</p>
        <p>$499. $099</p>
        <p>^T each plus tax</p>
        <p>udth $10.00 in register tapes. Also Special Promotion Prices without tapes.</p>
        <p>Available at*</p>
        <p>Americas SupermarkBtTJi.</p>
        <p>The best brands at the best prices ever.</p>
        <p>WINN-DIXIEs JUfMMBHCM BEST BRANDS S4LE!</p>
        <p>14-01. ME</p>
        <p>COMiT</p>
        <p>CLIAMSm</p>
        <p>&amp;gt;)LL-&amp;gt;1MERICAN BEST BRANDS .. SALE * * *</p>
        <p>40 OTE/aa-OE. EOK MOUlAROIIUMGEMnD</p>
        <p>THU</p>
        <p>DErmeiNT</p>
        <p>MXT.OOX</p>
        <p>OINICI PANIC SOPTIHIR SNIETS</p>
        <p>MACAN RBOIIUUI OR MmCR</p>
        <p>CRISCO</p>
        <p>SRORTiMIMG</p>
        <p>-01.IOX</p>
        <p>SPIC ARD SPAN POIMOIR</p>
        <p>1SOCT.R0X</p>
        <p>PRFPS w/LOTION FACIAL TISSRIS</p>
        <p>II* 0EP-4N0U RAN</p>
        <p>WRITi CLOUR RATRROORimSVI</p>
        <p>iMMvaiara</p>
        <p>Mo-n.Mw.</p>
        <p>U</p>
        <p>1EOX.ROX</p>
        <p>DUNCAR RINIS CARI MIXIS</p>
        <p>I____</p>
        <p>LRVS OISPOSRRU OIAPIRS</p>
        <p>MT. nma umafaaet. UMM 4CT. Iium ii ct mmu</p>
        <p>0* Off LAML/1Mlt.m. HOIMAI.'OILV '</p>
        <p>RIAR A SRORLHRS SRARIPOO</p>
        <p>14</p>
        <p>0-OX.ROX</p>
        <p>CASCADE</p>
        <p>AVTORIATIC</p>
        <p>DISHWASRIRG</p>
        <p>nmnam</p>
        <p>iBcmr</p>
        <p>mil;</p>
        <p>OX. JAR</p>
        <p>POLGIRS IRSTANT COPPII</p>
        <p>01. OECArrilNATIO a.tf</p>
        <p>RATNME</p>
        <p>IIST</p>
        <p>DEODORANT</p>
        <p>SOAP</p>
        <p>l-Ot.RTt.</p>
        <p>HORMAL/ONV</p>
        <p>PNSLL</p>
        <p>SNAMPOO</p>
        <p>/</p>
        <p>aaox, RTi.</p>
        <p>SCOPE</p>
        <p>MOIITHASN</p>
        <p>444. Him CNIST TOOTNPASTI</p>
        <p>1JM4. ROiMNI MMMMn RfllMT OR HRO. RGNHr</p>
        <p>aicalf</p>
        <p>maaaw  iat</p>
        <p>IJE-Of BUaiR.OOMrflR &amp;gt; ROWOM OQINV WORCr AMTIJMNNNHNNIIV</p>
        <p>aaaaaaat ..... a9</p>
        <p>1JM. CAN tMWn MMn. RM. OR HMMNMIPRAV MCRIT</p>
        <pb facs="00096780_0143" />
        <p>\U-'-"' 'f- y-^V- -^4:- *.  . r..</p>
        <p>|,f'-  '-^|j||g||g|Mi||y|^</p>
        <p>  '\  :^f</p>
        <p>&amp;gt;s</p>
        <p>Xj'</p>
        <p>Sale starts Sim., Nov. 22; ends Tuesday, Nov. 24^ unless otherwise specified.</p>
        <p>3UN.</p>
        <p>MON.</p>
        <p>tOes;</p>
        <p>items at reduced puces</p>
        <p>.- *,</p>
        <p>?</p>
        <p>#i&amp;gt;K-  J</p>
        <p>fe-,"..  ;!#  ri</p>
        <p>.THH</p>
        <p>* V^</p>
        <p>$2.8ai</p>
        <p>' Y,</p>
        <p>i</p>
        <p>tamitM Alt^r) keep^fOU iff *;ionnMi(iiQr</p>
        <p>|lina' - * ij5</p>
        <p>'29%</p>
        <p>Jflf tittIIINf</p>
        <p>SAVE on aportyMAyiio to \rewi irt HdlNl WiJh</p>
        <p>r-' "ifc^jtflioTttBiwr^</p>
        <p>,t .A</p>
        <p>J..'*i yi i ..</p>
        <p>Entire stock of NEW FALL SWEATERS for misses In a colorful array of styles and fabrics</p>
        <p>Nows the time to stock up on Christmas presents and SAVE 20%! Choose from out entire stock  Shakers, Shetlands, polos and morel __</p>
        <p>Ed "j</p>
        <p>1^'</p>
        <p>'s&amp;amp;</p>
        <p>1--</p>
        <p> K'</p>
        <p>r.</p>
        <p>20% OFF</p>
        <p>Entke slock of nriatospants</p>
        <p>Just in time for the hoday season! Choose from dress and casual pants at stock-up prices. Hurry in while the selections are best. In misses sizes.</p>
        <p>THRU TUESDAY</p>
        <p>mmMomsS'</p>
        <p>MMMkti ,C (NwtNwodM</p>
        <p>OMlQii,CahinMi.l . viie, gi*mw, rwiw, m ^VWmmoion iwiWiiiiHniklHf^r -v</p>
        <p>fi&amp;amp;'Sffi</p>
        <p>RUilidr|MBAr</p>
        <p>m&amp;lt;x</p>
        <p>fSgfsimm</p>
        <p>iimssmasrnmimmmrmspi' mm m kmmiM in om fliiwMBn M ana  tM whMkiM tor etM)</p>
        <p>at aatownr to not lnotoHl In aaaing ^</p>
        <p>20% OFF</p>
        <p>Entke stock of misses shirts</p>
        <p>Dress them up or dress them down, now you can find wardrobe pleasing shirts at fantastic savings! Our entire stock of misses shirts are reduced 20%!  -^  ,</p>
        <p>THRU TUESDAY</p>
        <p>m-i.</p>
        <p>4Q2 11/22/97</p>
        <pb facs="00096780_0144" />
        <p>1</p>
        <p>i/-'</p>
        <p>"',  i ra.:i.</p>
        <p>w :  :  f-iHyiEf</p>
        <p>, -</p>
        <p>SAVE 25f^</p>
        <p>Entire stodr of Levis* leans for boys sizes 4-7 ana 8-20</p>
        <p>SAVE RS m</p>
        <p>Oaklon Ltd. Flexslaxlormm</p>
        <p>"</p>
        <p>Hurry in and SAVE BIG on famous Levis* jeans for boys during Sears 3 Day SALE!</p>
        <p>Stretch-woven slacks move when you do for maximum comfort. Stretch-elastic Ban-Rol* waistband for neat appearance. Perma-Prest* slacks are polyester.</p>
        <p>fi-</p>
        <p>Oakton Ltd. sportshlrts for men</p>
        <p>Shirts with premium tailoring feature -  ^ ^ spread or button-down collars. Of polyester and cotton in solids and patterns. Sizes S, M. L, XL.</p>
        <p>SAVE 25%</p>
        <p>Entire stock of Lee* leans for</p>
        <p>7-14</p>
        <p>girls sizes 4-6x and</p>
        <p>Hurry In and stock-up on famous Lee* jeans for girls In an array of styles and colors sure to plesM.</p>
        <p>SAVE *25 to ?30</p>
        <p>Mens Classic Collection blazer</p>
        <p>Now enjoy the freedom of stretch comfort without sacrificing rtyle. In easy-care polyester In^^soWs and stripes. F^. $80-$85.</p>
        <p>$30 Matching slacklngs . .10.90</p>
        <p>$</p>
        <p>55</p>
        <p>.  t.-</p>
        <p>25% OFF .</p>
        <p>EnSn tloek of. tops for 0Mt</p>
        <p>Just in time for Christmas gift givingl Our entire stock of to^ are now reduced 28%. Choose from long sleeve styles in 's variety of solids and prints for fan.</p>
        <p>Sizes 4-ex and 7-14</p>
        <p>25% OFF</p>
        <p>Entirw itock of</p>
        <p>chUdm'$</p>
        <p>gnwslMpen</p>
        <p>From basic sieepwear to Sears Best Winnie-the-Pooh growsleepers--theyre all on sale now thru Tuesdayl In Infants and toddlers sizes. ^</p>
        <p>. -</p>
        <p>SAVEV</p>
        <p>Men'$ iMXunUi^ drnsBhtrts</p>
        <p>\</p>
        <p>Lengdeeve</p>
        <p>gant satln-stripe look tons-on-tone patterns. In solid colors.</p>
        <p>)  $16  Short sleeves. .9.00</p>
        <p>SAVE 20%</p>
        <p>Entire stock of mens dress shoes In oxford and sllp^ styfes</p>
        <p>Nows the tineld i^te'your dress shoes and SAVE 20%l Choose  our huge selection of styles and cotors</p>
        <p>for men.</p>
        <p>30% OFF</p>
        <p>ntfro afodlr of wmiom-Miylo boot$ for mmi j</p>
        <p>From plain to fanoy-weve ^ got them all reduced 30%t</p>
        <p>20/%0ff</p>
        <p>emmtHook of young foshfofi CMuafa for isomeo</p>
        <p>Choose from sWp-ons and oxfords in a variety of stylse and colors.</p>
        <p>eWMOlMMyPmiuaHm</p>
        <p>$AVE*lonS$tir$BM mon'o dm$ oek9</p>
        <p>Orion*, cotton jjee</p>
        <p>and nylon socks _ with Saul Guard* teg. la w plus Cushion Dri.</p>
        <p>SAVE20%on Met In gnnt oohro</p>
        <p>Great selection of colors and pat</p>
        <p>terns In polyester mg. iiuo and silk. &amp;lt; .    ii  t</p>
        <p>u</p>
        <p>P</p>
        <p>20%</p>
        <p>intIro titock of dm nd eamtnl $hoo for big boy SAVE 20% now thru Tuesday on our entire stock ot dreoa andoaaualatorbova.^</p>
        <p>ffdlrorifooli lorMApMri</p>
        <p>Chooed from our wide se</p>
        <p>ep</p>
        <p>Isdlloh o( dress and casual</p>
        <pb facs="00096780_0145" />
        <p>ICuthion and InstaHaUon lar* Mtra. Carpet ia not avrilabla tn AaNami, Con-loord, Qaatoma. Qiaaiwtla, IHIgh Point, Rock Hitl,</p>
        <p>I OAa^llMa a  rm</p>
        <p>ffwny wiQ vinMMnion.50% OFF Super fusH Carpet</p>
        <p>Full 10-yr.warranty-the best in the indus* f JtQQ try (see store for details). Deep xlense * nylon pile has a smooth surface texture, f40% OFF Good Times TWist</p>
        <p>Dense 32-oz. premium nylon twist the ul-timate functional carpet texture.</p>
        <p>Scotchguard.</p>
        <p>HS:</p>
        <p>Rag. $19.99 aq.yd.</p>
        <p>SPECIAL PURCHASE</p>
        <p>Dynasty accent rug</p>
        <p>199</p>
        <p>2x44t.</p>
        <p>wnaoQuanliliaaUal</p>
        <p>Choose from several styles in attractive colors to highlight almost any decor.</p>
        <p>4x6-ft.</p>
        <p>5x8-ft......</p>
        <p>7x11-ft.....</p>
        <p>iO-50% OFF</p>
        <p>Ready-made draperies</p>
        <p>AN home taahlona are not available in Aahland, SbebyandWMIamaon.</p>
        <p>30% OFF Regal antique satin draperies</p>
        <p>$79.99 72x84-in.................55.99  0709</p>
        <p>$99.99 96x84-ln.................69.99</p>
        <p>^ Rig- $89.99</p>
        <p>30-50% OFF Living Home dn</p>
        <p>$49.99 72x84-in.................34.99</p>
        <p>$59.99 96x84-in.................41.99</p>
        <p>M:</p>
        <p>Kg</p>
        <p>-'if</p>
        <p>&amp;gt;. r  :</p>
        <p>'Jiv</p>
        <p>LaSalle wedgre sofa PLUS one-arm queen size sieepr sectional6d9^</p>
        <p>Reg. $1299.99</p>
        <p>Unique blend of cotton, olefin and polyester makes this a durable upholstery. Lush, contemporary style.</p>
        <p>rEntire stock of flannel sheets In prints arl solids \</p>
        <p>799  f99</p>
        <p>TWin size, prints ^ M Twin size, solids Reg. $10.99  Rag. $9.99</p>
        <p>Choose from a variety of styles and flannel fabric blends.</p>
        <p>$11.99 Full size flannel sheets solids........  .9.99</p>
        <p>$16.99 Queen size flannel sheets, flat or fitted solids, 12.99</p>
        <p>60 OFF</p>
        <p>Ihpc. premium cookware set</p>
        <p>Reg. $149.99</p>
        <p>Aluminum-clad stainless steel cookware set.</p>
        <p>Cookware It not available In Aahland. Danville. Qaatonia. Qreen-vie. gh POM. Shelby</p>
        <p>*280**450 OFF Supnm aeta</p>
        <p>$349.99 FuU Size, ea. pc.........199J9</p>
        <p>$799.99 Queen set.............449.99</p>
        <p>$999.99 Khg set... ?..   549J9  w.</p>
        <p>*360 to ^650 OFf Elegance Ultra sets</p>
        <p>$429.99Fuisize,etpc.........249.99  iy%99</p>
        <p>$1099.99Queenset.^...........549J9  f / Jf</p>
        <p>$1399.99 King set.  ....... 749  J9</p>
        <p>Spindrift panelt</p>
        <p>* ^</p>
        <p>O Reg. $7.90.48K844n.</p>
        <p>/ Lovely semi-sheer panels.</p>
        <p>Deconltmtnmmrod</p>
        <p>Q99</p>
        <p>9nag.</p>
        <p>7 Rag. $14.90</p>
        <p>Extends 28 to 48-in.</p>
        <p>$89.90 48 to B44n. eiwiaian&amp;gt;w. .ISfl</p>
        <p>TTmmrwrod</p>
        <p>3-iMqr wallhugeer</p>
        <p>t Rea $6.00</p>
        <p>Extends 28 to 4$-in.</p>
        <p>$12.00Twwateerod. 49](04-ln....9J0</p>
        <p>3m</p>
        <p>^Rtg. 9MM</p>
        <p>triple Soft redlner, olefin velvet.</p>
        <p>50% OFF</p>
        <p>SAVE 100</p>
        <p>AdjmUdif deal rod 2-way rodlimr</p>
        <p>79J.</p>
        <p>7Rag.$1.80</p>
        <p>Extends from 28-in. 484n.</p>
        <p>im</p>
        <p>to</p>
        <p>^Rag.$890$0</p>
        <p>Plush 100% nylon velvet fabric. Richmond.</p>
        <p>SAVE yso</p>
        <p>armwrry nocntmr</p>
        <p>249S</p>
        <p>'Rag. $300.00</p>
        <p>Choose from a variety of colors.</p>
        <p>Oakmont Suprama chair</p>
        <p>100% DuPont Dacron* po^ater.</p>
        <p>YOUR CHOICE</p>
        <p>Reg. $29.99 to $34.99</p>
        <p> Steam/spray/dry iron with automatic shut-off, Reg. $34.99</p>
        <p> 10-cup coffeemaker with 12-hr. timer. Reg. $29.99 Toaster with color control, pastry setting. Reg. $29.99</p>
        <p> 10-speed blender with large capacity jar. Reg. $29.99</p>
        <p>Larga toaatar own</p>
        <p>'Rag. $70.90</p>
        <p>Broil or bake, 6-slice capacity.</p>
        <p>2 PRICE</p>
        <p>Braaa Hnhh tabla lamp</p>
        <p>39S?</p>
        <p>'Rag. $79.00</p>
        <p>4-way Touch-on control lamp-</p>
        <p>68845</p>
        <p>SAVE ^10</p>
        <p>Saara Baat Hand mixar</p>
        <p>'Rag. $29.00</p>
        <p>Groat for mixing cakes and cookies.</p>
        <p>1S7S3</p>
        <p>SAVE 20</p>
        <p>AnnNaraary clock</p>
        <p>3St</p>
        <p>'Rag. $60.09</p>
        <p>Westminster chime plays the hour</p>
        <pb facs="00096780_0146" />
        <p>l&amp;gt; EASY LIVING PAINT NOW ON SALE!</p>
        <p>J r</p>
        <p>SAVE OVER 50%</p>
        <p>195-pc. Mechanic's Tool Set</p>
        <p>33196</p>
        <p>priM 3614.23</p>
        <p>Get standard and metric sockets, V4-in. %-in. and V^in. drive toois. Has 6 and 12-pt. sockets. Regular and deep depth socketsi</p>
        <p>SAVE OVER 50% SAVE OVER 50%</p>
        <p>99-pc. Mechanic's Tool Set</p>
        <p>60-pc. Mechanic's Tool Set</p>
        <p>A great set for the home mechanic. Has a variety of socket, wrench, ratchets and best of all their Craftsman!</p>
        <p>prio 3209.96</p>
        <p>This tool set woukf make a fantastic gift tor Dad or that special handyman on your shopping. Packed with quality tooisi</p>
        <p>I</p>
        <p>SAVE *7</p>
        <p>IbolBol</p>
        <p>Craftsman steel constructed tod. With plastic tray.</p>
        <p>VALUE!</p>
        <p>SM 1bol0ox</p>
        <p>20 OFF!</p>
        <p>3-dr, n&amp;gt;of CfMat</p>
        <p>f9* I39S</p>
        <p>Craftsman lockable tod box with tray.</p>
        <p>Rugged sted chest in hi-tech gray cdor. Lockable.</p>
        <p>MS1/991S3</p>
        <p>62-"80 off:</p>
        <p>szaai</p>
        <p>ChmtCMimiCombo m MnltMt 2ri2iM./39^</p>
        <p>SimoISS^</p>
        <p>Craftsman 10-drawer chest or 6-drawer cabinet</p>
        <p>9ia4T</p>
        <p>Heipe to keep your sockets organized.</p>
        <p>14-"20 OFF!</p>
        <p>mmehSit</p>
        <p>14</p>
        <p>Craftsman open-end wrenches.</p>
        <p>10 OFF!SocMS9t</p>
        <p>IS0.4S*</p>
        <p>7-piece set in standard or metric sizes.</p>
        <p>SAVE OVER 50%SocM/Wrmieh S9l</p>
        <p>ra*</p>
        <p>974 .19-</p>
        <p>74.lMS2.2r</p>
        <p>20-piece set comes in standard or metric.</p>
        <p>SAVEover50% ICRAFTSMAN!</p>
        <p>Sctwiffdrlitwr 9&amp;amp;t q&amp;gt;,29* f</p>
        <p>Craftsman 20-piece screwdriver set. Phillip/ sW..</p>
        <p>rnmnchSH191</p>
        <p>Mjsesisr</p>
        <p>12-piece Craftsman combination wrench set</p>
        <p>SAVEovbr50% I SAVE "23</p>
        <p>Punch and Ch99i S291 1291</p>
        <p>itrni*</p>
        <p>20-piece Craftsman set made to last and last!</p>
        <p>__I81S4*</p>
        <p>6-pieoe pNer set has an assortment d pHers.</p>
        <pb facs="00096780_0147" />
        <p>TO SAVE ON GRILLS, MOWERS AND SPORTING GOODS!</p>
        <p>tdi</p>
        <p>20% OFF</p>
        <p>3-DAYS ONLY.'</p>
        <p>SAVE *5-i0</p>
        <p>ON ELECTRIC HEATERS</p>
        <p>3600</p>
        <p>36223</p>
        <p>OUR ENTIRE STOCK OF GAS GRILLS ON SALE/</p>
        <p>A. 850 watt Electric Radiant Heater. 2900 Btuh.</p>
        <p>B. 1320 watt Radiant Electric Heater, 4505 Btuh. Thermostat.</p>
        <p>C. 750-1500-watt Electric Heater with thermostat.</p>
        <p>750-watt Electric Convection Heater. 5120 Btuh capt^.</p>
        <p>(nelihowii)</p>
        <p>7Z $22.99</p>
        <p>l9Si</p>
        <p>Reg. $24.99 Bertite Heelm ewim an UL HMed</p>
        <p>Craftsman n^n. Gas Chain saw</p>
        <p>SoNd-state ignition, 3.0-cu. in. en- A</p>
        <p>gine. ISO-VIB anti-vibration sys-</p>
        <p>tern helps reduce fatique. marW%0 sm</p>
        <p>SAVE 30-*50</p>
        <p>ON THESE HUMIDIFIERS</p>
        <p>Each of these advertised ttems is reacfily available for sale as advertised</p>
        <p>13-gallon Humidifier, treats up to ||Q99 3000 sq. ft. Signal light.  IlirReg.</p>
        <p>15-gaiion Humidifier, treats up to 129/Si</p>
        <p>3400 sq. ft. 10-in. fan.</p>
        <p>Reg. $149.99</p>
        <p>99</p>
        <p>Reg. $179.99</p>
        <p>Tabletop Air Cfoanar</p>
        <p>89ft $129.99</p>
        <p>Removes up to 98% of pol-ienar other common particles ifom the air.</p>
        <p>36014</p>
        <p>E/ectdc^paceHeater</p>
        <p>Take that chiil-out of the air with- if out heating the whole house and savel</p>
        <p>Colorful Padded Toilet Seats</p>
        <p>Decorate! Colors to match our curtains, towels and fixtures.</p>
        <p>SAVE 60-*70</p>
        <p>ON THESE LAWN MOWERS</p>
        <p>SAVE *60</p>
        <p>PINNACLE or BRITTANY 12 MEN S AND WOMEN S BIKES</p>
        <p>SAVE WO</p>
        <p>POWER EXERCISER</p>
        <p>AeaamMynquNd ongiea,&amp;lt; endi</p>
        <p>Craftman Raahbaggar</p>
        <p>199^</p>
        <p>5-wheei height adjustments, 2-position handle. Pull-iite extended rope start. With bagger.</p>
        <p>DaHpta Craflaman RmMM099^ Moww</p>
        <p>aqulpnMnt nolaviMbla kiAaNand, Shaiby andWMnaon</p>
        <p>47293-4</p>
        <p>3.S-RP engine. 5-quick-height a^usters. Large bagger iriduded. '</p>
        <p>Craftaman n 3J-AP Raar-basgar Mowar</p>
        <p>249</p>
        <p>Solid-state ignition. 2 engine speeds. 5-quick height adjusters. Permanex bagger. )</p>
        <p>26600</p>
        <p>BikM and aiwrciM aqulpmant riquIrM lonw aiwnMy.</p>
        <p>YOUR</p>
        <p>CHOICE</p>
        <p>I-Beam Rower</p>
        <p>\99</p>
        <p>Regular</p>
        <p>27*ln. Pinnacle 12-epeed has smooth-shifting derailleur, alloy brakes. Flamboyant blue color.</p>
        <p>29-In. Brittany 12-epeed hfp lightweight lugged frame. 3-pc. cottered crank.</p>
        <p>109</p>
        <p>$199.99</p>
        <p>Electronic console features countdown timer. Has adjustable tension control. Get in shape and save at Sears!</p>
        <p>SAVE ^20!</p>
        <p>hHP EhcMc Bkmar</p>
        <p>59^</p>
        <p>Develops air velocity of 125 mph with 300 CFM at nozzle. Ooubie-ineulalad.</p>
        <p>SAVE W!</p>
        <p>l/MPEhcMcBkmar</p>
        <p>mta</p>
        <p>Indiides 15-in. extension tube UL listed-double-</p>
        <p>VALUE!</p>
        <p>204n:BIH(Blka</p>
        <p>99*</p>
        <p>Terrific looking bike has plealic wheel disc.</p>
        <p>18610</p>
        <p>SAVE WO!</p>
        <p>DP*Trac'^ 20Sy$tam</p>
        <p>00099</p>
        <p>20 exercises including curls, Nfts. pulls, more.</p>
        <p>12 PRICE!</p>
        <p>DP* Combo</p>
        <p>99^</p>
        <p>132-N&amp;gt;. barbell. dumbbeH weight set. Weight Bench.</p>
        <p>250 OFF/</p>
        <p>Raatlmtll</p>
        <p>449Tr-</p>
        <p>1.5 to 4.5 mph variable speed. LCD console.</p>
        <p>76664</p>
        <p>tntoOvWorMonfr</p>
        <p>lnl9n|9rlorNonly</p>
        <p>lnlwo97 9lM9only</p>
        <p>SAVE *30/</p>
        <p>QaaiHmarad Bkmar</p>
        <p>99^</p>
        <p>SAVE 70!</p>
        <p>Qaa-powarad Blowar</p>
        <p>249S.</p>
        <p>22.2-oc., 2-cyde engine. , Lightweight, variable-</p>
        <p>Deluxe model gas blower, great for cleaning drive-</p>
        <p>aittieiwMiiiMi</p>
        <p>SAVE *5/</p>
        <p>RadWdgon</p>
        <p>24</p>
        <p>Use</p>
        <p>SAVE W!</p>
        <p>TMcIng Computron</p>
        <p>39S</p>
        <p>Large heavy-gauge steel wagon. Rubber tires.</p>
        <p>B</p>
        <p>ll</p>
        <p>me</p>
        <p>$49.99</p>
        <p>Devefop math, spelling skills and morel</p>
        <p>SAVE *60/</p>
        <p>ArmadHlolOBIgr</p>
        <p>Rugged gym set made to last. Unassentoled.</p>
        <p>SAVE *30i</p>
        <p>ElactrkiJaap*</p>
        <p>im.</p>
        <p>Battery-powered jeep. 2% to 5 mph in forward. </p>
        <pb facs="00096780_0148" />
        <p>v^V ^ ' ^pTi|</p>
        <p>NOWTHRU NOV. 28</p>
        <p>i. m</p>
        <p>AU</p>
        <p>STORM D</p>
        <p>ONSA</p>
        <p>\</p>
        <p>saVe</p>
        <p>60</p>
        <p>Sears Best</p>
        <p>Storm</p>
        <p>Doors</p>
        <p>Reg. $299.99</p>
        <p>dSSii</p>
        <p>239</p>
        <p>All styles and colors are on salel Sturdily constructed of permacore board encased in seamless aluminum skin. Magnetic weatherstripping and adjustable bottom expander seals out bad weather. All have'double keylocks and deadbolts, plus easHy interchangeable glass and screen inserts. All styles avail able in white or brown.</p>
        <p>SAVE *O</p>
        <p>Sears RremAfi stom doors</p>
        <p>ke^ bad weather out where It belonga</p>
        <p>Reg. $239.99</p>
        <p>1*'</p>
        <p>6-</p>
        <p>SAVE *30</p>
        <p>Sears Better Stom Saeen doqrs</p>
        <p>Choice of four styles aH featuring polyurethane foam padded dent resistant kickpanel and full weatherstripping. Sturdy aluminum frames in a choice of coiors, baked on to resist njst With deadbolt locks for protection and privacy.</p>
        <p>Reg.69.99</p>
        <p>m</p>
        <p>99</p>
        <p>'V</p>
        <p>Built to last... these sturdy rugged doors have foam-fillid, extrd^wkJe fraihe and kick panel of aluminum. AvaHaUe in a Choioi of colors. All have double key lacks with deadbolts. Adjustable bottom expander ,with two vinyl sweeps and double weaiherstripping top and sides insure tight fit and reduce air leaks. Interchangeable giiass aid screen inserts have vinyl strips for each side to wedge them snugly in place. Three-year limited warranty. Ask salesperson for details.</p>
        <p>Some ttoor models and samples available at even greater savings!</p>
        <p>OetocMon Ml wy In Mch atora.</p>
        <p>Make Sears Your Home Heater Head Quarters</p>
        <p>CALL FOR FREE eSTIMATESl</p>
        <p>j</p>
        <p>BIG VALUE</p>
        <p>lnmoie 60 Economy</p>
        <p>Gas tumaee at Sears low priced</p>
        <p>90,000 BTUH upilCN modal</p>
        <p>$</p>
        <p>349</p>
        <p>These energy-efficient furnaces could cut your heating costs as they make your home more oorrirtablel We offer sizes for almost any home. The standing pilot has automatic shid-off if flame goes out. Multi speed blower is powerful enough for air condttioning. Heavy-duty heat exchanger canrtes a 10-year NmMed warranty. Ask for details.</p>
        <p>75.000 BTU upflow model</p>
        <p>75.000 BTU Horizontal model</p>
        <p>$399</p>
        <p>$449</p>
        <p>SAVE *100</p>
        <p>YOum get a warm Heine with Sears Dahm Off Furnace</p>
        <p>101,000 BTU Ra0.ioes.oo</p>
        <p>*899</p>
        <p>Upflow model, featuring flame retention burner and UFE-CLAO* oeramic coaled steel heavy exchanger for efficient, dean-burning heat when you need Rf Has direct-drfve multi-speed blower and draft regdator. Rust resistant cabinet lined wHh foil-taped ineulalion. Inetaltattonavallabto by Sears duthertradinefollira.^</p>
        <p>LAHQIRI2ISAUQ ON SAU AT IMIMjyRMm</p>
        <p>:^ii.</p>
        <p>r-Jr</p>
        <p>SAVE *100</p>
        <p>Kenmore package heat pumps for etndara headhg and oooHtg</p>
        <p>23,000 BTU haa 24S0OBTUOOOI Rag. $1540.00</p>
        <p>*M49</p>
        <p>Heipe save on heating oostsi Can be used to replaoe or supplement other kinds of heat. Helps save on oooNng oostsi Cools more economically than regular air conditioning systems installed five to ten years ago. Carries a S-yev Hmlted warranty. Ask for details in store. Free estimates on installatton.^</p>
        <p>LARQM SIZIt ALSO ON SAU AT amiLAR 8AVINQ8I</p>
        <pb facs="00096780_0149" />
        <p>i</p>
        <p>SAVE ^16!</p>
        <p>Sears DleHartT car battery</p>
        <p>53</p>
        <p>wHh trade-in I Reg. $06.90</p>
        <p>Power-up to 575 cold cranking amps plus strong reserve capacity for power when you need it most! That's the confidence you get with a DieHard*. Installation is included.</p>
        <p>SMil Sie on DieHMd* marbw tatleneel</p>
        <p>'-'SirV--'</p>
        <p>SUPER BUY!</p>
        <p>car stereo kit</p>
        <p>' h iti'MllMfeassetfa car sisreo complete with</p>
        <p>speakers at this great low price! 3hband graphic equalizer, auto-stdp cassette, a pair of 5^il slimline, speakers and more. Instalf^ is availabie, extii.</p>
        <p>,  -7 kiijV'--'v.i.... MM </p>
        <p>GREAT VALUE!</p>
        <p>4-gauge booster cables</p>
        <p>IS</p>
        <p>ff  While quantities last!</p>
        <p>These 4-ga. cables conduct 60% better than 6-ga. booster cablesi Extra-long 16-ft. extension for easier hookups in difficult situations. Insulated to assure flexibility.</p>
        <p>SUPER VALUE!</p>
        <p>to 2</p>
        <p>Charg^'^</p>
        <p>SeanK)l2 amp ^ battery charger</p>
        <p>34</p>
        <p>INTRODUCTORY SALE! Automatically turns on/off to keep battery charged. ^Pg^^a67 Ideal for any 12-volt battery.</p>
        <p>SPECIAL PURCHASE!</p>
        <p>y Watkby canister vacuum cleaner</p>
        <p>SAVE 50%</p>
        <p>on GE offer!</p>
        <p>asie</p>
        <p>Jt</p>
        <p>Rag. $26.99</p>
        <p>Plugs into Cigarette lighter for powerl 36-in. flex hose for hard to get places. Includes attachments.</p>
        <p>WNtooiMWMMlMl</p>
        <p>^  Halogen</p>
        <p>replacement headlights</p>
        <p>iyp*o*</p>
        <p>IgM</p>
        <p>Round4</p>
        <p>Hghtsystam</p>
        <p>Rectangular 4Hght system</p>
        <p>Round2 Ught system</p>
        <p>Recianguler</p>
        <p>2lightsystsn</p>
        <p>Sears reg. price</p>
        <p>11.99</p>
        <p>12.99</p>
        <p>19.99</p>
        <p>22.99</p>
        <p>Sears aaie price</p>
        <p>7.ae</p>
        <p>8.49</p>
        <p>13.99</p>
        <p>15.48</p>
        <p>Lms maraitaciiJrar's msMniabelB</p>
        <p>2.00</p>
        <p>2.00</p>
        <p>4.00</p>
        <p>4.00</p>
        <p>Vour cost after mir.a rebele</p>
        <p>5"</p>
        <p>6*</p>
        <p>9"</p>
        <p>ir</p>
        <p>ALL SHOCKS, PLUS McPherson struts and cartridges NOW ON SALE!</p>
        <p>Sizes to fit most: American-made and imported cars  Light trucks  Vans  Front wheel drive and 4-wheel drive vehicles</p>
        <p>,94600</p>
        <p>4 OFF</p>
        <p>13 OFF</p>
        <p>15 OFF</p>
        <p>93200R</p>
        <p>$6700</p>
        <p>H0aVyDuty  HtvvDuty</p>
        <p>ShoHn  OmShoA</p>
        <p>9?</p>
        <p>51?</p>
        <p>40% niore ride control area than standar^ i-in. shocks. -X , .</p>
        <p>IMAQINEI The ride and control of a gaa ilfock for under $10.</p>
        <p>'rr'</p>
        <p>lA</p>
        <p>SfeadyRMar</p>
        <p>RTihOGk</p>
        <p>Radial tuned tor exceptional cofo-tort, ride and cQh-trol.  I</p>
        <p>SlaachrAMar</p>
        <p>ev w^pva%e V e a eee^^e</p>
        <p>Qmmock</p>
        <p>Sears Best! Gas charged for exceptional stabRlty, and handling.</p>
        <p>SmtOwnKfm</p>
        <p>LThoek</p>
        <p>99100</p>
        <p>Sooalar</p>
        <p>thock</p>
        <p>04100</p>
        <p>AlradJuttaM</p>
        <p>thocks</p>
        <p>Sears Best shook for light trucks and vans I Firm ride control.</p>
        <p>39? S-S4</p>
        <p>99</p>
        <p>^^14^ ""woirpf </p>
        <p>Shock absorber Adjust with air for plus spring for carrying up to extra carrying ca- 1000 lb. of extra padty.'Pair. weight</p>
        <p>94500</p>
        <p>St99dyRlder Qm Cartridges</p>
        <p>n8 QQ99 m ss OSTp</p>
        <p>INSTALLED</p>
        <p>Cartridges for MacPherson equipped cars.</p>
        <p>MacPherson Gas Struts</p>
        <p>Rag.</p>
        <p>S130.B9</p>
        <p>119^</p>
        <p>INSTALLED</p>
        <p>Struts for MacPherson equipped cars.</p>
        <p>SAVE 40.'</p>
        <p>Ploorlack</p>
        <p>*99"*'T</p>
        <p>Heavy duty 2-toiif$oor|ack.  ^ Rugg^ steel frame, wida.</p>
        <p>V, </p>
        <p>SAVE 7!</p>
        <p>foormatsals</p>
        <p>smm *eM</p>
        <p>Fronruid rear floor mats in black, blue, gray or bur-</p>
        <p>'  '  ;    ''t</p>
        <p>AUTO CENTER NOW OPEN</p>
        <p>'^AM</p>
        <p>7</p>
        <p>P,</p>
        <p>MONDAY</p>
        <p>THROUGH</p>
        <p>WWQAYI</p>
        <p>Ohop ear nonsil etoie hours on tundqf</p>
        <p>GREAT VALUE</p>
        <p>PA-tonJaakwllh stands</p>
        <p>^^TTwNli qimew* uw</p>
        <p>Compact Jack lifts 3,000-lbs. Includes pair of 4,000-lb. capacity jack</p>
        <p>SAVE 20!</p>
        <p>FrofaelArtcareovir</p>
        <p>^ All weather iMidCtlon i elastic hems for a $fxjg fit. Sforaoepouch.</p>
        <p>SAVE 60.'</p>
        <p>Mfoiiiini car iflwao</p>
        <p>99</p>
        <p>nag.9lM.N</p>
        <p>Eleotronic tuning phis foH range tone control for crisp, dear sound.</p>
        <p>SAVE *3.'</p>
        <p>9-ton aek stands</p>
        <p>QB8</p>
        <p>Extra strong for extra stability when working on your car.'' .5-  ^</p>
        <p>UMTM</p>
        <p>SAVE 39%!</p>
        <p>kmOarmdOmotoroir</p>
        <p>59t-</p>
        <p>.91.14</p>
        <p>voun GMOica</p>
        <p>Choose 10W30 or 10W40 all weather fuel-efficient motor oM.</p>
        <p>UMIT12</p>
        <p>8911</p>
        <p>SAVE 40%</p>
        <p>STP oU traatmant</p>
        <p>Terrific engine protection. Use it every oil change.</p>
        <p>SAVE 20!</p>
        <p>Craftsman timing Hght</p>
        <p>29.</p>
        <p>'RtQ.$49J9</p>
        <p>Inductive-needs no adaptors. Detachable leads. Up to 8.000 RPM.</p>
        <p>ui-  ......</p>
        <p>STP gas treatment</p>
        <p>nag....................$1.39</p>
        <p>SALE......................69</p>
        <p>Uw&amp;gt; itwlHn isbsw..........80</p>
        <p>VOURFIHAL</p>
        <p>COSTATTER  AO0</p>
        <p>REBATE.............</p>
        <p>SAVE 20/</p>
        <p>Car top carrier</p>
        <p>59?</p>
        <p>Add 15-cu. ft. of extra space to your carl</p>
        <pb facs="00096780_0150" />
        <p>ALL-SEASON CAPABLE</p>
        <p>FUEL-EFFICIENT RADIAL DESIGN</p>
        <p>SAVE 50%</p>
        <p>SuperGuard steel-belted radiai</p>
        <p>at our lowest price ever!</p>
        <p>99</p>
        <p>PtS6/80R13</p>
        <p>Trust Sears to bring you this great vaiue in a steel-belted radial at savings of off Sears 1987 Fall Catalog prices. Where eise a tire with a 40,000-mile wearout warranty plus all-season traction at this low price.</p>
        <p>40.000-mi</p>
        <p>e wearout warranty</p>
        <p>SupeiGuard</p>
        <p>1967 Fall catalog price</p>
        <p>sue</p>
        <p>Prtce</p>
        <p>aaeii</p>
        <p>isseoRia</p>
        <p>1650R13</p>
        <p>175fl0ni3</p>
        <p>ieseoRi3</p>
        <p>18Sr7SR14</p>
        <p>195/75R14</p>
        <p>20S76R14</p>
        <p>2(/75R1S</p>
        <p>215/75R1S</p>
        <p>22S/75R1S</p>
        <p>23S/7SR1S</p>
        <p>969.90</p>
        <p>79.99</p>
        <p>89.90</p>
        <p>95.90</p>
        <p>101.99</p>
        <p>109.99</p>
        <p>111.99</p>
        <p>115.99</p>
        <p>117.90</p>
        <p>110.99</p>
        <p>119.99</p>
        <p>mao</p>
        <p>37J9</p>
        <p>4SJ9</p>
        <p>4SJ9</p>
        <p>45J9</p>
        <p>SU9</p>
        <p>SMS</p>
        <p>5649</p>
        <p>5649</p>
        <p>5746</p>
        <p>5746</p>
        <p>MADE BY MICHELIN. BACKED BY SEARS</p>
        <p>I</p>
        <p>\</p>
        <p>SAVE 30% 44</p>
        <p>on our best-selling higfmay ndtef</p>
        <p> Radial construction 2 steel belts</p>
        <p> All season capability</p>
        <p> Mtoby Michelin Backed by Sears</p>
        <p>45.0Q04llilS6ll</p>
        <p>NtSWIMtV</p>
        <p>nCMOHANOLEri</p>
        <p>46</p>
        <p>P186IWR13</p>
        <p>piaaeoRis</p>
        <p>P17S0ni3</p>
        <p>piiaani3</p>
        <p>P16V78R14</p>
        <p>P19678ni4</p>
        <p>P906(7mi4</p>
        <p>paovrnni</p>
        <p>erue</p>
        <p>CSI</p>
        <p>use</p>
        <p>sue</p>
        <p>E</p>
        <p>nee</p>
        <p>Othir ilwi I</p>
        <p>Front disc brake Job</p>
        <p>64^</p>
        <p>Now disc pads, turn and true rotors, re* place fluids and road test. Rebuild usable calipers. $10 each.</p>
        <p>LMlid vMfinty. SMUMttordilill.</p>
        <p>JAKE THE MUZZLER CHALLENGE!</p>
        <p>AH-8teel</p>
        <p>miMl dOflWllO OM</p>
        <p>LMMvwnMy-</p>
        <p>SMlkwloritaMi.</p>
        <p>Check our price, our warranty. Installation and construction-then juat try to find a Dener munier oeaii</p>
        <p>piTsmmns^</p>
        <p> In 60 or 70 series</p>
        <p> Raised white or black outline letters</p>
        <p> Folded Keviar*aramid over steel belts</p>
        <p>30.00IHIIS MiMl mmmif</p>
        <p>Y3srR|&amp;amp;</p>
        <p>mR</p>
        <p>giJilBj# mmrmn PBlfTffiiM \wsaarrwme M|nil14 I..ptaaa*.</p>
        <p>E</p>
        <p>em</p>
        <p>use</p>
        <p>aua</p>
        <p>niMimi4 iptsismms FIIMITRIi P......</p>
        <p>OUR LOW-PRICED ALL-SEASON RADIALQdaidsman</p>
        <p>ResponsepisseoRia 34</p>
        <p> Built with two rugged steel belts</p>
        <p>Swirl tread design for good wet-weather traction-ali season</p>
        <p>\</p>
        <p>\</p>
        <p>140,1100-iiiils tttiOTii mmmir</p>
        <p>rSST</p>
        <p>BMk</p>
        <p>iSsr</p>
        <p>6Mb</p>
        <p>piiMinit</p>
        <p>PMMMia</p>
        <p>P1TWMH3</p>
        <p>Rsaia</p>
        <p>pnmma</p>
        <p>PMwnni4</p>
        <p>PIWTWH</p>
        <p>paMmm</p>
        <p>ptiwnmi</p>
        <p>pinniiii</p>
        <p>PtMtlMII</p>
        <p>PMWIMN3</p>
        <p>IMlM</p>
        <p>Ml</p>
        <p>E</p>
        <p>MM</p>
        <p>TIME FOR A TUNE-UP?</p>
        <p>Electronic Ignition tune-m</p>
        <p>New plugs, set timing, ad)ust carburetor. 6&amp;lt;yl.*.......</p>
        <p>
        </p>
        <p>simupw^</p>
        <p>when you use all the t099 eoupone In tMe bqok^ ieJl</p>
        <p>l-year emergency tire change plus road hazard coverage</p>
        <p>Sears Best performance tire</p>
        <p>piasmiTRis 69"</p>
        <p>All-season capable  In 70 aeries Whitewall with raised outnne blaek letters on other side</p>
        <p>SO.OQO-inils amiit MnsRly</p>
        <p>WeMMweir</p>
        <p>IMm</p>
        <p>eSOLs</p>
        <p>far</p>
        <p>erne</p>
        <p>piMieimi</p>
        <p>nSitfina</p>
        <p>PiHiivnn*</p>
        <p>ptiwienni</p>
        <p>pmnemw</p>
        <p>mamniii</p>
        <p>PtTMMli</p>
        <p>P1NMN13</p>
        <p>P1MMin4</p>
        <p>l&amp;gt;1WTSR14</p>
        <p>PMvnmi</p>
        <p>pfinmii</p>
        <p>ernnm*</p>
        <p>4M</p>
        <p>tTM</p>
        <p>aeM</p>
        <p>OOMrUMavaMMa</p>
        <p>OUR LOWEST-PRICED ALL-TERRAIN RADIAL</p>
        <p>SAVII0%-f5%TrallHandler A-T</p>
        <p>LT198/78m4</p>
        <p>m</p>
        <p>P9M</p>
        <p> Super traction off road 2 strong radial belts</p>
        <p> Raised white outline letters (except 7.50R16)</p>
        <p>^aiESiiEai</p>
        <p>isas</p>
        <p>tIMMeW</p>
        <p>WMi</p>
        <p>1</p>
        <p>TIMESAVER OIL CHANGE</p>
        <p>Look St sum doforonfy</p>
        <p>19</p>
        <p>&amp;lt;*lnslallupto5qL10W40or</p>
        <p>lOWSCotl</p>
        <p>IrarttM naw Tirapper fitter i^ibricatachaaae a*ClMGlcandMI:</p>
        <p> Brattafluid</p>
        <p> TranamMon fluid</p>
        <p> DHmmial fluid</p>
        <p> WkidaMald fluid</p>
        <p> Vlauallylna^tiraa,balto,</p>
        <p>WHAT IS 4'WHEEL ALIGNMENT?</p>
        <p>vt</p>
        <p>Cvary oar. raar uihaal or Ironi wtwal drtua, haa an imaginary cantarna. Al lour aflMaia nwal ba paraM to ttla Hna lor piopar haixang and Ore wear. Wfwn atthar the front or raar whaalo ara not paralal you wM tiava poor handeig parlormanoa, Incraaaad waar on auapanaion parta and lliaal</p>
        <p>- /</p>
        <p>IF YOUR CAR NiEDS 4-WHEEL AyQNMElin</p>
        <p>nordunik</p>
        <p>Front Wheel Mje 4&amp;lt;whBel thrust alignment .$4.09 *4-wheel total alignment .49.99</p>
        <pb facs="00096780_0151" />
        <p>:l ', Or Service &amp;amp; Delivery Promises</p>
        <p>^ We will provide service and delivery no matter I I We will remove all cartons and packing</p>
        <p>where you livethrough our nationwide service . ^  materials at the time of delivery and arrange for</p>
        <p>organization with over 12,000 trucks and 15,000j^Ltemoval of your old appliance, at your technicians.  convenience.</p>
        <p>I \We will make every effort to deliver your new . appliance when ifs convenient for you.</p>
        <p>I I We will schedule the delivery date when you buy ^ your appliance, and call you, in advance, to confirm a 4-hour time period for our arrival.</p>
        <p>K  V</p>
        <p>n We will deliver Saturday or almost any evening,</p>
        <p>^ if you prefer.</p>
        <p>I I We will do everything we can to deliver</p>
        <p>refrigerators and dishwashers the following day, in case of an emergency.</p>
        <p>I I We will provide repair service in your home when convenient for you, including Saturday or almost any evening, if you prefer. -</p>
        <p>I I We will confirm a 2-hour time period, in  advance, for our service call.</p>
        <p>I I We will make every effort to repair carry-in appliances at our Service Centers while you wait.</p>
        <p>I I We will provide normal hookup of your new  appliance at the time of delivery ^</p>
        <p>1 We will provide convenient hours at our 800 Service Centers throughout the country. From , 7:30 a.m. to 7:00 p.m., weekdays.</p>
        <p>I I We will stand behind our policy of Satisfaction  Guaranteed or Your Money Back.</p>
        <p> \</p>
        <p>lot of companies can make yew a lot of promises'And if they (kmt ilfill ttem the last thin; they want is for you tt&amp;gt; call them on it.</p>
        <p>At.Sears. we lodt at k a little diff^oitly.</p>
        <p>You should expect our sCTvice to be as ^pendaUe as our products are. And, to that end, we try to be perfect. But sometimes a gentle roninder can help us become even better.'</p>
        <p>So, hold on to this ad. The next time we service your Kenmore appliance, w deliver a ikw one, check our perhnmance against this list. Because it*s not the promises we make tlrt count.</p>
        <p>But the ones we Iseep.</p>
        <p>If trfftfi</p>
        <p>.  Oaaeowi.  xsmrn.  piwin.</p>
        <p>mrnm. Qmrnmmmkn^Pm Mtmrm, rmm&amp;gt; 6%' Wlai'iWiw :  </p>
        <p>tC:</p>
        <p>.m Onilb&amp;gt;LMliRn.AWBb^  mi''</p>
        <p>wn ^^ "-n/Binrin </p>
        <p>-  rnmm...............'  -1^</p>
        <p>Vr.-t/</p>
        <pb facs="00096780_0152" />
        <p>BUY NOW!</p>
        <p>NO MONTHLY PAYMENTS UNTIL APRILSAVE *20to200</p>
        <p>ON STEREOS. COMPACT DISCS. AND MOREi</p>
        <p>SAVE *150</p>
        <p>HI-FI Stereo Rack System with MO-Watts per channel19</p>
        <p>R^. $549.99</p>
        <p>Fealures an AM/FM quartz tuner vnth 5 AM and 5 FM pr^</p>
        <p>sets. 5-band graphic equalizer. Dual synchronous hh speed cassette decks. Semi-automatic turntable 3-way bass reflex speakers. PLUS its Compact diw ad^Jteble.</p>
        <p>"50 OFF YOUR CHOICE CD PLAYERS</p>
        <p>BOOST YOUR BUYING POWER SearsCharge PLUS</p>
        <p>eresi</p>
        <p>pioneer CD Plarar yytonoto-ooolrol CD</p>
        <p>299S</p>
        <p> __</p>
        <p>Features 3-spot beam for better tracking. 16 track random pro-</p>
        <p>granming.LED&amp;lt;igitaldfeplay.</p>
        <p>199!;.</p>
        <p> ni0-wireless remote control for easy operation. 3-spot beam. 16 track random programming. LCD (igital rteplay.</p>
        <p>SAVE "200</p>
        <p>^WnSSSo^Sm599?_</p>
        <p>AM/FM quartz tuner, remoto ooMreL dual tapes, semi-auto tumtobto and</p>
        <p>SAVE-100 ir SAVE-30 j| SAVE20 U SAVE30 U SAVE40</p>
        <p>StamRmASystem UOCOWptor199.</p>
        <p>'RiseaeM</p>
        <p>AM/FM stereo, dual tapes, semi-auto tum-toble. equator and two</p>
        <p>'MsttTU</p>
        <p>3-spot beam. 16 track random programming</p>
        <p>mdUCOdlgiWdspiqf-</p>
        <p>PorttmaSteno</p>
        <p>AM/FM stereo with cassettte play. Terrific sound at a great price. '</p>
        <p>mutHAKeyboanl99-</p>
        <p>Portable, take It anywhere. Make a variety of different sound on one hayboard.</p>
        <p>jVlCRSmd79^.-,</p>
        <p>Stand rolls easily on cttt-eri Holds both TV and VCR. tvuvcrmim</p>
        <pb facs="00096780_0153" />
        <p>SAVE */5to"/20</p>
        <p>SAVE TYPEWRITERS PHONES VACUUMS AND MORE</p>
        <pb facs="00096780_0154" />
        <p>BUY NOW!</p>
        <p>NO MONTHLY PAYMENTS UNTIL APRILSAVE *30 TO *281ON DISHWASHERS, COMPACTORS AND COOKTOPS</p>
        <p>i</p>
        <p>%irM&amp;gt;</p>
        <p>A</p>
        <p>moff</p>
        <p>Deluxe Kenmore</p>
        <p>Built-in</p>
        <p>Dishwasher</p>
        <p>NOW ONLY</p>
        <p>3-level wash with 7 cycles. Has pots/pans cycle and rinse/hold cycle. Featpres Power Miser option to help conserve energy.</p>
        <p>Uae Vbur SearsCharge CardI</p>
        <p>nm-ieaw</p>
        <p>IPlfVI</p>
        <p>Buin-in DUmsher</p>
        <p>*348</p>
        <p>6-hour delay feature, water and power miser option. Pots/pans cyde. Touch-pad design for easy operationL  |</p>
        <p>Keimon BuUt-in ' Dia DishWMher</p>
        <p>3992L</p>
        <p>8-hour delay. ULTRA-WASH system to get dishes super deanl 22 cyde/option combinations.</p>
        <p>SAVE ^190!</p>
        <p>rortaom utwwmsner3S3H:^.</p>
        <p>RoHs easily on casters. Attaches to faucet quickly and easily. I&amp;amp;^sydes.</p>
        <p>SAVE "30/BuHt-ln Dishwasher</p>
        <p>Rag.|2.(</p>
        <p>Power Miser feature, 2 wash levels and 2 cyctos. Hurry and save at SearsI</p>
        <p>SAVE ^100!</p>
        <p>Built-In Compactor299S</p>
        <p>Foot operated drawer opener. Liquid deodorizing system.</p>
        <p>SAVE</p>
        <p>sonf</p>
        <p>EhcMcCooktopim.</p>
        <p>Chrorrtoi)lated cooktop is hinged to lift-up tor easy ctoaning.</p>
        <p>Reg.$239.08 Range Hood ....188J9Rmtge Hood</p>
        <p>^^ms.H4AW</p>
        <p>Stainless steel hood has solid-state controls. With workN^</p>
        <p>Each of those advertised items is readUy avaiiahle for sale as advertised</p>
        <pb facs="00096780_0155" />
        <p>0.4-cu. ft. capacity with 15-minute mechanical timer. 400 watts.</p>
        <p>SAVE *100!</p>
        <p>KMid Mft^stze Mkmwave Oven</p>
        <p>Features 3-stage memory-including program defrost. 0.8 cu. ft. capacity. Electronic digital display with touch controls. Has time of day dock. Variable power.</p>
        <p>7119</p>
        <p>Kenmon MVcrowave Ovwi</p>
        <p>Compact microwave oven at a fantastic price. It would make a great QiftlO.4 cu. ft.</p>
        <p>88347</p>
        <p>Kenmon MIcnmve Oven</p>
        <p>^Raa $349.99</p>
        <p>Family-sized microwave.. 1.3 cu. ft. capacity. 750 watts of power.</p>
        <p>SAVE "40; II SAVE V40!</p>
        <p>Kenmon Range</p>
        <p>259,_</p>
        <p>30-inch electric range with Hft-up oooktop. PoT: ceiain enameled cooktop.</p>
        <p>Kenmon Range</p>
        <p>*329S_</p>
        <p>glack glass oven door. Removable storage drawer. Clock with 4-hr. timer.</p>
        <p>VALUE!</p>
        <p>BecMc Range</p>
        <p>399"</p>
        <p>Self-cleaning 30-in. range. Lift-up cooktop for easy cleaning.</p>
        <p>SAVE ^30! 1</p>
        <p>SAVE WO!</p>
        <p>SAVE WO!</p>
        <p>Drop-In Range</p>
        <p>369?.</p>
        <p>30-inch electric Kenmore drop-in range.</p>
        <p>iMlMito. rtra on il MMm.</p>
        <p>Kanmoi* 0rqp4n</p>
        <p>499?_.</p>
        <p>30-in. electric model range gives your kitchen that spedai look.</p>
        <p>Kenmon Drop-In</p>
        <p>549?_</p>
        <p>Seif-deaning range with black glass oven door. Save big now at Sears!</p>
        <p>1</p>
        <pb facs="00096780_0156" />
        <p>K,</p>
        <p>'U-</p>
        <p>i-</p>
        <p>f</p>
        <p>BUY NOW!</p>
        <p>NO MONTHLY PAYMENTS UNTIL APRIL</p>
        <p>SAVE 80to</p>
        <p>ON THESE KENMORE LAUNDRY PAIRS ALL 1987 WASHERS AND DRYERS ON SALE</p>
        <p>ONTHISMIR</p>
        <p>Large-d^MC/fy Washf</p>
        <p>Features 7-cydes with 3 water tem-peratures aid self-dear^ lint filter. Plus 3 water levels. Heavy-duty 2-speed motor.</p>
        <p>Large-capacity EIbcMc Dry^r</p>
        <p>Automatic Fabric Master to automatically shut dryer off. Has end-of cycte-signal. 3 temperature controls.</p>
        <p>*80 OFF ONTmi^lR</p>
        <p>onfw</p>
        <p>98</p>
        <p>R.</p>
        <p>1279.99</p>
        <p>29^249</p>
        <p>6-cyde Waiher. Has 3 preset temperatures and 2 water levels.</p>
        <p>Etedric Dryer. Has 2 ten^ierature con-I trols. Manual timer.</p>
        <p>270 OFF THtSPUR</p>
        <p>49^-.</p>
        <p>3m</p>
        <p>Mg. 9499J9</p>
        <p>UdyKanfnoretMMwr. Sears Best 15 cycle washer with dual-action agi-tetor. Self-cleaning lint filter plus more.</p>
        <p>Lady Kenmore Dryer. Sears Best with Easy Loader door, customizable temperature ranges. Auto sow-stale</p>
        <p>*270 OFF THISPMR</p>
        <p>ms</p>
        <p>Mg. $629.99</p>
        <p>299S</p>
        <p>Oiyw</p>
        <p>Rig. 143999</p>
        <p>10-eyele Waaher. Features dualaction agitalor, electronic temperature control. Seifdaning Hot fitter. Extra-capacity Dryer. Automatic sofid-stete sen^ig. Has Easy Loader door for easy loaWg/unioading</p>
        <p>Each of these advertised iteros.is readily available for sale.aa advertiaed</p>
        <pb facs="00096780_0157" />
        <p>V i " </p>
        <p> t</p>
        <p>V</p>
        <p>'  ' VOUR t'j</p>
        <p>. 299'' 9 *1 '</p>
        <p>' ill ' ' ^ 1</p>
        <p>1 SAVE "240</p>
        <p>SAVE "120</p>
        <p>SAVE "90 II SAVE "/OO</p>
        <p>SAVE "220</p>
        <p>19.9 cu. ft Weftfgerator</p>
        <p>659?^</p>
        <p>3 glass cantilever</p>
        <p>shelves. Crisper and Nice</p>
        <p>N Fresh dravm. ^ awoDoweiciwiaiir.......yimi</p>
        <p>15 J CU. ft Rcfrigentor</p>
        <p>379?</p>
        <p>Budget-priced. Durable seamless liner for easy cleaning. Kenmore quaNty.</p>
        <p>KsfifflomCfiestfteeier Kmunon UprigM Fncnr</p>
        <p>29S^ 29SH:^</p>
        <p>12.0 CU. ft capacity. 1 side 11.0 cu. ft. capacity. 3 out basket. Magnetic gas- shelves plus 4 door kat to keep in cold. shelves. Magnetic gaskets.</p>
        <p>3 cantilevered shelves. Meatpan.Cfisperandmore.</p>
        <p>$1019.99 wWi iOMMktr. 779.99</p>
        <p>Each of these ac^ertiaed items i8 readily</p>
        <p>SAVE "400</p>
        <p>2Ueu.ftSM*-r-SM*</p>
        <p>WWVni0-i3aM9</p>
        <p>All-frostiess. Has water and ice thru-the-door. Meat pan and Nice N Fresh pan._</p>
        <pb facs="00096780_0158" />
        <p>SAV*50!</p>
        <p>Penonaf^/n Co/or TV</p>
        <p>ftaO-ttMJ</p>
        <p>13-In.* screen, great for Mlchen. bedroom or ofiicel Has 3-tey romote controll</p>
        <p>SAVE *120!</p>
        <p>STEBEOColorTV</p>
        <p>349?</p>
        <p>rlMSVCtl</p>
        <p>'Rm. MWJS</p>
        <p>19-in.* screen. MTS stereo! 19^rey romote control. Feahjres off-tbner.</p>
        <p>'ta|840J9</p>
        <p>On screen display for easy programming! 27-function wireiess remote.</p>
        <p>SAVE *400!</p>
        <p>On-screen' programming and Dolby* stereo. Has direct access on remote.</p>
        <p>179S^ *</p>
        <p>41-In.* color. Has fantastic &amp;gt; picture quality! Large screen for family viewing!</p>
        <p>Save *30!</p>
        <p>n^cnnio</p>
        <p> -</p>
        <p>Each of these advertised iterrte is readiV availabte for sate as advertised</p>
        <p>Sdaftae afid Oo^ Siy&amp;gt;</p>
        <p>1.* screen. AM/FM stereo dock radio and TV combination. Go-anywhere model!</p>
        <p>SfmiMsdTViweaononiiSWilMMn *41 TV ictwn iiMMund dWooMiif</p>
        <p>imyViteijil Ipa^ aoi,enr ' vWNteiln  CteiaUn,</p>
        <p>v |num</p>
        <p>Pie</p>
        <p>J</p>
        <p>tfwustroDl rtSuoii^</p>
        <p>4fV- 1!</p>
        <p>4Q1 11/22117</p>
        <p>a</p>
        <pb facs="00096780_0159" />
        <p>'l- /'V</p>
        <p>&amp;gt; i i S. *</p>
        <p>vl'i '&amp;gt;</p>
        <p>V  V  i':''  ip</p>
        <p>&amp;gt;' '''', ,1</p>
        <p>JjJiH</p>
        <p>ft#.</p>
        <p>'i  ^   ' I BS *. JP</p>
        <p>Ollir  SELF- BASINC:Young</p>
        <p>la  MU':  llim ~ WHVII  jWMlMl 911111 WHIII~li|fm .}WWJ^'</p>
        <p>PRICES EFFECTIVE SUN.. NOV 22 THRU THUR8., NOV. 2S, 1967. QUANTITY RIGHTS RE8CRVE0.</p>
        <p>'aaV 'UJl</p>
        <pb facs="00096780_0160" />
        <p>K</p>
        <p>^ -</p>
        <p>&amp;gt;</p>
        <p>.Sj-</p>
        <p>*'is-  ^</p>
        <p>STOP</p>
        <p>CAMPBF.LLS</p>
        <p>Tomato</p>
        <p>Soup</p>
        <p>STOP</p>
        <p>BEAN COFFEE</p>
        <p>Crnp THIN TRIM GRAIN FED BEEF JzJLZL.  OVEN  READY</p>
        <p>THIN TRIM GRAIN FED BEEF TOP</p>
        <p>Bonelis Sirloin</p>
        <p>Eight</p>
        <p>Oclock</p>
        <p>Rib</p>
        <p>Roast</p>
        <p>CUDDY DINNER STYLE BONELESS FULLY CO</p>
        <p>Smoked Trkey</p>
        <p>HOLLY FARMS</p>
        <p>10.75 oz can</p>
        <p>3|lb</p>
        <p>bag</p>
        <p>Sunday Best Ro</p>
        <p>100% PURE MARKET FRESH  ANY SIZE PKG.</p>
        <p>Ground Round</p>
        <p>FRESH CUT GRAIN FED BEEF  9-12 LB. AVG.</p>
        <p>r^'-ee VVnf-' An Abiiitionai $1Q Or More Purchase  Lirmi One With An Additional S10 Or More Purchase</p>
        <p>A&amp;amp;PJEaiED OR WHOLE</p>
        <p>CranbOrry Sauce</p>
        <p>FOR HOLIDAY COOKING</p>
        <p>Mbby Pumpkin</p>
        <p>LIK3Y</p>
        <p>inipkin Pie Mix</p>
        <p>2.100</p>
        <p>cans </p>
        <p>16 OZ.I can</p>
        <p>km'</p>
        <p>ASSORTED</p>
        <p>RiOe-A-Roni</p>
        <p>REULAR</p>
        <p>ReynoldsWrap</p>
        <p>REYNOLDS TURKEY (LARGE 5 CT $1.25)</p>
        <p>Oven Cooking Bags</p>
        <p>HEWYDUTY  .</p>
        <p>ReynoldsWrap ^</p>
        <p>NTTSORIGIINAL</p>
        <p>i^)ple Sauce</p>
        <p>EIQHTOCLjOCK</p>
        <p>Inoiant Coffee</p>
        <p>ibRY detergent</p>
        <p>Liquid</p>
        <p>Whole Sirloin Ti|</p>
        <p>SEAFOOD</p>
        <p>FRESH STANDARD</p>
        <p>East Coast Oysl</p>
        <p>FRESH SWEET</p>
        <p>Bay Scallops</p>
        <p>SEA LITE FULLY COOKED</p>
        <p>Crab Meat Blem</p>
        <p>6.25-8 oz. pkg.</p>
        <p>SAU SEA FRESH</p>
        <p>Shrimp Cocktail</p>
        <p>STOP</p>
        <p>THIN TRIM WHOLE OR HALf</p>
        <p>Fresh Pork Ham</p>
        <p>ft9</p>
        <p>32 oz. btl.</p>
        <p>- 'V.</p>
        <p>BAKERY SAVINGSGROCERY SAVINGS IN EVE</p>
        <p>tSTOP</p>
        <p>CTAp BUHER CHOC  DEVILS FOOD</p>
        <p>OI Ur  german choc,  golden van</p>
        <p>CTTTTli REG. OR BTR yellow* WHITE</p>
        <p>Betty Crocker Cake Mix</p>
        <p>ASSORTED</p>
        <p>Ann Page Ice Cream</p>
        <p>18,75</p>
        <p>oz.</p>
        <p>Ctfl</p>
        <p>2</p>
        <p>limit Tw(i With An Addition,ii $10 Oi Morn Pu'rt' i</p>
        <p>^OP</p>
        <p>MINI KAtSf. R f-iOlLSOI</p>
        <p>iDinner</p>
        <p>kRolls</p>
        <p>STOP</p>
        <p>BAKED FRESH</p>
        <p>STOP</p>
        <p>Pumpkin</p>
        <p>Pie</p>
        <p>SEL EC If I)</p>
        <p>SWT E I POTATO Plf</p>
        <p>Betty Crocker Frosting</p>
        <p>STOP</p>
        <p>Nl .-11 Lf-GtJIK</p>
        <p>^Chocolate</p>
        <p>Milk</p>
        <p>lOCiOON'V INSTOH WIIHIiAKr</p>
        <p>laODHM Yirj hTOHf- bVVrrH</p>
        <p>ctn</p>
        <p>I</p>
        <pb facs="00096780_0161" />
        <p>n Steaks</p>
        <p>.2</p>
        <p>r COOKED</p>
        <p>y Ham</p>
        <p>.1*</p>
        <p>ioasters</p>
        <p>.69^</p>
        <p>&amp;gt;KG.</p>
        <p>1 ^</p>
        <p>iVG.</p>
        <p>rip</p>
        <p>.t</p>
        <p>D SAVINGS</p>
        <p>sters</p>
        <p>.29</p>
        <p>ctn. mm</p>
        <p>nd</p>
        <p>lil</p>
        <p>.119</p>
        <p>^ pkg- </p>
        <p>ERY AISLE</p>
        <p>^STOP KFFRH</p>
        <p>KFF HI f H  K.'ASTF D P lA^ACKF f^S f 07 iF'AOfi</p>
        <p>Soft Batch Cookies</p>
        <p>12 07, nk(]</p>
        <p>STOP</p>
        <p>GRADE A  4-7 LB AVG CAROLINA</p>
        <p>Turkey</p>
        <p>Breast</p>
        <p>w Boneless Smoked Ham</p>
        <p>SLICED</p>
        <p>FREE</p>
        <p>499</p>
        <p>STOP</p>
        <p>lb.</p>
        <p>SEM,-BONELESS</p>
        <p>Leg of Lamb</p>
        <p>949</p>
        <p>STOP</p>
        <p>GRADE A  10-18 LB AVG SELF-BASTING</p>
        <p>Young</p>
        <p>Tlirkeys</p>
        <p>0</p>
        <p>lb.</p>
        <p>CTflP i JOHN MORRELL *5-7 LB AVG CTflP WHOLE  </p>
        <p>QUARTERS</p>
        <p>Blue Bonnet Margarine</p>
        <p>.?F5!L!  REGULAR</p>
        <p>W PetRitz Pie Shells</p>
        <p>1 lb. pkgs</p>
        <p>lit Tvva With An Add I S10 Or More Purch</p>
        <p>A&amp;amp;P SALTED</p>
        <p>Butter Quarters</p>
        <p>A&amp;amp;P</p>
        <p>Whipping Cream</p>
        <p>KRAFT PHILADELPHIA</p>
        <p>Cream Cheese</p>
        <p>REGULAR  EXTRA CREAMY</p>
        <p>Birds Eye Cooi Whip</p>
        <p>TROPIC ISLE FROZEN</p>
        <p>Coconut  A</p>
        <p>REGULAR  WITH CALCIUM  FROZEN</p>
        <p>Citrus Hiii Orange Juice</p>
        <p>12 oz. can</p>
        <p>HEALTH &amp;amp; BEAUTY GENERAL MERCHANDISE</p>
        <p>/  HONEY  JO</p>
        <p>STOP I</p>
        <p>HONEY JO</p>
        <p>Panda</p>
        <p>Bear</p>
        <p>tV'u'. ?n,irK'li*'A t,( .*u! = .ind !mi " *ir r, id-iMtnn</p>
        <p>'n.i'Rua , I ',)r, I r    "  .1  !  *</p>
        <p>MSlUf</p>
        <p>Genuine 24% Full Lead Crystal</p>
        <p>Glassware</p>
        <p>Thts Week's Feature WATER/WINE GOBLET</p>
        <p>On Our Quality Film Developing</p>
        <p>Single Prints! [ Twin Prints J</p>
        <p>I fi20#4.25'</p>
        <p>With All Additional PuK;h,is&amp;gt;' $19 99 Each Without Addilion.il Pur</p>
        <p>99</p>
        <p>All (tf mg are  -4  *</p>
        <p>always on sale at I iH*7es i</p>
        <p>m. a, njDCHtsf (OuixiD Lii&amp;gt;'&amp;gt;&amp;lt; tt 1</p>
        <p>STOP</p>
        <p>ate Motor Oil</p>
        <p>li INHFBA</p>
        <p>69</p>
        <p>case of 6S7 |.l</p>
        <p>PEROT AF lER RLFTATi</p>
        <p>three HOUFT Ln^</p>
        <p>A&amp;amp;Rn</p>
        <p>Firelogs</p>
        <p>t!S</p>
        <p>PLUS  GUARANTE ED SERVO</p>
        <p> r 2 .  2  PREE'</p>
        <p>STOP  0-)H  details</p>
        <p>Texaco</p>
        <p>Anti-Freeze</p>
        <p>ITS:'. MAI iSRrftAtf</p>
        <p>Ih</p>
        <p>TEXACO</p>
        <p>Anti-Freeze Coolant ^</p>
        <p>Pf FUiAl AF t| R F&amp;lt;[ ttAlt</p>
        <pb facs="00096780_0162" />
        <p>"""=HTER</p>
        <p>The freshest way to Sa&amp;gt;/e.</p>
        <p>DELI &amp;amp; CHEESE SAVINGS</p>
        <p>CTID  north CAROLINA  H  CTAD</p>
        <p>GROWN    2MUT  i AiK'.L CAi iFOf^NIL</p>
        <p>Sweet  1'^  Fresh</p>
        <p>Potatoes  I  Celery</p>
        <p>CTOP COLBY  CHEDDAR</p>
        <p>MONTEREY JACK  CO-JACK</p>
        <p>w Favorite Four Cheese</p>
        <p>FIRM MICHIGAN</p>
        <p>Fresh</p>
        <p>FOR YOUR HOLIDAY GARNISHING</p>
        <p>ror Grapes ,79^ Fresh Carrots  99^</p>
        <p>FOR YOUR HOLIOAYGARNISHING  A</p>
        <p>F^sh^rsley  3bchs99^</p>
        <p>Fresh Coconuts  3&amp;lt;cr99^</p>
        <p>GOLDEN RIPE</p>
        <p>Pinapples</p>
        <p>FLORIST QUALITY# 6" POT</p>
        <p>f hai^glvlng Mums  aa 6^</p>
        <p>3 BREASTS * 3 LEGS  3 THIGHS  3 WINGS</p>
        <p>Fried Chicken</p>
        <p>GREAT FOR PARTY TRAYS</p>
        <p>Hot Pepper Cheese</p>
        <p>REGULAR OR UNSALTED</p>
        <p>Tortilla Chips</p>
        <p>VEGETABLE  SHRIMP  LOBSTER</p>
        <p>Egg Roiis</p>
        <p>^-5</p>
        <p>ments</p>
        <p>ea.</p>
        <p>up</p>
        <p>FRESH TURNIP</p>
        <p>STOP MUSTARD OR</p>
        <p>lb.</p>
        <p>0000ONLY IN STORES WITH DELI &amp;amp; CHEESE SHOPPE</p>
        <p>MUSTARD OR   STOP OCEAN SPRAY</p>
        <p>Collard I Fresh Greens I Cranberries</p>
        <p>77</p>
        <p>pkg. m m</p>
        <p>FLORAL SVINGS</p>
        <p>4'-  ,</p>
        <p>1"'</p>
        <p>STOP</p>
        <p>Old Milwaukee Beer</p>
        <p>STOP</p>
        <p> 1</p>
        <p>Gallo</p>
        <p>Wines3793479</p>
        <p>BEMrriFULHOunw.ffPOT onrk great for Aa occasions  u</p>
        <p>Poinsettias iiOiUU K^Balloons 1.99</p>
        <p>STOP ^ HESH CUT  STOP F LOiHhT QUAl !TV- T Thanksgiving I  Thanksgiving</p>
        <p>Bouquets!  MumsWe Have A Fine Selection Of Imported Beer &amp;amp; Wine For Vbufi99i UP</p>
        <pb facs="00096780_0163" />
        <p>Regulw PricM May Voy At Some Stores Due To Local Contpewion loyowoy Not Available m All stores</p>
        <p>Our 2.67 Con. Honuy-rooslud pMfuilt fora tasty snack. 12-oz. net wt.</p>
        <p>UmltScoru</p>
        <p>Sale Price Pkg. Nestle mor-</p>
        <p>self; milk chocolate*, semi-sweet** or butterscotch**.</p>
        <p>UmltSpkgs. *1l&amp;gt;/i-oz.netwt. *12-o2.retwt.</p>
        <p>Pkgs.</p>
        <p>Sale Price. Paper goods.</p>
        <p>100.2-ply paper towels or 120,1-ply napkins.</p>
        <p>3.97</p>
        <p>maxell.</p>
        <p>47.88</p>
        <p>UmH2pl(gs.</p>
        <p>A. Sole Price. BkmkVNSvkh eolape. 2-. 4-. 6-hr. record.</p>
        <p>B. Bkmk Nhgrode ape*, 4.97</p>
        <p>Sale Price. DusKNisler "Power Bnisti with 2 motors and crevice tool.</p>
        <p>*VHS EXT-120 NGXfl20(M-giade)</p>
        <p>9338</p>
        <p> MAKE USE OF OUR CONVENIENT LAYAWAY PLAN! S</p>
        <p> SPECIAL HOLIDAY SHOPPING HOURS AT EVERY STORE</p>
        <p>VBA</p>
        <p>m</p>
        <p>&amp;gt;5 10 25 50 &amp;amp; 100 GIFT CERTIFICATES ARE GREAT FOR HOLIDAY GIFT GIVING!SALE STARTS SUN., NOV. 22; ENDS WED., NDV. 25</p>
        <p>1 (1-4 &amp;amp; 5 EXC. FLA &amp;amp; 7-14 &amp;amp; 16) PROG. 1-2 AND 1 (1-2 ft 4-5 EXC FLA ft 7-14 ft 16) PROG 5</p>
        <p>fa</p>
        <pb facs="00096780_0164" />
        <p>Rustler Pairs Up With Steeplechase</p>
        <p>RUSTLER CORDS PREWASHED JEANS</p>
        <p>Our 13.97 Ea. Mens cor- Our 14.97 Ea. Mens pre-duroy pants of rugged  washed Rustler jeans in 4</p>
        <p>cotton/polyester with 4-  pocket western styles. Of</p>
        <p>pocket western style cut. comfortable cotton. Our22.97,MensRustlerJacketsOfCottonDenim ... 18.97</p>
        <p>SPORT SHIRTS</p>
        <p>CASUAL SHIRTS</p>
        <p>12.97</p>
        <p>Our 12.97 Ea. Mens casu al shirts of polyester/cotton with pocket, tails. Varied smart plaids or stripes.</p>
        <p>10.97</p>
        <p>Our 13.97 Ea. Mens zip-front hooded sweatshirts of</p>
        <p>cotton/acrylic.</p>
        <p>SI2MS-XL</p>
        <p>6.90</p>
        <p>Save 36%Hc)bc</p>
        <p>Our Reg. 10.90 Pr. Womens smart-looking fashion skimmers work from dawn fill dark with all your casuals - pants, jeans or skirts! Delicate scalloped topline adds a touch of finesse. In versafile colors like black, taupe, red or navy blue. At this savings, pick up several.</p>
        <p>9.90 Save 41%</p>
        <p>Our 16.90 Pr. Mens casual leisure boots of</p>
        <p>genuine suede leather with padded insole. Tan in Reg. width or rust in wide-width sizes.</p>
        <p>2A (4-6 9 12-14) PROG 1-2 AND 2A (4-5 &amp;amp; 12-14) PROG 5</p>
        <p>Ji</p>
        <pb facs="00096780_0165" />
        <p>Holiday Dresses To Brighten Your Day</p>
        <p>4.99</p>
        <p>SREAT STYLES *12</p>
        <p>Our 16.66 And 17.77. Fashion dresses in festive styles In time for The holidays! Choice of colors. Jr./misses sizes 3/4-19/20.</p>
        <p>WOMENS SIZES</p>
        <p>Wmieii^ Sizes</p>
        <p>k- Pi I' -Ji</p>
        <p>Our 18.97-21.97. Flattering styles for the holidays and beyond, all in the colors and patterns of the season. Womens sizes 36-44.</p>
        <p>Available In stofes with Dtess Dept</p>
        <p>Our 6.97. lUrtlenecks to accent your favorite sweater. Choice of fashion colors. S-XL.</p>
        <p>2.77 T. 3.97</p>
        <p>Our 3.97-5.97 Pr. Womens arylic knit gloves.</p>
        <p>Choose from styles with vinyl or suede-leather appliques. Protect your hands from winter winds.</p>
        <p>4.77</p>
        <p>Our 6.97. Handy tote bog, perfect for carrying books, exercise gear and more. Choose from variety of colors. Quality and value from your K mart!</p>
        <p>3A(4&amp;amp;13) PROG 1-2 &amp;amp; 5</p>
        <pb facs="00096780_0166" />
        <p>Boys And Jr. Boys Holiday Dressing</p>
        <p>Our 12.97.2'pc. vest/shirt sets of</p>
        <p>polyester/cotton/acrylic In choice of colors dr patterns. Jr. boys sizes 4-7.</p>
        <p>Sfvte may vofv $</p>
        <p>Out 11.97. Baited Mil diess slacks</p>
        <p>Of polyester/cotton In choice of colors. Jr. boys sizes 4-7.</p>
        <p>Our 16.97. English Glen 2-pc. sweater vest/shirt sets In variety of colors for the coming season. Boys 8-18.</p>
        <p>Our 13.97. English Glen twill dress slocks of polyester/cotton in choice of colors. Boys reg., slim sizes 8-14.</p>
        <p>Our 8.97*11.97 Eo. Girls fashion separates.</p>
        <p>Choose casual fleece tops of polyester/acrylic in the latest scene-stealing colors, some print styles. Coordinate with denim skirts or jeans of cotton for the hottest looks during cool days ahead. In sizes 4-6X. Shop K mart today.</p>
        <p>Oe%OFF</p>
        <p>A90urReg. 13.97-19.97 Holiday dresses in variety of pretty styles and colors, some with decorative trim. Infant girls sizes 12-24mos., toddlers 2-4.....10.47*14.97</p>
        <p>Our 4.97 Ea. Gitano thermal tops or bottoms in variety of fashion colors. Polyester/cotton. S-M-L-XL.</p>
        <p>4A (4-5) PROG 1-2 &amp;amp; 5</p>
        <pb facs="00096780_0167" />
        <p>Mfr.s</p>
        <p>Sug.</p>
        <p>List</p>
        <p>Prices</p>
        <p>OFF</p>
        <p>Timex Watches In Many Styles</p>
        <p>Selection of fashion watches for him or her. Beautiful analog and LCD styles for dress or casual wear, many with precision-accurate quartz movement.</p>
        <p>Lady Remington WER4000 shav</p>
        <p>with handy travel case 19.97</p>
        <p>XLR920 worldwide rechargeable shaver with travel case 36.97</p>
        <p>XLR800 electric shaver with Micro</p>
        <p>Screen shaving head  .....24.97</p>
        <p>Men's Remington Triple Action electric shaver. PM750 .....  17.97</p>
        <p>Powder, 2.37 Replacement Screen, 3.97 Replacement Screen/Cutter, 9.97</p>
        <p>HPl 328E rechargeable quick-  Men's  rechargeable cord/cordless</p>
        <p>charge Rotatroct shaver 52.97  shaver  950RX............59.97</p>
        <p>Men's Norelco Rotatract electric  550TL  Tripleheader razor with uni-</p>
        <p>shaver Model 650RL ......36.97  versal  voltage  ,  23.97</p>
        <p>Comb And Cutter, 11.38 Comb And Cutter, 14.88 New Heads, 16.97</p>
        <p>  -..... HP1917/3 (Of models SMUanddSOIX</p>
        <p>HP19)2/3 lof 3 head models e</p>
        <p>HP19I5 to* Rotol'oct models</p>
        <p>6.88  5.88</p>
        <p>Sale Price. Jewels of the Sea'makeup kit. Maybelline"</p>
        <p>Sale Price. Moon Shadows eye shadow Mt. Maybelllne.</p>
        <p>Sale Price. Petite hair organizer and</p>
        <p>twin organizers.</p>
        <p>Sale Price. Lady Stetson cologne spray, l-fi.-oz. size.</p>
        <p>Sale Price Ea. Fabuious takes of top name designer fragrances. 1 oz.*</p>
        <p>n 0/</p>
        <p>6-1 (4) PROG 1-2 &amp;amp; 5</p>
        <pb facs="00096780_0168" />
        <p>6.97</p>
        <p>Sale Price Ea. Battle Beast vehicles in choice of battling designs. Buy!</p>
        <p>68.86</p>
        <p>39.77</p>
        <p>A. Sale Price. My Talking Computer teaches basic skills. My Talking Computer Modules, 13.86</p>
        <p>.O a.o'ao'e 'n qi s'O'es</p>
        <p>Sale Price. Laser Tag StarBase fires infrared bearr^nd keeps score.</p>
        <p>44.870</p>
        <p>B. Sale Price. VideoSmarts</p>
        <p>video learning system. Save! VideoSmarts Tape .. Ea., 14.96</p>
        <p>%o* o.a-iQDie *n Oil scores</p>
        <p>57*87puMMEq^</p>
        <p>C. Sale Price. Electronic Talk n Play learning toy. Value! Book And Cassette 8.87</p>
        <p>39.83</p>
        <p>D. Sale Price. Speak &amp;amp; Moth.</p>
        <p>3 levels of challenge to grow with your children's ability.</p>
        <p>32%</p>
        <p>Our 37C Ea. 'First Color coloring books in choice of 6 titles. Hours of tun.</p>
        <p>Save 38% Our 1.97 Ea. Christmas color and activity book</p>
        <p>with 320 pages of tun.</p>
        <p>39.83</p>
        <p>, 11 \ </p>
        <p>E. Sale Price. Speak &amp;amp; Music</p>
        <p>teaches pitch and rhythm fundamentals. Fun to play.</p>
        <p>24.97</p>
        <p>F. Sale Price. Lesson One with 10 learning activities including math, music and more. Save!</p>
        <p>\</p>
        <p>54.96</p>
        <p>V</p>
        <p>G. Sale Price. Talking Whiz</p>
        <p>Kid teaches many subjects. Talking Whiz Kid Cartridge. 11.97</p>
        <p>''if'</p>
        <p>&amp;gt; : ^ %</p>
        <p>- r  \</p>
        <p>5.97 Your Choice</p>
        <p>Sale Price. Kitchen sets tor many hours of make-believe tun. Corning Vi/are cook 'n serve set, Revere cook-and-serve set or microwave cookware just like moms.</p>
        <p>Not available in all stores</p>
        <p>6.97</p>
        <p>Justin</p>
        <p>H. Sale Price. Mickey Mouse calculator with 4 moth functions. LED readout and more.</p>
        <p>Sale Price. Table and chair set</p>
        <p>featuring Sesame Street character designs. Great gift tor Christmas.</p>
        <p>Unassembled in coilon</p>
        <p>6/7(1 6 3-9 ft 11-14 616)PROG 1-2 AND6/7 (1 ft 4-5ft 7-9ft 11-14 ft 16 PROGS</p>
        <pb facs="00096780_0169" />
        <p>10.88</p>
        <p>Sale Price. Sketch-A-Doo-</p>
        <p>die battery-operated* drawing toy. Shop today!</p>
        <p>Sale Price. Kaleid A-Sketch. Kaleidoscope and creative drawing.</p>
        <p>Holly or pine wreath.</p>
        <p>22 " size to decorate door, fireplace or wall.</p>
        <p>While quantities lost</p>
        <p>Holly or pine garland</p>
        <p>in 9-ft. length. Adds perfect finishing touch.</p>
        <p>Musical porcelain angel or Santa Claus</p>
        <p>adds festive touch.</p>
        <p>While quantities lost</p>
        <p>While quantities lost</p>
        <p>Sale Price. Etch-A-Sketch helps develop hand/eye coordination.</p>
        <p>Sale Price. Etch-A-Sketch</p>
        <p>drawing and game center with cassette. Value!</p>
        <p>-.n' SuteiL..-'.v</p>
        <p>gOfiSi</p>
        <p>2.88 Save 27% Our 3.97 Pkg. Christmas cards in pkg. of 20. Variety of festive designs.</p>
        <p>2.97 Save 25%</p>
        <p>Our 3.97 Pkg. Christmas cards. Box of 32 in most-popular holiday designs.</p>
        <p>Save 23% To 26%. Holiday wrapping needs in choice of festive designs</p>
        <p>Our 1.17.3-ribbon Reel..........86C  Our  1.57, Bag Of 10 Bows........1.16</p>
        <p>Our 1.27,3-pc. Gift Cards........966  Our  2.97, 30 Roll* Gift Wrap 2.26</p>
        <p>Our 1.27,18-pc. Gift Trims .......966  Our  3.97,3 Rolls ** 30 Wrap 2.96</p>
        <p>60 sq II *70sq (1</p>
        <pb facs="00096780_0170" />
        <p>^D^ER A Name Brand You Can Trust</p>
        <p>12.9</p>
        <p>19.63</p>
        <p>m</p>
        <p>Sale Price. Steamer unwrinkles doming. Dual voltage for world travel.</p>
        <p>IS60</p>
        <p>Sale Price. 5&amp;lt;qt. eoQker/ fryer/steamer with thermostat control, fry basket.</p>
        <p>03-1705-32</p>
        <p>I- [</p>
        <p>79.97 Toaster Oven</p>
        <p>Sale Price. Spacemaker toast-r-oven</p>
        <p>holds 13x9^ baking pan. Bakes, toasts, broils. Heat-guard mounting system.</p>
        <p>S02S00</p>
        <p>29.97</p>
        <p>Our 36.97. Cordless Handy Knife. 3 attachments store In recharging base. Convenient and powerful for peeling, slicing.</p>
        <p>HK30</p>
        <p>19.97</p>
        <p>Our 24.88. HandyOpener cordless can opener automatically walks around lid to open can by Itself. Auto-shut-off feature.</p>
        <p>KEC10</p>
        <p>27.77 Mixer</p>
        <p>Sale Price. HandyMixer cordless beater features 2 speeds and 4 attachments. Wall-mount storage/charger base. Save!</p>
        <p>Can opener plus opens cans, bottles, jars, bags. Mounts under cabinet.</p>
        <p>05600 Rebate limited to mff s slipulalion</p>
        <p>29.97</p>
        <p>Sole Price. 15 fry pan</p>
        <p>wim nonstick cooking surface, high-dome cover.</p>
        <p>0615</p>
        <p>Were Cooking With Savings</p>
        <p>Mighty Sisler. Convenient food browner for use in microwave ovens.</p>
        <p>Nordic Micro-Go-Round</p>
        <p>turntable features pressure-activated start/stop.</p>
        <p>^89 SHARP</p>
        <p>Sale Price. V2-pint microwave oven in compact cube design. 15-min. dial timer. 0.5-cu.-ft. size.</p>
        <p>R4075</p>
        <p>8-3 (4) PROG 1-2 fit 5</p>
        <p>166 QSGoldSlxir Microwove oven with rotating turntable, variable power from 65-650 watts. Auto-delay start.</p>
        <p>ER6S3M I.Ocu tt</p>
        <p>Microwave tender cooker cooks with gentle pressure. 2V2-qt. size.</p>
        <p>Sale Price Ea. Handy containers in variety of sizes. Microwave safe.</p>
        <pb facs="00096780_0171" />
        <p>188</p>
        <p>21.97</p>
        <p>Portable color TV with AM/FM radio, AC/DC* operation. Savings!</p>
        <p>KRB1S41 Botteiies die extra</p>
        <p>Sale Price. Portable black-and-white TV with AM/FM stereo radio.</p>
        <p>KMA-0S06 Batteries are extra</p>
        <p>Sale Price. Personal AM/FM stereo radio with cassette player.</p>
        <p>3-5422 Batteries extra</p>
        <p>Sale Price Ea. Christmas LP*s or cassettes by</p>
        <p>favorite artists including Johnny Mathis, Elvis Presley, Bing Crosby and many more. Holiday value!</p>
        <p>Table/desk phone</p>
        <p>with tone/pulse signal, hold button, more.</p>
        <p>mi</p>
        <p>Rebate limited to mli s slipulaiion</p>
        <p>Your Choice. Desk or wall phone with tone/ pulse signal, more.</p>
        <p>SW3502/SW2502</p>
        <p>Rebates limited to mti's stipulation</p>
        <p>39.97</p>
        <p>Our 49.96. Mighty Mini vac</p>
        <p>with handy attachments. Lightweight, portable.</p>
        <p>3-speed Electrikbroom</p>
        <p>with multipower suction, edge cleaning, more.</p>
        <p>SHB7839 Rebate limited to mti i stipulation</p>
        <p>56.66</p>
        <p>Sale Price. Steamer for</p>
        <p>carpets. With spot release applicator. Save!</p>
        <p>S2 78 Rebate limited to mii $ stipulations</p>
        <p>9-3(4) PROG 1-2 &amp;amp;</p>
        <pb facs="00096780_0172" />
        <p>28.97</p>
        <p>Energy-efficient Ceiling Fans</p>
        <p>28.97</p>
        <p>A. Sale Price. 42" flush-mount ceiling fan</p>
        <p>with 4 wooden blades; white, antique- or polished-brass finish. Light adaptable.</p>
        <p>style and mfr. may vary Light Mt not Included</p>
        <p>C. Sale Price. 42" close-to-ceiling fan</p>
        <p>with white or antique-brass finish and 3-speed reversible rhotor. Light adaptable.</p>
        <p>style and mtr. may vary light kit not Included</p>
        <p>17.96</p>
        <p>34.96</p>
        <p>B. Sale Price. 36"down-rod ceiling fan</p>
        <p>with 4 wooden blades, reversible motor. Light adaptable. In white or brown.</p>
        <p>Slyle and mir. may vary light Mt not Included</p>
        <p>D. Sale Price. 52" flush-mount ceiling fan</p>
        <p>with antique-brass or white finish and 3-speed reversible motor. Light adaptable.</p>
        <p>style and mil. may vaiy UghtMlnotmckided</p>
        <p>Make Any Room More ComfortabI</p>
        <p>P0DGSON</p>
        <p>13.88</p>
        <p>Our 18.88. Robeson fan</p>
        <p>with 750/1500 watts, rotary switch, signal light. Value.</p>
        <p>2724</p>
        <p>29.99</p>
        <p>Our 36.88. Lakewood heater</p>
        <p>with 1200/1500 dual wattage, rocker style heat switch.</p>
        <p>415</p>
        <p>P0DSON</p>
        <p>49.97</p>
        <p>Our 59.97. Robeson radianf/con-vection fan/ heater with 5 heat combinations. 450-1500 watts.</p>
        <p>3-2714</p>
        <p>Press-ln-Plice Caulk T </p>
        <p>10.77  3.57</p>
        <p>Sale Price. Outdoor window insulation kit. 62x110"-size film.</p>
        <p>Buy 2 insulating Mis and lecelve</p>
        <p>Sale Price. Press *N Place caulk In 20'</p>
        <p>roll. Paintable.</p>
        <p>2.77  4.47</p>
        <p>Sale Price. Moisture-resistant clear tape In 1V2"x30'roll.</p>
        <p>Sale Price. Window weotherstrip helps seal out cold air. 20'.</p>
        <p>9.97  3.77</p>
        <p>Sale Price. Outdoor patio door insulation. 84x112" film.</p>
        <p>Sale Price. Outdoor window film tape.</p>
        <p>V4"x38.8 yd. Save.</p>
        <p>Sale Price. 3-pack storm window Insulating kit with tape.</p>
        <p>29.91</p>
        <p>Sale Price Ea. Automatic thermostat control; sq. or round.</p>
        <p>Siyl. and mti may vary</p>
        <p>lOA (4 &amp;amp; II) PROG 1-2 8(5</p>
        <pb facs="00096780_0173" />
        <p>69.97</p>
        <p>Sale Price Ea. Molded or metal truck box for full or mini trucks. Qualify built.</p>
        <p>Sold In moit Spoiling GoocbDept</p>
        <p>159.97  9.97</p>
        <p>Sale Price. Universal molded truck bed liner.* Special Orders, 179.97</p>
        <p>style and mil may voiv VMmiollgale</p>
        <p>pfoloctoi</p>
        <p>Carryout</p>
        <p>Sale Price Ea. Gas-charged shocks. For many cars. Von/Druck Shocks, Ea., 11.97</p>
        <p>mitollatlon ovodable in stoies wim seivlce24.96</p>
        <p>Ansco</p>
        <p>Sale Price. Ansco gift outfit features compact focus-free 35mm camera, built-in flash. 12-exp. print film, batteries, case.</p>
        <p>11 (1-9 &amp;amp; 11 &amp;amp; 15-17) PROG 5 AND 11 (1-2 &amp;amp; 4-5 &amp;amp; 7-9 &amp;amp; 11 &amp;amp; 15-17) PROG 5</p>
        <pb facs="00096780_0174" />
        <p>Son SkxM WMl Not to Open Sun., Nov. 22 Due Ib Ceilain Local Oidlnanoes. In That Event, Moonlight Madness MWI to Held On Mon. Evening, Nov. 23</p>
        <p>'T^^'Americas Bnorite Store</p>
        <p>iktStuitrijPtm</p>
        <p>PRIZES AND 3 HOURS OF FUN</p>
        <p>ENTRY BLANK FOR PRIZE DRAWINGS</p>
        <p>State,</p>
        <p>Limit one (1) entry blank per person</p>
        <p>No PuiciMM Nececray. 1b enter, im out the official entry bkmk, tcfcelttoyouK mart store and deposit It In the entry box on Nov. 22,1967. Official tulef ore on me entry box. \Md where prohibited. Sweepstakes open to U.S. residents who are 18 years or older, limit one (l)entiy per person.</p>
        <p>nUEUOHTSPICIAU</p>
        <p>During this 3-hr. tale, there will be 6 Blue Light Speciats - one every 20 minutes. Enjoy the fun and take advantage of the opportunity to save.</p>
        <p>DOOR PRIZES</p>
        <p>rowSSSK mortgrncMimoilM.</p>
        <p>DratMlng to !&amp;gt; held 20 mln. befor* closing. FUNANDRRRESHMENTS</p>
        <p>Don't miss this exciting family event full of special values. Come one. come all to shop on this special evening. Enjoy coffee and punch . . . freel</p>
        <p>Mb. Whitmans Sampler Candy</p>
        <p>On Sale</p>
        <p>5 PM lb</p>
        <p>6 PM</p>
        <p>3</p>
        <p>Limit 2</p>
        <p>66</p>
        <p>Choice Of GE Telephones</p>
        <p>On Sale</p>
        <p>5 PM To</p>
        <p>6 PM 29040/41/42/43/44/46</p>
        <p>sq.-6.Roll Gift Wrap</p>
        <p>On Sale</p>
        <p>6PM OOV</p>
        <p>1b</p>
        <p>7PM</p>
        <p>88</p>
        <p>Astronaut Barbie Doll</p>
        <p>On</p>
        <p>6</p>
        <p>97</p>
        <p>Christmas Bows</p>
        <p>Umlt2pkgs. IV</p>
        <p>29</p>
        <p>Television</p>
        <p>On Sale</p>
        <p>7 PM</p>
        <p>lb ,__</p>
        <p>8 PM 161212/181210</p>
        <p>Umiti $</p>
        <p>39</p>
        <p>Our 7.97 Pkg. 6 pit. mens sport socks of</p>
        <p>cotton/polyester.</p>
        <p>,.Mir. may vary FitilzM 10-15</p>
        <p>Solo Price Pkg. Littio Dutch Boy cookies;</p>
        <p>fancy varieties.</p>
        <p>5-oz.-rwtwt</p>
        <p>Sale Price Pkg. Cor* nation hot cocoa</p>
        <p>mix;12-oznetwt.</p>
        <p>IpXceofllavott</p>
        <p>Sale Price Ea. St. Ailkm sparkling lulceorspumontl.</p>
        <p>/Ucohoi-irM:2SV4fl.oi.</p>
        <p>Sole Price Roll. 12"k25olunilnum foil for many uses.</p>
        <p>Mft.tnoyvorv Umlt2iolli</p>
        <p>SalePrice. Pkg.of 20 Happy HoHday cups; clear plastic.</p>
        <p>9-or.it</p>
        <p>Our 4.57-4.97 Pkg. 5prs. misses, girls siMMtfube socks.</p>
        <p>GMi' fit liras Wh, Misws' m9-II Mfrmay vary</p>
        <p>Adorn hair spray In</p>
        <p>choice of formulas; 9* oz.-net-wt. each.</p>
        <p>Pric* bafora mir.'s $4 rebate wim purchase of 2</p>
        <p>Sale Price Ea. Palmolive dish soap; 22 fl. 02.</p>
        <p>limit 2 of each lotrrHila</p>
        <p>Sale Price Ea. Copper BrHe polish for copperware; 16 02.*</p>
        <p>EI.OI.</p>
        <p>7,97.,.</p>
        <p>Our 11.96. Kitchen Are extinguisher for</p>
        <p>quick fire control.</p>
        <p>KFE2-2IC</p>
        <p>97*sr</p>
        <p>Our 1.37 Skein. WIntuk</p>
        <p>yam of Orion acrylic: Solids* or ombres.**</p>
        <p>*DuPonttog.TM *4-oi.-nelwt. *3'A-oz-netwt.</p>
        <p>12A (2-8 ana 13-14) prog. 1-2 and i2a (2 a 4-5 a 7-8 &amp;amp; 11 a i3-i4) prog. 5</p>
        <pb facs="00096780_0175" />
        <pb facs="00096780_0176" />
        <p>\bur Cost After Rebate</p>
        <p>Your Choice: Conair Curling Iron or Mini Curts Curling Iron. Rebates make it a super deal! iCost After</p>
        <p>A. FuU Size 1500 Watt Hair a Lighted Makeup  OG. Assorted Cuilifig</p>
        <p>Dryer. #VS-207.  Minor.  #VS^70.  Irons  and  Brushes.</p>
        <p>iSale Price..........14.99  Sale Price..........22S8  Sale Price...........&amp;amp;99</p>
        <p>992d. Mfr. Rebate.........-SuOO  Mfr. Rebate.........-SM  Mfr. Rebate.........~2JOO</p>
        <p>BonusRebale.......-2j00  Bonus Rebate.......-2j00  Bonus Rebate 2M</p>
        <p>799 Cost After Rebate 1598 Cost After Rebate 299</p>
        <pb facs="00096780_0177" />
        <p>mpe Someone</p>
        <p>I</p>
        <p>1*^ '</p>
        <p>17SS  1088</p>
        <p>Chaps om Sat with  Chaps IS oz. Aflar-  Chaps 1 oz.</p>
        <p>IS oz. cologne and  ahava and Cotogne.  shava and cologna.</p>
        <p>deodorant A HSvahial  AI25S0 vahial  A $14 valual</p>
        <p>A.  a</p>
        <p>Lady SiPlaon OolqpM Lady Stetson SpiayFowder om Set.</p>
        <p>A *22 value.  Set.  A  value.^</p>
        <p>Entile Stock of Ctaia Fragranoe Products.</p>
        <p>includes cologne sprays, body silk, and dusting pGwdet</p>
        <p>ladi  Choice</p>
        <p>^ Jbiever Krystts Spray or Carrington Pour</p>
        <p>Stoekl^stufl^ size. Save big on . efptotoi. iwiprncea. </p>
        <p>IMDK</p>
        <p>CfemeNsH  ^</p>
        <p>Enamel. Ail  ^</p>
        <p>shades on sale: Regular 2JS.</p>
        <p>iMh Ml  laoh  1499.</p>
        <p>^ dem CM Ihv wito rntrior OoMbi Brueh end Mnor Set ttotloifi.Miksee beautiful gift Mtotate design. Perfact corn-for aomaone special.  pMenttotray.</p>
        <p>uoKT fsacxiaae wiui Iraealet Aaaedment of NfeetfftkM</p>
        <p>LsJardin* Fragrance Candle Tin. Burning candle releases the beautiful scent of Le Jardn.</p>
        <p>Reg. 14.99</p>
        <p>Large Coemetlc Bag with fittings. Conveniently holds your makeup and accessories.</p>
        <pb facs="00096780_0178" />
        <p>jm</p>
        <p>DMISIDIISqUitiStue</p>
        <p>Each\bur Choice1MM&amp;gt;p Christmas Hm.</p>
        <p>Attractively ^ decorated and ready lo erijoy. Topped with ball or star ornament.</p>
        <p>homs.</p>
        <p>aii^ McIl Atimi^ live nonie aoootr ^sofyaRyaar'Iong. Rm.3M. ;;</p>
        <p>Aeeoflid IMn Houaaa. Four pratty styles to choose from. Nice decoration for the holiday season.</p>
        <p>Wooden Radpa Box. Includes blank cards. Perfoct way to organize your favorite recipes.-Buy now.</p>
        <p>Otonewaia Candto HoM. Comes with pretty Chrislmas design painted on the front. Nice gift. Aesortment of selected designa</p>
        <p>ilblomite Snowhouae Night Ught. Pretty blido decoration thats also practical. Regular pdcaW.</p>
        <p>Country Style MaH Box. Attractive woven design. Regular ^2.</p>
        <p>* IBniatuia Mail Box, aale price 3J9.99</p>
        <p>Earthanwaia PigtatlM. Four assorted styles. Each comes in its cam basket. Coliect aH four now.</p>
        <pb facs="00096780_0179" />
        <p>'iiig gi^ts</p>
        <p>\</p>
        <p>X</p>
        <p>EMlhamm PVMlad IHm Set Set of twiD (Mte puppies. C)ne sicvKis wMe the other SMS. Buy now for ChristmM.</p>
        <p>PtakBegence</p>
        <p>covered bOK, mini</p>
        <p>Buy a Whole Set!</p>
        <p>Six atiiaclive pieces inchng pump atomizer, picture frame, bud vwe. or mini hurricane lamp.</p>
        <p>AMiy.WNIiiihhol-</p>
        <p>HMM tM OMi HoMw. OnM oonvIM th cm. &amp;lt;lln*lB.Yeurclieleot&amp;lt;low.Bi&amp;lt;Mtr|iile*4 </p>
        <p>JOiyMI CMdto ailefci. euaan biii In Wi Ml. BwiglJt Wrtdl W wan m llw Iwwi. w</p>
        <pb facs="00096780_0180" />
        <p>?Jli6 ^itcten</p>
        <p>GREAT FOR THE HOLIDAYS</p>
        <p>OO</p>
        <p>%Z</p>
        <p>A. Ceramic Butter Holder  .............  Sale  Price  3.99</p>
        <p>B. 4-piece Ceramic Canister Set with wording  ..... ..:.....Sale  Price  16.99</p>
        <p>C. Ceramic Salt and Pepper Shaker Set with wording ...................Sale Price 2.99</p>
        <p>Ciiamie Mug with painted flower dIporBlion. Several styles to / </p>
        <p>cm Iron KetUe HumldNier. Z5 quarts. Adds moisture to dry air in your home.</p>
        <p>Stoneware.  Sidt APepper 8il. Reg.</p>
        <p>II</p>
        <p>appii-l^off and on witha</p>
        <p>Cotjf Copper Tee Pot Welcome addHon to any homes kitchea ^. 12J8. Sees 3.00</p>
        <p>19</p>
        <p>M ebeautiM icere ae I burns. H Tureen. Great for holiday meals. Nice for any room.  ill  S9t &amp;amp; Pepper Set Sale 4.99</p>
        <p>Baeh</p>
        <p>Copper Butter Wanner. Burning candle melts butler perfoet^ for aN yout redpes. Reguiw AOO. * s</p>
        <p>i9</p>
        <p>Your</p>
        <p>SoU Copper KMehenwaree. Your choioe of simmer pot, recipe box or , rnirfo pirieappfo mold. Deoorato your Mtdien with matt^^</p>
        <p>a^.JnrtI.ILaB-BajMna.</p>
        <p>3l</p>
        <p>Rag. 30.99 Save $10,Op, Max Pood Pith 02000 iforxv kb*</p>
        <p>PilBtO* Popcorn Now Plue Hot Popper. Model #04820. Fbr</p>
        <pb facs="00096780_0181" />
        <p>A</p>
        <p>Your</p>
        <p>Each Choice</p>
        <p>Seat Conair^ Kitchen Appliances. Choose a 2-sHce toaster, automatic can opener, or 5-speed jnixe^i Make kitchen work easier.</p>
        <p>Twenty-piece Dinnerware Set Called The Joy of Christmas, this is the perfect complement to any holiday</p>
        <p>Each</p>
        <p>stoneware Christmee Mw. 11</p>
        <p>ounce size. Assorted holraay d^ns. Buy aeveral now.</p>
        <p>renpwa'sst Jndudss EMiy-you need to make your favorite meals.</p>
        <p>rmCmikPmm^ NPTofvercrllEhiM Not Tapper. 6waiy  viOh  moltod  txjliar.</p>
        <pb facs="00096780_0182" />
        <p>Qi^tg Qahitel</p>
        <p>II</p>
        <p>V s;fBrass Candle Holders</p>
        <p>A. Candle Holder with Glass Cover, SALE 3.99.</p>
        <p>B. Church Candle Holder, SALE 4.99.</p>
        <p>C. House Candle Holder, SALE 4.99.</p>
        <p>D. Bugle Candle Holders, 3-pc. set, SALE 7.77</p>
        <p>Ctfamic Hurricane Lamp. Three assorted designs. PBrfoct decoration</p>
        <p>for Christmas.</p>
        <p>Wooden neindeer. Set of tna One stands while the other sits. Adds tots of holiday spirit to your home.</p>
        <p>Decorative Whaath with candfo. Buy several at this price to decorate your whole home.</p>
        <p>MM Country Lamp. Electric. Ybur choice of four assorted style&amp;amp;</p>
        <p>Badi</p>
        <p>nngertip Ihwel with Christmas cross stitch design. Several st^l^JPret^jioMa^aora</p>
        <p>flfotceleln ChrMniae CanBe  || fforcealnwere Bon Bon OWi. Rwr</p>
        <p>HoMeia^ Set of four holders with  || assorted shapes. Psrlsct for holiday</p>
        <p>Icandlaa.  ||  candy serving.</p>
        <p>lach</p>
        <p>Solid Oak Coaster Set. Set of</p>
        <p>six. \bur choice of three styles. Buy now.</p>
        <pb facs="00096780_0183" />
        <p>feetoc^fiwifemGnt</p>
        <p>SalePrice........... .24:99  j</p>
        <p>Mfr. Rebate  ............-&amp;amp;00</p>
        <p>Bonus Rebate *  ...........-ROO</p>
        <p>^^ 4M</p>
        <p>Conair Tone/Pulse Phone. Perfect for desk or wall. Choice of 3 fashion colors. Save big with rebates.</p>
        <p>sorry:</p>
        <p>A. Sony* a Sony*</p>
        <p>C. Sony*</p>
        <p>D. Sm^</p>
        <p>E.Sony*</p>
        <p>Black FM Wallanan...........  .SALE  PRICE  UM.</p>
        <p>Microphone.....................SALE PRICE Ma</p>
        <p>Stereo Head Phones  ..........SALE PRICE 7J7.</p>
        <p>AM/FM Digital Clock Radio SALE PRK%</p>
        <p>Monaureri Boom Box  SALEPRICE</p>
        <p>IDEAS!!</p>
        <p>598 no</p>
        <p>Kodak* KMNCVR35</p>
        <p>Camera. Takes beautiful 35mm pictures. Regular price 7M9.</p>
        <p>Kodak nim $1jOO MaH-Ui Rbate On Puichase of 2 Rolla</p>
        <p> VR-Q100 CA 135-24, SALE 2.79.'</p>
        <p> VRO 200 CB no-24, SALE 2.79.</p>
        <p> CVRDiec FHm, 2-pk., SALE 4M.</p>
        <p>Each Choice Emerson* AM/FM Stereo Cassette Player with headphones or AM/FM Deluxe Portable Cassette Player.</p>
        <p>HOjOO OFR</p>
        <p>Qrm Prtoc AMm Stereo with Dual Cassette Deck. Model #C94a Super Christmas gift. Has. 4S9a^%^ ^ '</p>
        <p>TDK8AS0</p>
        <p>apM. 2 por pack. Graat quaWyt</p>
        <p>1burCtiolC8:TDK raoVHSorUSO Bote VMao 1h|)ia.</p>
        <p>25%;</p>
        <p>  - rfcg a ^</p>
        <p>Ejoo ancK 01 lanMR* lIRnm</p>
        <p>Loigo selocdon of meiViB*and ladeo' stytoa</p>
        <p>ANiMlclteancta tfjoo oir lagular fwioe..</p>
        <p>TIMEX</p>
        <pb facs="00096780_0184" />
        <pb facs="00096780_0185" />
        <p>Qite ^oti 0Tfie ^ounge/i Qet</p>
        <p>Each</p>
        <p>Laige selection of Dan Dee Bears. Assortment includes Patches Bear, Dress Up Bears, Color Paws Bears, and more. These cuddly bears make great gifts. Begular price to 9.99 each.</p>
        <p>Each Choice Coleco Staioom Small Land Baaed or Airborne Vshides.</p>
        <p>Lots of playing fun.</p>
        <p>Mail Bactronic Cash Regiatsr.</p>
        <p>BaltBiy opeialad. Buy now for US.</p>
        <p>Blue Box Hm SaL Includes favodie farm aniinals, fence and farmer. Regular price 1099.</p>
        <p>Each</p>
        <p>lUrbo Oorvelte/Rrebird Assort-merit. Almost as much fun as having the real thing.</p>
        <p>l2Sf</p>
        <p>Baby Soft Loss. 13W" high. Great gift for that special little girl. Regular 099. Save $2jOO</p>
        <p>DaNco Ibntflc Uttle Clocic* .</p>
        <p>With quartz alarm. Wear it for funi Assorted styles.</p>
        <p>Each</p>
        <p>Ibddy Baer Fun Pack with assorted cassette tapes. 16 fawDTlte stories for children.</p>
        <p>iM1bolNbruah.QiS Matos brushing</p>
        <pb facs="00096780_0186" />
        <p>QIats Christmas Ornaments.</p>
        <p>8^" or 12-1 %" ornamente. Choice of ckHs. Regular 1.99.</p>
        <p>Sure Action Merry Go Chiietmas Lights. 108 multi-colored lights per set Regular 12.99. Save 94.Q0.la7</p>
        <p>laeh $2.00 Ptanters* Peanuts HoVdav QHl Pack. Serve as holiday snacks or buy as a gift. Regular price 7.49.</p>
        <p>Plus Mark 30* Christmas Wrapping Paper. 100 sq. ft Three roils per package. Regular 3.99.</p>
        <p>CONYBRENT LOCATIONS OF KERR DRU6 STORES. . HAVEL0CK*RE8EARCH HIIANQLE*RALEIQH*CARYQAfVIERWILSON*</p>
        <p>DURHAM  ABERDEEN  ROCKY MOUNT  LOUBBURQ  CREEOMOOR  BUTNER  CLAYTON  CARRBORO  CHAPEL HILL  JACKSONVILLE FAYETTEVLLE*QOL0880ROaREENVILLEOUNN*TARBORO*8HALLOTTE*SANroRO*KM8TON*CHAIILOTTl*WRiQHTSVILLE BEACH*CAPE CAITTERET  PINEHURST  MYRTLE BEACH (BRIARCUFFE MALL)  ZEBULON  BURUNQTON  MOREHEAD CITY  HOPE MILLS* HIGH POINT</p>
        <p>1^8 PWlcHierr Drugs reserves the right to limit quartfities of all iletits. Iterr's PUicy Is to provide you with the Hetiis edvertised at the</p>
        <p>iMoe advertised. However, due to seasonality of some items, Rainchecks wiH not be available tor these Hems.</p>
        <p>DnigStom</p>
        <pb facs="00096780_0187" />
        <p>* ^........</p>
        <p>fr:.^. .V. :-n.v'</p>
        <p>  -D-' - JV ;The Bear Essentials</p>
        <p>l-: ' </p>
        <p>II. rt  .  r</p>
        <p>l  =  D_*.</p>
        <p>' -j ' '..  ' ^'  i</p>
        <p>,.  .  .  .ft  .  </p>
        <p>. I . D , .,r  .</p>
        <p>.= F.-'</p>
        <p>a-. - </p>
        <p>, _KoliS .</p>
        <p>i o '*'1 T</p>
        <p>'4 </p>
        <p>Family Jewelers since 1922</p>
        <p>i*'.' r/</p>
        <pb facs="00096780_0188" />
        <p>Wonderful treasures</p>
        <p>and teddy beofs-</p>
        <p>o TUCK me</p>
        <p>o</p>
        <p>Why settle for an ordinary box when you can wrap your gift in a_ bear hug? The warm and fuzzy Cariyie Gif I Bear keeps your treasure safe and snug untii that speciai moment.</p>
        <p>And imagine the surprise os the bear's spectal secret is discovered by your speciai someonei it's a very iovabie bear and ifs yours free with any item of $199 or more.* Only at Carlyle &amp;amp; Co.</p>
        <p>'Offer good while supplies last.</p>
        <pb facs="00096780_0189" />
        <p>On Our Model:</p>
        <p>Diamond fan earrings. $269 Ruby and didmond ring. $499 Ruby dnd diamond bangle bracelet. $1499</p>
        <p>On Our Bear:</p>
        <p>Classic diamond circle pin, .96 ct. t.w, $999</p>
        <p>In The Background:</p>
        <p>Gold and opdl mosaic earrings. $99</p>
        <p>14K gold "V" earrings. $49 Onyx ring set in 14K gold, $299 Onyx and hematite twisted &amp;gt; -strand, $99</p>
        <p>Onyx and hematite earrings. $29 All merchandise 14K gold unless otherwise noted.</p>
        <p>Fun with sapphires &amp;amp; diamonds</p>
        <p>Emerald and diamond fashion</p>
        <p>mi 1</p>
        <p>IB</p>
        <p>Carlyle &amp;amp; Co.</p>
        <p>Family Jewelers since 1922</p>
        <p>C-L .</p>
        <pb facs="00096780_0190" />
        <p>Twoman's a itte air about her teddy bear</p>
        <p>^arlyle &amp;amp; Co. sparks romance and sets hearts racing with exquisite gifts. Our insistence on superior quality and beautiful designs means you can be sure your gift will delight for a lifetime. Come, rekindle the flame.</p>
        <p>On our Model:</p>
        <p>Diamond stud earrings,</p>
        <p>150 ct. t.w.$2895 18" 5y2mm pearl strand. $299 Mobe pearl attachment. $299 Pav diamond dome ring,</p>
        <p>.76 ct. t.w.$999</p>
        <p>14K gold bangle bracelets.</p>
        <p>Prioed From $159</p>
        <p>Double pearl bracelet. $399</p>
        <p>n The Background:</p>
        <p>Ruby and diamond ring. $499 Ruby and diamond heart attachment. $399 Diamond cut rope chain, 18." $249</p>
        <p>Diamond heart pendant, .25 ct. t.w. $699</p>
        <pb facs="00096780_0191" />
        <p>' ,y</p>
        <p>Family Jewelers since 1922</p>
        <p>D  .    *.  .      "  -'.            ^</p>
        <p>S,.  ^.--  -  -  _.nj__;  .L____.1 .......r</p>
        <pb facs="00096780_0192" />
        <p>Some wome</p>
        <p>eddy bears</p>
        <p>III it animal magnetism. Or an Instinct for fine jewelry that always leads straight to Carlyle &amp;amp; Co., where each exquisite piece Is handpicked from around the world or commissioned exclusively for us.</p>
        <p>Even our Rolex watches* receive special Carlyle attention under our Presidential Service warranty.</p>
        <p>It's the same kind of special, personal attention you'll receive on every Carlyle visit.</p>
        <p>* Rolex watches available in selected markets.</p>
        <p>On Our Modul:</p>
        <p>Ladies twisted rope iD braceiet. $99 14K goid wedding band hoop earrings. $99 Ladies Seiko dress watch. $295 Ladies diamond fashion ring. .50 ct. t.w. $799</p>
        <p>On Our Bears:</p>
        <p>A sampie from our coiiection of iadies dress watches, priced from $95</p>
        <pb facs="00096780_0193" />
        <p>Mng.$699</p>
        <p>TI* toe. $69</p>
        <p>lae^. $499</p>
        <p>Elegant 3-piece gift set includes ball point pen, money clip and key ring. $69</p>
        <p>.. V'S'. ^.1 I  '</p>
        <p>Carlyle &amp;amp; Co.</p>
        <p>Family Jewelers since 1922</p>
        <p>-iy   </p>
        <p>.  J</p>
        <pb facs="00096780_0194" />
        <p>Precious Gifts At Alluring Prices</p>
        <p>&amp;gt; gr-</p>
        <p>Diamond Classics</p>
        <p>mSapphires &amp;amp; DiamondsYour choice $99</p>
        <p>On our cover:  I</p>
        <p>Drop diamond earrings,</p>
        <p>1.15ct.t.w. $1499</p>
        <p>Elegant matching diamond necklace,</p>
        <p>2.65 ct. t.w. $3995</p>
        <p>Diamond cocktail ring, 1.38 ct^ t.w.</p>
        <p>18K. $2995</p>
        <p>Diamond solitaire engagement ring, 1.50 ct. t.w. $6990  ,  pi</p>
        <p>Ladies' 18K Rolex President watch, $6895]</p>
        <p>Vi -HI</p>
        <p>\ "V</p>
        <p>From Our Boor:</p>
        <p>A gorgeous diamond tennis bracelet, 2.00 ct. t.w. $2495</p>
        <p>OurProml$0 To You:</p>
        <p>To guarantoo you $ueh tuporlor $onrteo, quality and valuo that wo may bo worthy ot your high ostoom.</p>
        <p>D. Your choice $169</p>
        <p>Prices in effect through January, 1988 Merchandise eniarged to show beautltui details. All jewelry 14K gold unless otherwise indicated. All diamond weights are approximate.</p>
        <p>Et</p>
        <p>I</p>
        <p>!</p>
        <p>Montgomery. AL</p>
        <p>EastdaleMoll</p>
        <p>(205)277-6799</p>
        <p>Tuscaloosa. AL Univetsity Mall  (205)556-5913</p>
        <p>Jacksonville. FL</p>
        <p>Regency Square (904) 724-4322 Orange Park Mall (904) 269-1816</p>
        <p>Mary Esther. FL</p>
        <p>Santa Rosa Mall (904)244-2510</p>
        <p>Panama City. FL</p>
        <p>Panama City Mall (904) 769-6777</p>
        <p>Pensacola. FL</p>
        <p>University Mall (904)478-1271</p>
        <p>Tallahassee. FL</p>
        <p>Tallahassee Mall (904)385-9242</p>
        <p>Augusta. GA</p>
        <p>Regency Mall (404)790-8854 Augusta Mall (404) 738-9017</p>
        <p>Macon. GA</p>
        <p>Raleigh. NC</p>
        <p>Macon Mall</p>
        <p>Crabtree Valley Mall</p>
        <p>(912)477-7385</p>
        <p>(919)782-5562</p>
        <p>Auburn. ME</p>
        <p>Winston Salem. NC</p>
        <p>Auburn Mall</p>
        <p>Thruway Shopping Center</p>
        <p>(207) 784-1422</p>
        <p>(919) 722-3211</p>
        <p>Charlotte. NC</p>
        <p>Charleston. SC</p>
        <p>Eastland Mall</p>
        <p>Citadel Mall</p>
        <p>(70I) 568-3350</p>
        <p>(803)571-2624</p>
        <p>SouthPark</p>
        <p>Northwoods Mall</p>
        <p>(704)366-4545</p>
        <p>(803)797-2750</p>
        <p>Durham. NC</p>
        <p>Knoxville. TN</p>
        <p>Northgate Mall</p>
        <p>West Town Mall</p>
        <p>(919)286-5495</p>
        <p>(615)693-7060</p>
        <p>South Square Mall</p>
        <p>(919)489 6824</p>
        <p>Memphis. TN</p>
        <p>, Mall of Memphis</p>
        <p>Fayetteville. NC</p>
        <p>(901) 795-6601</p>
        <p>Cross Creek Mall</p>
        <p>(919)864-1220</p>
        <p>Nashville. TN</p>
        <p>Hickory Hollow Mall</p>
        <p>Greensboro. NC</p>
        <p>(615)834-7176</p>
        <p>Friendly Center</p>
        <p>Rivergate Mall V</p>
        <p>Opens November, 1987 (615)859-5004 .</p>
        <p>Four Seasons</p>
        <p>(919)885-6225</p>
        <p>Lynchburg. VA &amp;gt; ,</p>
        <p>Carolina Circle Mall</p>
        <p>River Ridge Mall ,</p>
        <p>(919)621-2300</p>
        <p>(804)237-1828 Ir' '</p>
        <p>Greenville. NC</p>
        <p>Virginia Beach. VA</p>
        <p>Carolina East Mall</p>
        <p>Lynnhaven Mall</p>
        <p>(919) 756-8734</p>
        <p>(804)486-6360</p>
        <p>Policy On Advertised Selections: items ottered are chosen in advance and may not be available in all our staes In the event we are temporarily out of selected items, we will honor the advertised price at a later date or you may purchase an alternate item ot comparable value.</p>
        <p>Carlyle &amp;amp; Co.</p>
        <p>Family Jewelers since 1922</p>
        <p>''"o - '</p>
        <p>I</p>
        <p>Call today arid apply for your Carlyle Charge Card. Just call this toll-free number and tell the Operator you would like to apply for the Carlyle Charge. All the necessary Information will take only a few moments. Please call Monday through Friday 9 a.m. to 9p.m. ESI</p>
        <pb facs="00096780_0195" />
        <p>WEVE GOT ANYTHING YOUR CHILD COULD ASK FORALL AT LOW, LOW PRICES!</p>
        <p>Tons O' Toys MaD vakw coupons to be used as  cash on aiv purchase at any Tons O' Toyslocalioa</p>
        <p>Tons O'Toys value coupons and mfg,</p>
        <p>I forms available at an Tons 'Toysslorei l(Vahie Coupon Good For Merchandise Onl^</p>
        <p>SHOP SUNDAY</p>
        <p>MON.-SAT. 9 AM-10PM SUN. 1-6 PM</p>
        <p>(S.C. Stores 1:30*6 PM)</p>
        <p>(Some stores not open on Sundays)</p>
        <p>RECHARGEABLE BATTERY-POWERED</p>
        <p>JEEP' RENEGADE</p>
        <p>No. PP982 - Reg. $199.97. Comes with batteries and recharger, hood and tailgate open and close, automatic brake, CB microphone &amp;amp; more!</p>
        <p>Sf^VE</p>
        <p>ii;:"</p>
        <p>*351</p>
        <p>TONS O' TOYS WILL NOT BE UNDERSOLD ON ANY ADVERTISED ITEM IN STOCK</p>
        <p>Bring any local print ad into Tons O' Toys and we will nieet the advertised price. Advertisement must show sale dates. We reserve the right to Kmit quantities. Excludes catalogues, discontinued or closeout merchandise. No rainchecks.</p>
        <p>CHARGE IT!</p>
        <pb facs="00096780_0196" />
        <p>50% OFF</p>
        <p>DOLL HOUSES WITH niRHITURE</p>
        <p>12 Piece Set  Now</p>
        <p>17 Piece Set...................NOW  *24*^</p>
        <p>PLASTIC TEA</p>
        <p>SET No. 3030-9 26 Piece set-Servicefor4.</p>
        <p>$^9:</p>
        <p>EUREKA</p>
        <p>TOY</p>
        <p>VACUUM</p>
        <p>CLEANER</p>
        <p>No . 9060-</p>
        <p>DUHCAH HIMES TASTYBAKE"* OVEMfJ AQ7</p>
        <p>No. 3608 - Reg. $27.97</p>
        <p>Electric oven that  "  ^</p>
        <p>really works! Comes complete with cake</p>
        <p>pan, cookie sheet cookie cutters, cookbook</p>
        <p>&amp;amp;more!</p>
        <p>SILVERSTONE COOK *N SERVE</p>
        <p>SET No. 3037-9 39 piece set</p>
        <p>SHOPPINQ CART WITH PLAY FOOD</p>
        <p>No. 1015 - Great for shopping trips or hauling toys.</p>
        <p>LfHLE TIKES PLAYHOUSE-</p>
        <p>No. 4307 - Two large windows hake shutters that open and dose, drop-leaf t^ inside Old a play telephone  much more! Ages 1'^-5..</p>
        <p>Reg. Price.;........;.......;.......$159.97</p>
        <p>' AU PRICE139bf7 -</p>
        <p>T.O.T; Value  ;  ;  </p>
        <p>- Coupon  10.00  '</p>
        <p>AFTER T.O.T.</p>
        <p>VALUE COUPON</p>
        <p>RITE HITE METAL APPLIANCES</p>
        <p>2d</p>
        <p>a</p>
        <p>todgg</p>
        <p>RITE HITE STOVE</p>
        <p>No. 602 - Reg. $31.97. Clicking knobs, utensil set&amp;amp; saucepan.</p>
        <p>28" I</p>
        <p>RITE HITE REFRIGERATOR</p>
        <p>No. 612 - Reg. $39.97 Working ice&amp;lt;</p>
        <p>$2497</p>
        <p>RITE HITE SINK</p>
        <p>No. 622-Reg.$31.97 Touch control faucets, sprayer fau-^ cel. 28" high.</p>
        <p> ^----- TONsonrovt*</p>
        <pb facs="00096780_0197" />
        <p>......</p>
        <p>A. CABBAGE PATCH KIDS SIDE-BY-SIDE STROLLER</p>
        <p>No. 3945-Sun canopy &amp;amp; more!</p>
        <p>B. CABBAGE PATCH KIDS PLAYPEN No. 3933-Folds</p>
        <p>for easy storage.</p>
        <p>C. CABBAGE PATCH KIDS BUNK BED No 3996-Can be stacked with other C.P.K bunk beds.</p>
        <p>YOUR</p>
        <p>CHOICE!</p>
        <p>CABBAGE PATCH KIDS SPLASHING KIDS</p>
        <p>No. 3580-14 Dolls that can be fully immersed in water!</p>
        <p>OUR PRICE.....................................$29.97</p>
        <p>T.O.T Value Coupon................................5.OO</p>
        <p>AFTER T.O.T VALUE COUPON..........</p>
        <p>97</p>
        <p>BARBIE GLAMOUR HOME FURNISHED No 9477</p>
        <p>OUR PRICE.....................................$99.97</p>
        <p>T.O.T Value Coupon................................5.00</p>
        <p>AFTER T.ar VALUE ^ COUPON..........</p>
        <p>$i</p>
        <p>97</p>
        <p>JEWEL SECRETS'"</p>
        <p>BARBIE No. 1737</p>
        <p>OUR PRICE.....................................$13.97</p>
        <p>Mfg. Rebate..............................................2.00</p>
        <p>AFTERMFO $4  4  97</p>
        <p>RERATE........................ I  I</p>
        <p>ir NEWBORN BOY/GIRL DOLLS</p>
        <p>No. 80740-Reg. $19.97 Anatomically correct, Bubble-blowing&amp;lt; mechanism, bottle &amp;amp; bib included.</p>
        <p>YOUR CHOICE! KID SISTER OR MY BUDDY DOLLS</p>
        <p>Reg. $28.97 - Ddls 'that become your child's best friend.</p>
        <p>*14</p>
        <p>30 PIECE PLAY MAKE-UP SET</p>
        <p>No. 1850</p>
        <p>27 PIECE PURSE AND HAIR SET</p>
        <p>No. 1851</p>
        <p>Your Choice</p>
        <p>$097</p>
        <p>Each</p>
        <p>THE WORKOUT GIRL DELUXE EXERCISE SET</p>
        <p>No. 36600-Comes with dumbells, dance baton, dance ribbon and mat.</p>
        <p>$997</p>
        <p>BARBIE DREAM HOUSE Fumiehed No. i667</p>
        <p>Reg- Price .................................$135.97</p>
        <p>ale PRICE.................................$129.97</p>
        <p>T.O.T Value Coupon..............................10.00</p>
        <p>AFTER T.aT VALUE COUPON..........</p>
        <p>*115</p>
        <p>ROCK *N CURL'"</p>
        <p>No. 4002-12V2 Doll with fashion hair style.</p>
        <p>HOLOGRAMS</p>
        <p>DOLLS</p>
        <p>No . 4005</p>
        <p>MISFITS DOLLS</p>
        <p>No. 4010</p>
        <p>JEM</p>
        <p>97</p>
        <pb facs="00096780_0198" />
        <p>:  :  :  '  ;  i    I          -    j  f</p>
        <p>1 ,t^ !&amp;gt;'*'" I  1 &amp;gt; ^ii &amp;lt;</p>
        <p>m/am</p>
        <p>D. MONOPOLY</p>
        <p>No. 0009 -  8-up.</p>
        <p>Edition of distinction.</p>
        <p>E. AGGRAVATION</p>
        <p>H.</p>
        <p>1</p>
        <p>ai'</p>
        <p>CAnDVLAnD</p>
        <p>No. 8321 - Ages Shi^.</p>
        <p>Classic game of skill.</p>
        <p>F. OUMA BOARD SET</p>
        <p>No. 0600 - Ages 8-up. Fascinating &amp;amp; mystifying.</p>
        <p>0. SCRABBLE  CROSSWORD GAME No. 0017 - Ages 8-Up OUR PRICE.............................$0.97</p>
        <p>T.O.T. Value Coupon.....................2.00</p>
        <p>AFTER T.O.T.  $7^7</p>
        <p>VALUE COUPON  f</p>
        <p>H. FRONTS AND BACKS MEMORY  $|S97</p>
        <p>No. 4014 - Ages 3-6.  9</p>
        <p>I. A QUESTION OF SCRUPLES</p>
        <p>No. 4619 - Reg. $19.97 Genne of moral dHemas.</p>
        <p>J. THE ORIGINAL MEMORY No. 4664 Ages 3-6</p>
        <p>K. CANDY LAND</p>
        <p>No. 4700 - Ages 3-6.</p>
        <p>A childs first game.</p>
        <p>CRAYOLA CADDY</p>
        <p>No. 5510 - Sturdy revolving tray loaded with art supplies.</p>
        <p>ETCH A SKETCH MAGIC SCREEN</p>
        <p>No. 505-Make vertical or horizontal lines, erase &amp;amp; draw again. Ages 4-up.</p>
        <p>ROLLING STONES ROCK TUMBLER</p>
        <p>No. 635 - Reg. $24.97. Chan^ rou^ rocks into beautifully polished gem-stones. Makes exciting jewelry.</p>
        <p>*19?^</p>
        <p>-}-</p>
        <p>ELECTRONIC</p>
        <p>BATTLESHIP</p>
        <p>No. 4750 - Reg. $44.97. Electronic hunt and seek game .on the high seas.</p>
        <p>|97</p>
        <p>--'f-</p>
        <p>--r</p>
        <p>---I-</p>
        <pb facs="00096780_0199" />
        <p>.J_____ii-..*-.. J </p>
        <p> 1 r 'i-- -</p>
        <p>I J L</p>
        <p>---f----i-----f-----</p>
        <p>-y-'r T</p>
        <p>&amp;lt;90</p>
        <p> T r</p>
        <p>.4  i J. , . .t. i .</p>
        <p>i _ _ ,  ;</p>
        <p>'jlSis^</p>
        <p>A.LII.TOTWALkEil trainer No. $1 I</p>
        <p>' Rocjo, walks and bquKes: age adjos-. .. table; fun-safe instnrctional for preschoolers; tubular steel.</p>
        <p>OUR PRICE</p>
        <p>! T.OX Value Coupon,</p>
        <p>: EPT1RT.0.T. VAULC</p>
        <p>^COUPON...;...</p>
        <p>FISHER-PRICE BUBBLE MOWER</p>
        <p>No. 2006 - Makes bubbles. Handle folds flat for convenient storage.</p>
        <p>tA7</p>
        <p> 5.00</p>
        <p>197</p>
        <p>TINKER TOY BIG BUILDERS SET</p>
        <p>No. 842 - Reg. $12.97 &amp;lt;&amp;gt;lginal oonstrudion toy with interchangeable, non-toxic pieces.</p>
        <p>b:;II|SI0AL MOBILE</p>
        <p>Stimulates baijys . curiosity and encourages baby to coordinate eight... withsound.</p>
        <p>C.FISHER-PRICE</p>
        <p>NURSERY: MONITOR Ntf. 0T57 r Re^. $4^7. ^  ii' j| Q7 Offers mobility as well as . peace ofmkid. "  </p>
        <p>FISHER-PRICE MEDICAL KIT</p>
        <p>No. 2010-A popular toy made even better.</p>
        <p>p. FISNER-PRICE TRAVEL ; TENDER PORTABLE r CRIB AM&amp;gt; NjEYPEN</p>
        <p>. .t. No. 9130 OUR PRICE ------IR9.97</p>
        <p>; T.O.T. Value Coupon  ....... 10.00</p>
        <p>*59"</p>
        <p>AFTER T.aT.</p>
        <p>VALUE COUPON. ..</p>
        <p>E. FISHER-PRICE HOP</p>
        <p>SKIP JUMPER eA</p>
        <p>NO. 9146 - Reg, $29.97.</p>
        <p>Seat &amp;amp; heigM adjust.</p>
        <p>SESAME ST. OR DISNEY POPPIN PALS</p>
        <p>Activity learning toy, built-in carry handle. fALE</p>
        <p>PRICE..........$9.97</p>
        <p>T.O.T. Value Coupon..............1.00</p>
        <p>AFTER</p>
        <p>T.O.T.</p>
        <p>COUPON.</p>
        <p>w</p>
        <p>SEE *N SAY THE BEE SAYS OR THE FARMER SAYS TALKINQTOYS</p>
        <p>Still a favorite with kids!</p>
        <p>SALE.................$7.97</p>
        <p>Mfg. Rebate...........1.50</p>
        <p>AFTEI MFG.</p>
        <p>TODDLER</p>
        <p>KITCHENP</p>
        <p>No. 1008 - 10 fun-filled activities to keep a toddler busy!</p>
        <p>&amp;lt;00</p>
        <pb facs="00096780_0200" />
        <p>TONS O IgTS ; BIG</p>
        <p>ii</p>
        <p> ------V----- -r - - -</p>
        <p>......A</p>
        <p>GOLDEN SPIKE TRAIN SET</p>
        <p>No. 175-Reg. $39.97-Consists of diesel with working headlights &amp;amp; 5 cars, blinking bridge &amp;amp; trestle set &amp;amp; more! Power pack included.  &amp;lt;</p>
        <p>$</p>
        <p>29</p>
        <p>97</p>
        <p>CLIFF HANGERS ELECTRIC RACING</p>
        <p>SET No. 6232-Race them up the walls, upside down. They defy gravity.</p>
        <p>Reg. Price...............................$59.97</p>
        <p>SALE PRICE....&amp;lt;................$49.97</p>
        <p>Mfg. Rebate................................5.00</p>
        <p>AFTER MFG.</p>
        <p>REBATE.</p>
        <p>!44^'</p>
        <p>^ SUPER TURBO TRAIN SET</p>
        <p>No. 7431 -Worlds fastest train! Over 29 feet of track.</p>
        <p>Reg. Price .......................................$54.97</p>
        <p>SALE PRICE  ...............$47.97</p>
        <p>Mfg. Rebate........................................5.00</p>
        <p>AFTER MFG. REBATE..........</p>
        <p>$</p>
        <p>42</p>
        <p>97</p>
        <p>8-FUNCTION RADIO CONTROL SUPER BUGGY No. 4727CO-Super spring action!</p>
        <p>Reg. Price..................................$69.97</p>
        <p>SALE PRICE........................$54.97</p>
        <p>T.O.T. Value Coupon...................5.00</p>
        <p>AFTER T.O.T. VALUE</p>
        <p>COUPON..........</p>
        <p>*49</p>
        <p>97</p>
        <p>GOTCHA</p>
        <p>ENFORCER</p>
        <p>GUN SET No. E9601 Reg. $39.97-Pistol fires 30 feet away. Comes with gun, goggles, ammo, targets. No batteries required. Ages 15 and up.</p>
        <p>MAGIC MIKE TALKING ROBOT</p>
        <p>No. 1165  Mystery bump-n-go action, eyes flash. Battery-</p>
        <p>to *10*^</p>
        <p>(newwgw)</p>
        <p>3 + BASIC BUILDING</p>
        <p>SET No. 337-</p>
        <p>Reg. $15.97 - 212 interlock</p>
        <p>ing pieces. Ages 3-5.</p>
        <p>Now! BtSir^hliiiif |OMr4mMonR*kignMitf I</p>
        <p>*11</p>
        <p>SILVERHAVKS NERO A VILLIAN FIGURES 5 Fi</p>
        <p>gures-ooHect them all! SALE.................$8.97</p>
        <p>T.O.T. Value Coupon...................1.00</p>
        <p>T.O.T VALUE COUPON.........</p>
        <p>BATTERY OPERATED MONSTER WHEELS SUPER TRUCK</p>
        <p>No. 1145-Reg. $14.97. Working headlights. 2 speeds Hi-Lx), forward &amp;amp; reverse.</p>
        <p>MIGHTY DUMP</p>
        <p>No. 3901-Made of durable steel!</p>
        <p>SALE</p>
        <p>raicE.............11"</p>
        <p>Mfg. Rebate....................3.00</p>
        <p>tSr SQ97</p>
        <p>REBATE O</p>
        <pb facs="00096780_0201" />
        <p>20 BOYS BMX RENEGADE " BIKE</p>
        <p>No. 2212 - Blaze red finish, box" handlebars, coaster brakes &amp;amp; more!</p>
        <p>Reg. Price .....................$79.97</p>
        <p>SALE PRICE.......................69.97</p>
        <p>T.O.T. Value Coupon................5.00</p>
        <p>AFTER T.O.T $|t^97 VALUE COUPON ...</p>
        <p>20 GIRLS HI-RISE J  DAISY  BIKE  No.  1205</p>
        <p>Hot pink finish, coaster brakes, deluxe padded saddle &amp;amp; more!</p>
        <p>Reg. Price...................$79.97</p>
        <p>SALE PRICE 69.97</p>
        <p>T.O.T. Value</p>
        <p>Cottfxxt ...........5.00</p>
        <p>AFTER T.O.T.</p>
        <p>VALUE %^A97 COUPON........</p>
        <p>E FOR</p>
        <p>28 RED WAGON</p>
        <p>No 6207-Reg. *29*'Heavy-guage steel.</p>
        <p>10 RED TRICYCLE</p>
        <p>No. 6701-Tubular Steel SALE PRICE $17.97</p>
        <p>T.O.T. Value</p>
        <p>Coupon.........................2.00</p>
        <p>AFTER T.O.T.</p>
        <p>VSSSm *iS</p>
        <p>ASSORTED VIDEO CASSETTES</p>
        <p>A wide selection ol timeless stories and popular characters.</p>
        <p>$J97</p>
        <p>Reg. Price .-.;.r...;...;.:.... $189.97 SALE PRICE  169.97</p>
        <p>TXXT. Value ......</p>
        <p>Coupon ........  1........  10.00</p>
        <p>COUPON..</p>
        <p>eVMHBANBW</p>
        <p>6-t.EGSUPER GALVANIZED GYM SET</p>
        <p>No. 68503 - Sturdi-weld* constmdion, super wide ladder steps, thermp'fused weattw shield A morel</p>
        <p>PRINCE CHESTNUT SPRING HORSE</p>
        <p>No. 174 - Reg. $49.97. Age adjustable frame, step-up pads &amp;amp; more!</p>
        <p>DUNKASWISH</p>
        <p>BASKETBALL SET</p>
        <p>No. 8180-Comes with Dwi-ny Alnge Baskelbafl.</p>
        <p>13</p>
        <p>n</p>
        <p>j</p>
        <p>HCOLECO</p>
        <p>ETCH-A-SKETCH</p>
        <p>ANIMATOR"'</p>
        <p>No. 520 - Batteries operated. Ages 6-up.</p>
        <p>49</p>
        <p>UHBmni.</p>
        <p>McMAHON</p>
        <p>FOOTBALL WITH TEE</p>
        <p>No. F1609 - Official Size.</p>
        <p>S997</p>
        <p>45 CHAMP POOL TABLE No. 7090</p>
        <p>Reg. Price.......................................$39.97</p>
        <p>SALE PRICE................................34.97</p>
        <p>T.O.T. Value Coupon.........................5.00</p>
        <p>AFTER T.O.T.</p>
        <p>VALUE COUPON. ..</p>
        <p>*29"</p>
        <p>)AR BAti-'</p>
        <p>RADAR BALL</p>
        <p>No. 4310/4312 - Reg. $12.97. Shows miles per hour when caught.</p>
        <p>$997</p>
        <pb facs="00096780_0202" />
        <p>GIFT</p>
        <p>Certificates</p>
        <p>A wlcom gift for ovory chNd that satisfies all needs and pleases everyone.</p>
        <p>CHRISTMAS HEADQUARTERS!</p>
        <p>SPVAIISSNU.''</p>
        <p>KIOSONQS ViiPMIj</p>
        <p>mm</p>
        <p>SfoS'</p>
        <p>Di&amp;lt;</p>
        <p>F.l</p>
        <p>PERSONAL</p>
        <p>li ', nMoa </p>
        <p>50 LITE MIDGET SET</p>
        <p>TtHA anr L'W COX|IAuCT&amp;gt;Oe</p>
        <p>* WiW'Mfii'M"''"</p>
        <p>$27</p>
        <p>A. 6 FT. CHRISTMAS D. 3 ROLLS GIFT E. 8 ROLLS GIFT BALSAM PINE  WRAP Nos. 3502/ WRAP No. 81-0501</p>
        <p> - T' Res|. $39.97'   ^...... ' '3601 -100 sq. ft.-  i - - -  .....t''' t'</p>
        <p>,.J L.  2Sa i ,F,.50 LIGHT set:</p>
        <p>B-?!?&amp;gt;-EAR ;  ; etear^cotor !</p>
        <p>-j.CANOLE -  .....,.Beg.$3.9n....;..,.</p>
        <p>C. 25 BOW BAG  REMTe.....i</p>
        <p>ASSORTED</p>
        <p>9V</p>
        <p>m</p>
        <p>IS</p>
        <p>UL* ENTERTAINER</p>
        <p>PRICES GOOD THRU NOV. 29,1987 AS LONG AS QUANTITIES LAST &amp;gt; SORRY NO RAINCNECKS</p>
        <p>lObuilNndyihTO.</p>
        <p>SHOP TONS O TOYS NEAREST YOU!</p>
        <p>MYRTLE BEACH, SC  (2) COLUMBIA, SC. ROCK HILL, SC  RALEIQH, NC &amp;gt; GREENSBORO, NC  STATESVILLE, NCOREIMVILLE, MC. ATHENS, QA - AUGUSTA, GA  ROANOKE, VA - LYNCHBURG, VA</p>
        <p>PAQE8 - TONSaTOYS</p>
        <pb facs="00096780_0203" />
        <pb facs="00096780_0204" />
        <p>Your health care needs are as close as Eckerd.</p>
        <pb facs="00096780_0205" />
        <p>Give the gift of fragrance and sav^ Eckerd^</p>
        <p>3</p>
        <pb facs="00096780_0206" />
        <pb facs="00096780_0207" />
        <p>My Buddy wink ondBHnkorKid Sitter Wink and Blink doll by Ployskool.</p>
        <p>Reg. 29.99 each.</p>
        <p>^07</p>
        <p>#ea orCribsy.Reg22.99</p>
        <p>Prtncess Pony by</p>
        <p>Hasbro with Bush Woolleftfend.</p>
        <p>Tr '</p>
        <p>V  </p>
        <p>  ^ "---</p>
        <p>mOaWOmWmMmnB</p>
        <p>ftectowalchby Mattel. Reg 8.99</p>
        <p>Giflwar</p>
        <p>ItekloQw Ciydni</p>
        <p>cachet box and more. Reg. 4.99</p>
        <p>B saving!</p>
        <p>Royal Brighton</p>
        <p>relish dish, jam jar or sauce set. Reg. 3.99</p>
        <p>;...now cri</p>
        <p>T99</p>
        <p>3*piece Cruet Set</p>
        <p>with teak base and tops. Reg. 7.99</p>
        <p>Eckerd!</p>
        <p>Tam-X</p>
        <p>tarnish remover 12-02.</p>
        <p>loweMua</p>
        <p>Christmas mug 12-02. Reg. 3.79</p>
        <p>Teddy Boor 8n.</p>
        <p>Choice of sizes. Reg. 2.99</p>
        <p>/ygborttr</p>
        <p>ashtray. Reg. 7.77</p>
        <p>2.99</p>
        <p>^Ueew^^leelee</p>
        <p>vnnsiinos rorcwain</p>
        <p>heart box and mote. Reg. 3.99</p>
        <p>2.99J</p>
        <p>Country French</p>
        <p>bone china trinkets. Reg. 3.99</p>
        <p>Mellttq optic vase. Choice of siyles. Reg. 4.99</p>
        <p>Wbidtor candy dish with lid. Crystal or blue. Reg. 4.99</p>
        <p>3.99</p>
        <p>l-PteceMeoturlng</p>
        <p>cookie cutter set. Reg. 4.99</p>
        <p>HngeiNpToiMel</p>
        <p>in holiday designs. Reg. 2.99</p>
        <p>Oe%OFF</p>
        <p>Rag.Prlca Country Ooote bowl. 7"a9'/iplatee8f3k.or tray. Reg. 99c to 349</p>
        <p>Cryttal</p>
        <p>Egg Tray. Reg. 3.99</p>
        <p>SotoChrtstTTKncu^ J 1002.18-pk. ;</p>
        <p>Reg. 1.79 i</p>
        <pb facs="00096780_0208" />
        <p>ECKEIW</p>
        <p>Shop Eckerd for Christmas savings and rebates.</p>
        <p>22.88 I 8.^ aa</p>
        <p>Mtonw wall mount shower massage #OM109. Reg. 15.99</p>
        <p>14.99</p>
        <p>g-OOaa 9.99 s</p>
        <p>PioctorSHex</p>
        <p>stearr^diyiron ^1300. Reg. 19.99</p>
        <p>PolleiMx Ionizer air cleaner #1701. Reg. 59.99</p>
        <p>DazMfFootsover #FS-2a Reg. 21.99 4</p>
        <p>Of</p>
        <p>decorative bulbs 2-pock.</p>
        <p>Oimdoor/outdoor flood lick 65 or 120-watt!%a649</p>
        <p>12.99 s</p>
        <p>00 ^ 7.99 s,</p>
        <p>Conoir 1250wcitt minlhakdiyer #106. Reg. 16.99</p>
        <p>Ooncrir Hot Sticks traveler hoksetter #HS-18.</p>
        <p>IMIedlons travel or rechargeable mirror. I^.9.99</p>
        <p>29.99</p>
        <p>iMssi MSPi 19.99 s</p>
        <p>rotary shaver #RR-3. Reg. 39.99</p>
        <p>16.99</p>
        <p>WHWldOII</p>
        <p>hakcutset #HC-100. Reg. 19.99</p>
        <p>WhKhMie Clothes Shaver. Removes pUls torn jweolets. Reg. 1299</p>
        <p>OHomtemlciovNNe</p>
        <p>oodoMmCholoeor</p>
        <p>4dnpeiRega99</p>
        <p>OosMe Jar. Choose goose or cat Reg 9.99</p>
        <pb facs="00096780_0209" />
        <p>Cqich the spirit with eieclronic gift ideas.</p>
        <pb facs="00096780_0210" />
        <p>"SS'</p>
        <p>.  ^  'Wlncli#clii).lfanadillsdlltinlt  MM</p>
        <p>out of fliock, wxtll giv you a raindMck or qulvalml savings on a comparablo brand.</p>
        <p>Printed in Canad</p>
        <pb facs="00096780_0211" />
        <p>for all occasions</p>
        <p>w A104</p>
        <p>Super value one diamond dinner ring.</p>
        <p>AlOl</p>
        <p>A circle of sapphires surround a diamond.</p>
        <p>AlOO</p>
        <p>A circle of rubies surround a diamond.</p>
        <p>A103</p>
        <p>Super value one diamond princess ring.</p>
        <p>A102</p>
        <p>The classic cultured pearl ring.</p>
        <p>oar (2</p>
        <p>I.V</p>
        <p>H</p>
        <p>\ y. E</p>
        <p>: V</p>
        <p>38</p>
        <p>mm</p>
        <p>f</p>
        <p>B106</p>
        <p>Classic signet ring.</p>
        <p>B107</p>
        <p>Ruby and diamond circle earrings.</p>
        <p>BIOS</p>
        <p>Seven beautifully encircled diamonds.</p>
        <p>(j/}e</p>
        <p>^48</p>
        <p>BlOf</p>
        <p>Sapphire and diamond circle earrings</p>
        <p>\ I</p>
        <p>cue /</p>
        <p>Four diatTtpryl'panda coin pendant.</p>
        <p>.r .</p>
        <p> Rubies and diamonds</p>
        <p>^ rt '</p>
        <p>Sapphires and diamonds , in a dazzling pendant.</p>
        <p>in a dazzling pendant.</p>
        <p>SnU HI35    .-'rii</p>
        <p>Seven diamond  ,  '</p>
        <p>dazzling nugget cluster.    </p>
        <p>H136</p>
        <p>Ruby and</p>
        <p> , b.   diamond</p>
        <p> ' ,  .  _'.Ti  earrings.</p>
        <p>.  yoar (o*</p>
        <p>H137</p>
        <p>Sapphire and diamond  ^  ^ ^</p>
        <p>earrings.  </p>
        <p>S'f r . </p>
        <p>CHS</p>
        <p>Four diamond ' '</p>
        <p>C109   ^ </p>
        <p>Elegant marquise shaped ring in  _  '</p>
        <p>rubies and   -C'</p>
        <p>diamonds. -  ,</p>
        <p>* r*</p>
        <p>88</p>
        <p>liberty coin</p>
        <p>pendant.</p>
        <p>Vi -'</p>
        <p>C114</p>
        <p>Seven diamond</p>
        <p>Clio</p>
        <p>Elegant marquise shaped ring in sapphires and diamonds.</p>
        <p>C113</p>
        <p>Traditional one diamond filigree ring.</p>
        <p>Chain price not Included.</p>
        <pb facs="00096780_0212" />
        <p>SUPER SALE ON DIA</p>
        <p>mi*</p>
        <p>,vC^</p>
        <p>K145 $438.00</p>
        <p>Classic eight diamond cluster.</p>
        <p>K150 $258.00</p>
        <p>Seventeen dazzling diamonds in an exquisite shape.</p>
        <p>K149 $528.00</p>
        <p>Elegant array of nineteen diamonds.</p>
        <p>K146 $448.00</p>
        <p>Brilliant waterfall of nineteen diamonds.</p>
        <p>K143 $328.00</p>
        <p>Three diamond gents nugget.K147 $448.00</p>
        <p>Classic five diamond wedding ring.</p>
        <p>D117</p>
        <p>Liberty coin ring.</p>
        <p>D118</p>
        <p>Panda coin ring.</p>
        <p>D119</p>
        <p>One diamond classic filigree ring.aar C7</p>
        <p>D123</p>
        <p>The onyx and diamond classic.</p>
        <p>68</p>
        <p>D120</p>
        <p>Sapphire and diamond waterfall ring.</p>
        <p>D121</p>
        <p>Ruby and diamond waterfall ring.</p>
        <p>DI22</p>
        <p>Unique three diamond design.</p>
        <p>9/aur S/uHi x</p>
        <p>30%V! OFF LISTED PRICESL161 $1,348.00</p>
        <p>A ladies superb cluster with eight diamonds.</p>
        <p>L152 $748.00</p>
        <p>Large seven diamond circle gents ring.</p>
        <p>L160 $1,878.00</p>
        <p>Heavy gold nugget gents with seven diamonds.</p>
        <p>L153 $898.00</p>
        <p>Tasteful double row wedding ring set with ten diamonds.</p>
        <p>L159 $2,398.00</p>
        <p>Filigree three diamond classic ring.</p>
        <p>ITEMS ENLARGED TO SHOW DETAIL</p>
        <pb facs="00096780_0213" />
        <p>AMOND JEWELRY</p>
        <p>K148 $498.00</p>
        <p>Masculine seven diamond cluster.</p>
        <p>K144 $598.00</p>
        <p>Seventeen diamond Kentucky cluster.</p>
        <p>L158 $1,048.00</p>
        <p>Pear shaped diamond solitaire.</p>
        <p>F127</p>
        <p>Panda coin pendant.</p>
        <p>E124</p>
        <p>Onyx and diamond gents.</p>
        <p>E125</p>
        <p>Classic gents signet ring.</p>
        <p>E126</p>
        <p>Super one diamond gents.</p>
        <p>L156 $898.00</p>
        <p>Round diamond solitaire.</p>
        <p>F128</p>
        <p>Liberty coin pendant.</p>
        <p>oar L2L155 $1,128.00</p>
        <p>Antique reproduction in black enamel with five diamonds.F129</p>
        <p>Special, special one diamond beauty.F130</p>
        <p>Eternal one diamond double heart ring.</p>
        <p>L157 $1,048.00</p>
        <p>Marquise diamond solitaire.</p>
        <p>^(HiA &amp;amp;/uHC/58</p>
        <p>chain price not included.' ft ///</p>
        <p>L154 $1,578.00</p>
        <p>Larger center diamond surrounded by twelve diamonds on wide band.</p>
        <p>3?#</p>
        <p>G133</p>
        <p>Cluster of marquise rubies and diamonds.</p>
        <p>G131</p>
        <p>Five diamonds in Jji extraordinary ' _ i design.</p>
        <p>w</p>
        <p>*</p>
        <p>L162 $1,648.00</p>
        <p>Twenty-five diamonds in the classic dinner ring shape.</p>
        <p>L151 $778.00</p>
        <p>Glamorous array of twenty-five diamonds.</p>
        <p>.//// ,</p>
        <p>fi</p>
        <p>G132</p>
        <p>Delicately and forever three diamond filigree ring.</p>
        <p>G134</p>
        <p>Cluster of marquise sapphires and diamonds.</p>
        <p>our ( 9,</p>
        <p>108</p>
        <pb facs="00096780_0214" />
        <p>J140</p>
        <p>Jacket ring for your solitaire, six diamonds.</p>
        <p>J139</p>
        <p>r.j~ Liberty coin ring with four diamonds.</p>
        <p>I -.m,</p>
        <p>(i M</p>
        <p>^ tll'f p</p>
        <p>\</p>
        <p> '</p>
        <p>See Our ESTATE JEWELRY COLLECTION</p>
        <p>J138 Classic three diamond gents ring.</p>
        <p>J142</p>
        <p>A seven diamond gents cluster.</p>
        <p>?/ai/r (lxHce</p>
        <p>^38</p>
        <p>J141</p>
        <p>Panda coin ring with four diamonds.</p>
        <p>V</p>
        <p>M163 $2,249.00</p>
        <p>Enamel ^ eleven diamond / cross-antique style.</p>
        <p>M1&amp;amp;7Value prices in^l sizes, In soHtaire pendant ar^i chain,</p>
        <p>Ml66 -$398.00  IP</p>
        <p>Eight diamopd^ndant Ml 65 $998.00 and chain\jegant. Diamond enamel pendant Jgj. and chaifvantique style.</p>
        <p>M168-  ^</p>
        <p>Value prices In all sizes</p>
        <p>Diamond stud earrings ^  ^</p>
        <p>from one tenth  * carat total and up.</p>
        <p>1. Ml64 $1,798.00 , rt.</p>
        <p>Diamond enamel VW earringsantique style. ^</p>
        <p>m m</p>
        <p>r</p>
        <p>^TCn6!</p>
        <p>All merchandise shown in either lOk or 14k gold. All coins are replicas.</p>
        <p>Prices may vary based on fluctuating prices in the world gold and gem markets.Cometo: 3EAR3 FlilC vJCWGlry DcpdrtrnCnt CaroHna East Man, GreenvHle NC 27834 IF NOT, SE THIS CONVENIENT ORDER FORM</p>
        <p>NAME:</p>
        <p>ADDRESS:_</p>
        <p>CITY. STATE, ZIP:</p>
        <p> CASH (CHECK/MONEY ORDER ENCL.</p>
        <p> SEARS ACCOUNT ^_</p>
        <p> DISCOVERY ACCOUNT ^__</p>
        <p>ITEM</p>
        <p>QUANTITY</p>
        <p>COST PER UNIT</p>
        <p>LESS DISCOUNT (IF APPLICABLE)</p>
        <p>EXTENSION</p>
        <p>ORDER FORM</p>
        <p>TOTAL</p>
        <p>SALES TAX</p>
        <p>POSTAGE (INCL. HANDLING)</p>
        <p>$5.00</p>
        <p>GRAND TOTAL</p>
        <p>$</p>
        <pb facs="00096780_0215" />
        <p>I^S</p>
        <p>s</p>
        <p>easonL_7ale</p>
        <p>.Mk</p>
        <p>h, \.i :-</p>
        <p>salf:</p>
        <p>349' s f : :y: ^ 5:  :f:</p>
        <p>E SAU:</p>
        <p>69</p>
        <p>IV V- N/ k(kkVIBC</p>
        <p>  I'-''</p>
        <p>- "</p>
        <p> * -SALF '</p>
        <p>149</p>
        <p>v-'4" o</p>
        <p>SALf '' j ggnH</p>
        <p>SALF </p>
        <p>s398</p>
        <p>i\ W</p>
        <p>SAIF</p>
        <p>1999</p>
        <p>DAWSON'S</p>
        <p>. FINE JEWELRY AND GIFTS  ESTABLISHED 1916</p>
        <p>GRADUATE GEMOLOGIST AVAILABLE TO ASSIST IN YOUR DIAMOND SELECTIONS'</p>
        <p>102 E. Main St. Belhaven, NC 27810 (919) 943-2121</p>
        <p>FOR MAILORDERS CALL NCTOLL FREE</p>
        <p>Next to the Plaza 611 E. Arlington Blvd</p>
        <p>Greenville, NC 27834  ^  OAA AOO 0*4 04</p>
        <p>(919) 355 5252  1  OUU"DoZ"^l  1</p>
        <p>Save This Flyer! Special Prices Good thru Dec 10,1987</p>
        <p>VISA</p>
        <pb facs="00096780_0216" />
        <p>Start Your Christmas Shopping Here!</p>
        <p>^ D</p>
        <p>SALE</p>
        <p>297*^^</p>
        <p>4. B</p>
        <p>SALE</p>
        <p>SI19988</p>
        <p>^ </p>
        <p>SALE</p>
        <p>8^^99988</p>
        <p>E</p>
        <p>Y SALE</p>
        <p>f U79'</p>
        <p>SALE</p>
        <p>1988</p>
        <p>" </p>
        <p>SALE</p>
        <p>24988</p>
        <p>^ B</p>
        <p>SAEE</p>
        <p>S5988</p>
        <p>SALE</p>
        <p>32988</p>
        <p>- </p>
        <p>SALE</p>
        <p>SJ8988</p>
        <p>. SAEE</p>
        <p>659^^</p>
        <p>EB</p>
        <p>ti ED</p>
        <p>SALE</p>
        <p>S39988</p>
        <p>SALE</p>
        <p>99988</p>
        <p>m</p>
        <p>/ SAL</p>
        <p>SB</p>
        <p> SAl.K</p>
        <p>SALE</p>
        <p>^659</p>
        <p>SALE</p>
        <p>5988</p>
        <p>4  &amp;lt; ii;i-</p>
        <p>SALE ED 12488</p>
        <p>SALE E3 1199</p>
        <p>'*</p>
        <p>?3 O0</p>
        <p>SALE</p>
        <p>S3288</p>
        <p>li, 9L</p>
        <p>ED  'f</p>
        <p>SALE  * '</p>
        <p>^ 14988 SALE</p>
        <p>(1) Surprtsa bar with this IMct. Round Solltaira Ring in a 4-prong Yellow Gold setting.</p>
        <p>1123-113(7 Ret $59500 Everyday Low Pnce $34907 SPECIAL $297.88</p>
        <p>Dasla Her with a 1/2ct. Marquise Cut Diamond Solltairo Ring</p>
        <p>jt on a 14K Yellow Gold wide band</p>
        <p>135S4IIMa Ret $237500 Everyday Low Pnce $144997 SPECIAL $1199.88</p>
        <p>(3) let. Round Diamond Solltairo Engagemont Ring set in 4-prong 14K Yellow Gold settin 1123-79MRet:</p>
        <p>(4) For Vsur Christmai Wedding, the classic 2mm Wddding Band</p>
        <p>in 14K Yellow Gold.</p>
        <p>1303-30IM Ret $4150 Everyday Low Price $2497 SPECIAL $19.88</p>
        <p>(5) 4mm Banded edge Wedding Band tor that special man in 14K Yellow Gold</p>
        <p>1303-399M Ret $12500 Everyday Low Price $7497 SPECIAL $59.88</p>
        <p>(6) Ladles 4mm Banded edge Wddding Band in 14K Yellow Gold Matches men's above</p>
        <p>t303-3iin Ret $11000 Everyday Low Price $6497 SPECIAL $49.88</p>
        <p>(7) For that Special Lady a 17 Diamond Eternity Ring. 43ct TW in 14K Yellow Gold23l54)04nRet $50000 Everyday Low Price $29997 SPECIAL $249.88</p>
        <p>(B) Mend 3 Diamond IMcl. TW 14K Vdllow Gold Nuggot Ring. Big</p>
        <p>bold fashion for men.</p>
        <p>minan Ret $07500 Everyday Low Price $39997 SPECIAL $329J8 ^9) Claulc Ladios 3 Diamond Fillgreo 12ct. TW 14K Yellow Gold</p>
        <p>2^201/2 Rel $37500 Everyday Low Price K2497 SPECIAL S189J8</p>
        <p>(IB) The Perfect GIN for the SeasonI 1/Scl. Pendant in a 4-prong 14K Yellow Gold setting</p>
        <p>1123-149(7 Rel $42500 Everyday Low Price $24997 SPECIAL $179J8</p>
        <p>(111 tadlllonat Id. Diamond Solitaire Pendant in 4-prong 14K</p>
        <p>Yellow Gold setting</p>
        <p>1123-530(1 Ret $3995 00 Everyday Low Price $249497 SPECIAL $1999.88</p>
        <p>(12) 1(2ct. Diamond Pendant in 4-prong 14K Yellow Gold setting Just as lovely in a smaller size.</p>
        <p>1123-504(2 Ret $119500 Everyday Low Price $79997 SPECIAL $659.88</p>
        <p>(13) The perfect gift Chrlstmas-anytlmet let TW Diamond Stud</p>
        <p>tarrlngs set in 4:prong 14K Yellow Gold setting</p>
        <p>1123^ Ret $24%00 Everyday Low Pnce $149^SPECIAL S999JI8</p>
        <p>(14) 1(2ct. TW Diamond Stud Earrings set in 4-prong 14K White Gold setting</p>
        <p>1123-131(4 Ret $89500 Everyday Low Price S49997 SPECIAL $39988</p>
        <p>aS) The Special GiffForlfhurspecial Girt Diamond Hoart Pendant.</p>
        <p>62ct TW 14K Yellow Gold Chain not included.</p>
        <p>215M2i(3 Ret $149500 Everyday Low Price $79997 SPECIAL S659J8</p>
        <p>(16) 16 Diamond .2Sct TW 14K veilow Gold Cron Pendant. Strik mg style Chain not included.</p>
        <p>1123-717(3 Ret $25000 Everyday Low Price $13997 SPECIAL $11998</p>
        <p>(17) Fashion lakn a now twist with this .Net TW DiMiond Bow</p>
        <p>hmdant in 14K Yellow Gold</p>
        <p>1123-779(3 Ret $13500 Everyday Low Price $7497 SPECIAL $5998 (IB) .llct. TW 14K veilow Gold Pendant spells out your LOVE for her Chain not included.</p>
        <p>2389-531(5 Ret $275.00 Everyday Low Price $14997 SPECIAL S124J8 ^) Up to "itoute styling. Large Diamond Hoop Earrings in 14K</p>
        <p>2053-013(8 Rel $33495 Everyday Low Price $17997 SPECIAL $149.88 ^) 2 Diamond Did. DlaiiHmd Nugget Earrings in 14K veilow Gold m-ma Ret $6995 Everyday Low Pnce $2997 SPECIAL $3218 (21) Dainty 2 Diamond Hoop Earrings with bar clasp Old TW in 14K Gold</p>
        <p>2053-014(6 Ret $10905 Everyday Low Price $6997 SPECIAL $44.88</p>
        <p>^) Id. TW Diamond Tennis BrKolel in 14K Yellow Gold setting The newest style at the best price!</p>
        <p>1123-774(6 Ret 49500 Everyday Low Price $140747 SPECIAL $119968</p>
        <pb facs="00096780_0217" />
        <p>Everyone Appreciates A Gift of Jewelry</p>
        <p>, -iii# '} SALE</p>
        <p>\ y ggHH</p>
        <p>SALH</p>
        <p>249</p>
        <p>SALl</p>
        <p>559^^</p>
        <p>SALE  499SH</p>
        <p>SALE</p>
        <p>s69</p>
        <p>BA</p>
        <p>SALE</p>
        <p>79NS</p>
        <p>SALL</p>
        <p>S74SS</p>
        <p>SALE </p>
        <p>S4988</p>
        <p>SALE Q</p>
        <p>II99S8</p>
        <p>SALE O ^45988</p>
        <p>sall;</p>
        <p>sggHH</p>
        <p>f -V .</p>
        <p>E</p>
        <p>.f;</p>
        <p>- X</p>
        <p>SALE</p>
        <p>S7788</p>
        <p>SALE I59S8 E</p>
        <p>sall;,'249""</p>
        <p>SALi;  % [U</p>
        <p>   '189""  /: ' 'i-, V ^</p>
        <p>SAI L </p>
        <p>S7488</p>
        <p>SALE</p>
        <p> 109""</p>
        <p>/ )&amp;lt;cL / SALE</p>
        <p>V  ^189""</p>
        <p>SALE ^</p>
        <p>169""</p>
        <p>m</p>
        <p>C</p>
        <p>C., SALE &amp;gt;  .32988</p>
        <p>...-.T, 115ct TGWsetin lOKYfeHwGold .. ...t Ret $18500 Everyday Low Price $ie97 SPECIAL S89J8 (2| Chatham Cut Emeiald and 14 Diamonds Combine in this ring. 60ct TGW set in 14K Yellow Gold 21S7403M Ret $495 00 Everyday Low Price S2947 SPECIAL $249.88 0) Impretslvo Large Oval Amelhysl and 16 Diamond Ring set in 14K Yellow Gold</p>
        <p>21S7-4nW Ret $112500 Everyday Low Price $67997 SPECIAL $559.88</p>
        <p>(4) DIstinclivo Opal Ring 45ct TGW set in 10K Yellow Gold. Perfect</p>
        <p>57046 Ret $10000 Everyday Low Price $6997 SPECIAL $49.88</p>
        <p>(5) Beautllul Sapphire and 12 Diamond Ring 180ct TGW set in 14K Yellow Gold,</p>
        <p>21S7-45MRet $92500 Everyday Low Price $64997 SPECIAL $459.88</p>
        <p>(6) 4 Cubic Ziiconias surround a large oval Ibpaz Quartz Ring set</p>
        <p>in 10K Yellow Gold.</p>
        <p>2157-46315 Ret $15000 Everyday Low Price $8997 SPECIAL S74S8 I Rom ol Diamonds surround an impreuive square-cut Blue az in this classic Ring. 135ct TW set in 14K Yellow Gol ...1-50919 Ret $100000 Everyday Low Price $69997 SPECIAL S499JI8 (8| Dazzling Ring with 9 Rubles and 16 Diamonds (some baguettes) 1 Met TGW set in 14K Gold</p>
        <p>254720515 Ret $249500 Everyday Low Price $149747 SPECIAL S1199IS</p>
        <p>in 14K Yellow Gold</p>
        <p>%M-500l7 Ret' $21500 Everyday Low Price $12997 SPECIAL $109.88 (10) 1/2cl. Cubic Zirconia Solitaire Ring in 14K Yellow Gold The look of diamonds lor less!  ..</p>
        <p>2309-502/1 Ret $13500 Everyday Low Pnce $7997 SPECIAL $69.88 ^) Dazzling Cubic Zirconia Marquise Ring 1 lull carat set in 14K</p>
        <p>2309-043/7 Ret $16500 Everyday Low Price $9997 SPECIAL $89.88</p>
        <p>(12) 1 cl. Cubic Zirconia Solitaire Ring Set in 14K Yellow Gold The</p>
        <p>zS^?ler$TSoo""^ Everyday Low Price $8997 SPECIAL $77.88</p>
        <p>(13) HI cl TW Diamond Free Form Ring set in ipK Yellow tolcL 57-620/4 Ret $16000 Everyday Low Price $9497 SPECIAL $79.88</p>
        <p>(14) Sparkling Cubic Zirconia Cluster in this Wbteriall Ring 138ct</p>
        <p>TW set in 14K Yellow Gold  .............</p>
        <p>2349-112/5 Ret $38500 Everyday Low Price $22997 SPECIAL $189.88</p>
        <p>(15) Cubic Zirconia Wedding Ring 66ct TW 14K Yellow Gold Classic Eternity band</p>
        <p>2349-113/3 Ret $34000 Everyday Low Price $19997 SPECIAL $159.88</p>
        <p>(16) Modem and polite Double Pearl and 2 Diamond Ring set in</p>
        <p>10K Yellow Gold  _______</p>
        <p>57-022/2 Ret $15000 Everyday Low Price $8997 SPECIAL $74.88</p>
        <p>(17) Beaulilul Ring with 12 Diamonds encircling 1 Poart Set in 14K</p>
        <p>YellowGold 12ct. TW</p>
        <p>572/4 Ret $37500 Everyday Low Price $22997 SPECIAL $189.88</p>
        <p>(18) Classic Sapphire and 7 Diamond Pendant 80ct TW with 14K setting Chain not included</p>
        <p>1127-012 Ret $52500 Everyday Low Price K9797 SPECIAL $249.88</p>
        <p>(19) Mens Onyx Masonic Ring set in 10K Yellow GoIrL 87-207/5 Ret $45000 Everyday Low Price $26997 SPECIAL $189.88</p>
        <p>(M^Mon^i Cubic Zirconia 3 Stone Ring set in 10K Yellow Gold</p>
        <p>2309-505/6 Ret $32500 Everyday Low Price $19997 SPECIAL $169.88</p>
        <p>^)^Men'S Nugget Style with Lapis Lazuli Ring set in 10K Yellow</p>
        <p>07-304/7 Ret $66500 Everyday Low Price $39997 SPECIAL $329.88</p>
        <p>(22) tadltlonal 9 Sapphire and 8 Diamond Bncelot. 10lct TW t4K</p>
        <p>YellowGold.  cBtni.i</p>
        <p>1123-775 Ret $75000 Everyday Low Price $39747 SPECIAL $319.88</p>
        <p>TW=total diamond weight  _</p>
        <p>TGW=lotal gem weight  [|]</p>
        <pb facs="00096780_0218" />
        <p>Save on Glittering Gifts of Gold</p>
        <p>(1) 2^ and 2 Diamond Earringt in 14K Gold 01 ct. t.w. 2183-702M Ret $15700  Everyday Low Price SB097 SPECIAL S69J8</p>
        <p>(2) Clanic Cameo Earrings with rope border in 14K Yellow Gold. ^714a Ret $6295  Everyday Low Pnce 13407 SPECIAL S27J8</p>
        <p>(3) Hradltional Stud 5mm Ball Earringt in 14K Yellow Gold ^-227M Ret $1795 Everyday Low Price $607 SPECIAL S6J8</p>
        <p>(4) SliglMy Lamer 7mm Ball Earrings in 14K Yellow Gold 2469-11 Ret $2595 Everyday Low Price HM7 SPECIAL S9A8</p>
        <p>(5| Dainty Small Pyralhid Earrings in 14K Yellow Gold. , mmt Ret $2795  Everyday Low Price 61097 SPECIAL S10J8</p>
        <p>aScallofied Hoop Earringt in 14K Yellow Gold^</p>
        <p>I-512M Ret $7995  Everyday Low Price 13997 SPECIAL $32 J8</p>
        <p>(7) Flairod 14K YWlow Gold Earrings. Tailored styling 2M750W Ret $65.95  Everyday Low Price 63397 SPECIAL S27S8d]</p>
        <p>I French BKk Ribbed Button Earrings in 14K Yellow Gold. l&amp;amp;mn Ret $149.95 Everyday Low Price 67497 SPECIAL SS9J8</p>
        <p>I Hoop Earrings in 14K Yellow Gold. Everyday Low Price 64397 SPECIAL S34J8</p>
        <p>(15) Impressive Filigroo Hoop Earringt in 14K Yellow Gold. 2395927/8 Ret $199.95 Everyday Low Price 69997 SPECIAL</p>
        <p>SB4J8</p>
        <p>(9) Distinctive Fillg 2729-320M Ret $85.9!</p>
        <p>114K Vbllow Gold IlMltl Hoop Earrings.</p>
        <p>9-119R Ret. $59.50 Everyday Low Price 63997 SPECIAL S24JI8</p>
        <p>ling I</p>
        <p>not included) 2745-74 Ret $8995</p>
        <p>Everyday Low Price 64497 SPECIAL S37JI8</p>
        <p>(12) 14K Ybllow Gold Kissing Ram Earrings.</p>
        <p>^-20071 Ret $6395 Everyday Low Price 63397 SPECIAL S24J8</p>
        <p>(13) Flower Earringt Jxkol in 14K Yellow Gold. To enhance your diamond or pearl studs.</p>
        <p>2745-734/7 Ret $29.95 Everyday Low Pnce 61497 SPECIAL S10B8</p>
        <p>asm so Mill</p>
        <p>(14) Oversized Shrimp Earringt in 14K Yellow Gold  of a Liberty C</p>
        <p>2302M Ret $279.50 Everyday Low Price 613997 SPECIAL S114J8  2729924/7 Ret</p>
        <p>Diamond and Aquamarine Pendant in 14K Yellow Gold 03ct. Ret $27500 Everyday Low Price 614997 SPECIAL S124S8</p>
        <p>(17) 3 Diamonds surround an onyx heart in this Pondant in 14K</p>
        <p>Yellow Gold.</p>
        <p>220740 Ret $375.00 Everyday Low Price 631997 SPECIAL S179JI8</p>
        <p>(IB) Fashionable Sunflower Pin in 14K Yellow Gold.</p>
        <p>2819-707/1 Ret $199 95 Everyday Low Price 69997 SPECIAL $79118</p>
        <p>Diamond Tie Ibc in 14K Yellow Gold Fgr_yqur man. '700/5 Ret $59 95 Everyday Low Price I</p>
        <p>(20) Hall surely like this 14K VWlow Gold Tie The with a replica of a Liberty Dime.</p>
        <p>2729924/7 Ret $55.50 Everyday Low Price 797 SPECIAL $21S8</p>
        <pb facs="00096780_0219" />
        <p>Baubles, Bangles and Beadson Sale!</p>
        <p>sAi i; '19"</p>
        <p>'  in .'</p>
        <p>I /r,</p>
        <p>sau^289^</p>
        <p>SAi.i: S]</p>
        <p>169^</p>
        <p>SAl 1 297</p>
        <p>-m,</p>
        <p>*  * </p>
        <p>SAl 1</p>
        <p>s84s</p>
        <p>- SALi:</p>
        <p>17S8</p>
        <p>J/   '</p>
        <p>            UJ-* '** ."I </p>
        <p>-^. .sALi:'249"j;^  </p>
        <p>a</p>
        <p>sAi.i ^89^saij:'99"^___-^,^^^</p>
        <p>E1'69  ;^sa.:&amp;gt;'1</p>
        <p>ijl  *  ..-  *'  i?-*  -%.'  **&amp;gt;1^0,  *  '  '  'r^V, =</p>
        <p>! 4STMW SPKttl ,1MI</p>
        <p>as!'rs''^w*</p>
        <p>0) UdMitl Head Cham. Wear the vronders of Egypt around your</p>
        <p>2W70fl/7 Ret $59.50 Everyday Low Price $299? SPECIAL I24J8 (4) 14* Yrtlow Gold Uboily Cham with fepji oaLibe^ di^^^ n2M2M Ret $2995 Everyday Low Price 99? SPECIAL S16J8 gfof your favorite Shipmate this 14K Vhllow Gold hollow Anchor</p>
        <p>- 24I3-T1M Ret. $40.00  Everyday  Low  Price $9? SPECIAL S16J8</p>
        <p>1(6) 14K Yellow Gold SI. Jude Medal.</p>
        <p>mUm Ret $64.50  Everyday Low Price 1329? SPECIAL $27.88</p>
        <p>(7) For that special someone a Large Pulled Heart Cham in 14K</p>
        <p>Yhilliiw BflM</p>
        <p>2053-S2K1 Ret $9800 Everyday Low Price $489? SPECIAL $39.88</p>
        <p>ssLar,sf4;KS5sFai.iw</p>
        <p>S8MW KlSriSrsiKKSSb fSloOTSt^$239M" EwSay^wPrSfiwSPECIAL$99.88</p>
        <p>(10) Jet/CryilaKGold Bead 14K Gold Earrings. Matches necklace aJs-ttwTRet $3995 Everyday Low Price 29? SPECIAL $18.88</p>
        <p>Sei-SI^R?*  Low  Price $3499? SPECIAL $297^</p>
        <p>Clastic 5mm Cultured Pearl Slud Earrings with 14K Yellow Gold</p>
        <p>24m-117/B Ret $3995 Everyday Low Price 19? SPECIAL $17.88</p>
        <p>(13) Oltlinclive 14K Yellow Gold Pin with a Cultured Pearl in the</p>
        <p>center Always in style  ocnsi coa so</p>
        <p>20S3-021f9 Ret $18997 Everyday Low Price $999? SPECIAL $84.88</p>
        <p>(U) 18 Princew length Fine Quallly" Cultured Pearl Strand with</p>
        <p>14K Yellow Gold Clasp.  ___________</p>
        <p>2161-S04/I Ret $53500 Everyday Low Price $2999? SPECIAL $249.88</p>
        <p>(IS) 24 Freshwater Peart Necklace makes a wonderful gift for some-SoiVl^Ret $19995 Everyday Low Price 099? SPECIAL $89.88</p>
        <p>i Herringbone 16 Chain in 14K'</p>
        <p>J-26M Ref $3ra 50 Everyday Low Price 899? SPEC.</p>
        <p>Quail Satin Edoe Herringbone 18" Chain n MK^Oow toll 2599-215/6 Ret. 9950 Everyday Low Price 999? SPECIAL S169J8 (18) 3.3mm Quad Herringbone 16 Chain in bFc!mi^mo 919-727/6 Ret. $25950 Everyday Low Price 299? SPECIAL S99JI8 33mm Quad Herrlnobone 18 Chain in J4K told  </p>
        <p>2M9-728/4 Ret $29995 Everyday Low Price 499? SPECIAL $124.88 33mm Quad Herrlnobone 20*^ Chain in j4K Gold.</p>
        <p>29-729/2 Ret $35950 Everyday Low Price $W99? SPECIAL S149J8</p>
        <p>(19) 16 Arrow 3.6Smm Chain in 14K Vhllow . mi04/8 Ret $35950 Everyday Low Price 799? 18 Amw 3.65mm Chain in 14K Yellow told</p>
        <p>$149.88</p>
        <p>2769-105/6 Ret $39995 Everyday Low Price $1999? SPECIAL $169.88 I Style Bracelet in 14K Yeliow^Gold Ever^ay Low Price $19^ SPECIAL $16938</p>
        <p>I Ladies 7</p>
        <p>V203aRet</p>
        <p>$16995</p>
        <p>tjdiw 7 Arrow 3.6tom Bracolol</p>
        <p>amend in</p>
        <p>4/16 Wldo Hainmeredlta^gM Biaceiei in^iK Gold</p>
        <p>Everyday Low Price $8^ SPECIAL $6938 elel wiih Diamond in l4K_Yellgw Gold</p>
        <p>(221 ladles Love" Bracelet  ~ </p>
        <p>^019/7 Ret $15000 Everyday Low Price $?99?</p>
        <p>(2314/16 Wide Hammered SiS-IOOM Ret $40000 Everyday Low Price 999? SPECIAL $169.88</p>
        <p>M'rsS7?T?,'S!SlSiV </p>
        <p>a</p>
        <pb facs="00096780_0220" />
        <p>Save on Men's &amp;amp; Ladies Watches</p>
        <p>SEIKO ^</p>
        <p>SAIJ</p>
        <p>SU488</p>
        <p>SAI I</p>
        <p>sy^88</p>
        <p>^LORUS A-</p>
        <p>V  /</p>
        <p>" H</p>
        <p>I</p>
        <p>/ I, \</p>
        <p>Pulsar Quartz</p>
        <p>IV^jjestima</p>
        <p>SALI-</p>
        <p>s23s  i</p>
        <p>_  1  Mr  V-*.</p>
        <p>^^&amp;lt;1</p>
        <p>MAMIL.TOrj\</p>
        <p>SAIL</p>
        <p>S5988</p>
        <p>SALI</p>
        <p>1S5988</p>
        <p>l sAii: if '44</p>
        <p>1  SAi.i:</p>
        <p>if V.' '69</p>
        <p>'7</p>
        <p>aM </p>
        <p>TIMEXCm/EN</p>
        <p>ai Seiko tedies Dren Quartz MMch with sweep second hand and goldtone mesh bracelet with black face.</p>
        <p>1861-30in Ret. $18500 Everyday Low Price (907 SPECIAL $114A8</p>
        <p>(6) Pulsar Men^ Quartz Oren WMcIi with sweep second hand and date. Goldtone case and band with a jet black face.</p>
        <p>1109^ Ret $135.00 Everyday Low ^ice S94 SPECIAL S79J8</p>
        <p>(t1) Hamilton Winston Ments Quartz Dren WMeli with sweep second hand and date. The case and bracelet are in two/tone silver and gold with a distinctive gray face.</p>
        <p>1658-70V1 Ret $14000 Everyday Low Price 18097 SPECIAL S79I8</p>
        <p>(2j Seiko Ladin Dren Quartz WMch with Gold Plated Mesh Bracelet and a distinctive Grey face.</p>
        <p>18St-304a Ret $16500 Everyday Low Price $10997 SPECIAL S94A8</p>
        <p>(7) MaiestI Hmt Quartz Anaiog Pocket IMakli with a Hunting Scene on the Cover. Old-fashioned styling with modern movement. 1M7HM Ret $3995 Ever^ay Low Price $8997 SPECIAL S23J8</p>
        <p>aZ) citizen Ladin Geldlone can and bmeletnen Quartz VIMch. 1S63-12IV1 Ret $8500 Everyday Low Price $59^ SPECIAL $49A8</p>
        <p>(3) Seiko Ladlos Dren Quartz Watch with goldtone face and mesh band</p>
        <p>1861-002/7 Ret $13500 Everyday Low Price $8997 SPECIAL $7918</p>
        <p>(4) Pulsar Men^ Sports Quartz Watch with sweep second hand and 'date The face, case and bracelet band are in let black " 7 Ret $9500 Everyday Low Price $6997 SOCIAL $59.88</p>
        <p>(5) Pulsar Ladin Quartz Which with sweep second hand and yellow</p>
        <p>case and expansion band with a white face</p>
        <p>1009413 Ret $9500 Everyday Low Price $6997 SPECIAL S59J8</p>
        <p>(8) Lorus Quartz Mickey Mouse Whteh with a Black band and white face and sweep second hand For the child in everyone! 1731-4200 Ret $1995 Everyday Low Price $1697 SPECIAL $13.88</p>
        <p>(9) Timex Men's and Ylouth Combination Quartz AnalogllBllal Which with a goldtone case and lace. Leather stra 1IM-20SI5 Ret $4995 Everyday Low Price $89^ T</p>
        <p>(10) Hamilton Jamid Ladin Dren Quartz Watch with goldtone case and baguette shaped champagne face. Swiss made. 16S0-Zim Ret $16500 Everyday Low Price $9997 SPECIAL $89J8</p>
        <p>(13) Citizen Ladin Quartz Dren Which with round silvertone case</p>
        <p>and mesh bracelet with safety chain</p>
        <p>1S63-124M Rel $7500 Everyday Low Price $5497 SPECIAL $44J8</p>
        <p>(14) Citizen Men's Exnutive'' Quartz Dren Watch with sweep second hand and goldtone case and bracelet 1563-129/7 Ret $11000 Everyday Low Price $7997 SPECIAL $69.88</p>
        <p>S</p>
        <p>Come in and see Our Thmendous Selection of Brand-Name Watches All at Fabulous Savings!</p>
        <pb facs="00096780_0221" />
        <p>Cn^tal Qear Savings on Giftware</p>
        <p>I Imperial Crystal</p>
        <p>Dessau</p>
        <p>SALE</p>
        <p>SJ388</p>
        <p>T^ SALE</p>
        <p>A.P 19^^</p>
        <p>//Tt sTo8^8</p>
        <p>V</p>
        <p>'~h</p>
        <p>B</p>
        <p>Dessau</p>
        <p>meRiT4G</p>
        <p>SALE</p>
        <p>S8988jijxioon,  Vi</p>
        <p>fe'  X  '.'r</p>
        <p>m (</p>
        <p>s</p>
        <p>3^</p>
        <p>Jay t</p>
        <p>I ,</p>
        <p>(1)mMMlonalBinltollm"KCHaiHMiiMonl ..criAi HeavywtigM CiyiM Swans. Made of cut crystal. Pair. SKctlAL Each 10"H &amp;amp; 8-1/2"H. 9039  ^ 088</p>
        <p>3S02-603/7 Ret. $24.00</p>
        <p>Everyday Low Price $169?</p>
        <p>(2) Imperial Ciyilal Bird Caga. The cage is made of a aS^IOin Ret $13.00  Everyday Low Price $89?  7  (8)  poole  Silver  SlluarplaledChallng  Dish  with applied</p>
        <p>&amp;lt;#1iiom$Ia efArn/v Kairnar lJ^tar n^n</p>
        <p>(6) Heritage Industries 24 Karat Gold Electroplated Crystal Standing Unicom. Makes a wonderful gift SPECIAL 4-1/2" High. 039    $C88</p>
        <p>465M00/2 Ret $1400  Everyday  Low  Price  $89?</p>
        <p>. Industries 24 Karat Gold Electroplated SPECIAL Id Parrots. 6" High,095  _  $-|g88</p>
        <p>Everyday Low Price K49?</p>
        <p>I The Perfect Gift Idea-this hand made Heavy Crystal . jidy Bear Figurine from MC. Comes with its own gift SPECIAL box, 5-3/4" tall 9062  .  .   $-|088</p>
        <p>3502-217/1 Ret $22 00</p>
        <p>Everyday Low Price $1897</p>
        <p>M) Dessau Solid Brass Full Dimension naylul Sealed</p>
        <p>Elephant makes the perfect gift tor someone special. SPECIAL Adds to aiiy decor. K613  $1ft88</p>
        <p>3$45-504/7 Ret $2995 Everyday Low Price $199? ^ IO</p>
        <p>15) Heritage Industries 24 Karat Gold Elactroplaled &amp;amp;yM RocUng Horse. Graceful looking and beautiful SPECIAL</p>
        <p>Everyday Low Price $199? ^8**</p>
        <p>085 7 Ret $1600</p>
        <p>3509-202 Ret $3199</p>
        <p>Everyday Low Price $289?</p>
        <p>19w</p>
        <p>(11) Heritage Industries Brass 5x7 Photo Frame. This hand polished frame is lacquer coated to eliminate tarnishing, Made from two toned chrome plating with brass SPECIAL ribbed inlay PF1857  $^^88</p>
        <p>4659416/9 Ret $2400</p>
        <p>Everyday Low Price $149?</p>
        <p>(12) Dessau PairolGraiingDeer-aStagand Doe made of hand-polished solid brass. Dramatic looking in any SPECIAL decor Stag 13.5" Tall. Doe 8.5" Tall. K531  $^^88</p>
        <p>3645-500M Ret $75 00</p>
        <p>Everyday Low Price $499?</p>
        <p>border. Includes adjustable sterno burner, water pan. and wood handles. The overall height 15". stand 6-3/4", SPECIAL Diameter 19" Gifi boxed 5806  aQgg</p>
        <p>2611-601/5 Ret $15000 Everyday Low Price $999?</p>
        <p>(9) Rosemark Solid Brass Rope IHm Ashtray. The</p>
        <p>Perfect gift tor any smoker 6" diameter Gift boxed SPECIAL 88882545  $7gg</p>
        <p>2455-016/1 Rel $1500  Everyday  Low  Price  $947</p>
        <p>(10) Asahl Hading Company Musical Carousel Horse</p>
        <p>with blue saddle echoes the nostalgic figures of days gone by Plays the "Carousel Waltz" Horse goes around and around and up and down when you wind it up Gift SPECIAL boxed. 7.5" tall. 340082</p>
        <p>(13) Jay Import Elegant BiKk 10" IMI Stoneware Vase</p>
        <p>with plastic Rickshaw Stand Vase has colorful floral SPECIAL</p>
        <p> -----  14-213021  MOM</p>
        <p>Everyday Low Price $1847 10""</p>
        <p>pattern 13-1/4" tall on stand. 14-213021 3699-501 Ret. $23.95  '  '</p>
        <p>(14) Asahl Hading Nested 3 pc. Hay Set with black lacquer tinish. Calla Lily flower design in pink, gold and green Gold trim rim. lanyard bound handles Alcohol and stain resistant, the trays wipe clean with a damp</p>
        <p>cloth. Small 7.25"x10.75"/Med. 10.75"x10.75"/Large SPECIAL</p>
        <p>185"x11 25" 750737  ----</p>
        <p>3509-107/6 Rel $1299  Everyday Low Price 689?</p>
        <p>(15) The perfect gltt tor any flower lover-lris on BiMk SPECIAL</p>
        <p>Vne dresses up any setting  6160F  Agg</p>
        <p>3551-1105/2 Ret $1700  Everyday  Low Price 6129?  ^51"</p>
        <p>$6&amp;lt;s</p>
        <p>a</p>
        <pb facs="00096780_0222" />
        <p>Start Your Christmas Savings Here!</p>
        <p>S) Caramel Complete Petlle Gumbell Machine with Gumballs.</p>
        <p>nest cast metal construction with non-toxic paint. Accepts pennies. nickels, dimes, and quarters, no adjustment necessary. Can be put on freeplay. All metal coin mechanism. Comes with a 10 year warranty. #332(M)1</p>
        <p>3517401/4 Ret. $18.95 Everyday Low Price (1397 SPECIAL $11 (2) Caramel Indmtrim 62. oz. Gumball Refilli. Features multi color gumballs. seven flavors, blows multi-color bubbles. For machine sold above #6262-09  _</p>
        <p>3517402/2 Ret. $12.95  Everyday Low Price $347 SPECIAL $7.49</p>
        <p>(3| Cross Ball Point Pen In saUn gray finish with Chrome appointments. The newest expression or Cross excellence. Lifetime mechanical guarantee. 2102</p>
        <p>4019-352A Ret $15.00  Everyday Low Price $997 SPECIAL S8J8</p>
        <p>(4) SheaHer Fmhlon Brocade Pen Complete with its own pouch. #FBP647</p>
        <p>4221-20V3 Ret. $13.75 Everyday Low Price (997 SPECIAL SIL88</p>
        <p>(5) Shealfer Hi Gloss Pen and Pencil Set. Sheaffer Quality makes</p>
        <p>this a perfect gift for someone special #95185</p>
        <p>4221-015 Ret $19.00 Everyday Low Price SH97 SPECIAL S9J8</p>
        <p>(6) Amart Musical Double While Doves with finely crafted wood base Perfectly detailed in fine bisque porcelain with delicate floral attachment. Gift box. #6/1266M</p>
        <p>3533-71IM Ret $36.00 Everyday Low Price (^ SPECIAL S19J8</p>
        <p>(7) Amart American Eagle wilh finely cralled wood baso, hand paintedof fine quality bisque porcelain. Perfectly detailed. #6/1099 !^30M Ret. $32.00 Everyday Low Price (4997 SPECIAL S16J8</p>
        <p>(8) Albert Price Musical Hobo Clown Doll on a Crate with Brown Corduroy suit. Plays "Show Me the Way to go Home" as body moves to the music. Porcelain hands, feet and head. #7227 4113-303 Ret $30.00 Everyday Low Price 397 SPECIAL S14J8</p>
        <p>(9) Albert Price Porcelain Musical Clown standing on top of square box. Clown is dressed in red. white, and black outfit. Stand is hand painted in the same color. 11.5" tall #7525</p>
        <p>4t13405n Ret. $30.00 Everyday Low Price 397 SPECIAL S14J8</p>
        <p>(10) Amarl Musical Unicom of fine quality detailed porcelain. Hand painted in soft hued underglazed pastel. 6/2144</p>
        <p>Ret $22 95 Everyday Low Price 597 SPECIAL $1218</p>
        <p>The ntetMCi prltM ilwm IR this flyw im CMpwWiw prICM to be mad MI gxMe to Ow noH al Miniig pricw In On mirkitelKii They are luggMtod list oriCM n ftcgaiiDMdM pricM wo oor doMtmlniilaR of coaipinMe prlcai Iw tiw tmm or similor qoollty moRliondisoL Goilomorv morkops ol roioilon on lokoo lolo conoldoraltoR in aor rovlaw. Ratenoci WO laoaiva tea itfht la IlmN qaaatniot. Hams mwkad laacW ara oa sola. All otear Hams rtawa wa aar UNI avatyday pricas. All phatemphlc. darlcal. typogtapMcal. and</p>
        <p>ndad by tea Hdp. Whan anawllabte tea lalainnM ravlaw. Rateranea pricat an aal aar praianl ar tannar pticai ' prlaUai anaia an aabjacl to eanacUaa.DAWSON'S</p>
        <p>MmtafCard</p>
        <p>FINE JEWELRY AND GIFTS  ESTABLISHED 1916  -</p>
        <p>GRADUATE GEMOLOGISTAVAILABLE TO ASSIST IN YOUR DIAMOND SELECTIONS '</p>
        <p>Next to the Plaza  102 E. Main St. pQp ORDERS</p>
        <p>611 E. Arlington Blvd. Belhaven. NC 27810 CALL NC TOLL FREE Greenville, NC 27834  (919)943-2121  ^  OAA  fiOO  04  0-1</p>
        <p>(919) 355 5252  1  "0UU%)0^"^  141Save This Flyer! Special Prices Good thru Dec 10, 1987</p>
        <p>J .V .ft ,,</p>
        <pb facs="00096780_0223" />
        <p>mm</p>
        <p>&amp;amp;k '</p>
        <p>'Ut</p>
        <p>/</p>
        <p>. i&amp;lt;- ^:.v^  r^&amp;gt;:</p>
        <p>&amp;gt;", i . M</p>
        <p>e 1M7, J. C Panmy Ca, Inc. NP10W43</p>
        <pb facs="00096780_0224" />
        <p>s.</p>
        <p>'^r^-4</p>
        <p>'HtfV .e '-&amp;lt;W-&amp;gt;-&amp;gt;.  -3</p>
        <p>i</p>
        <p>SPECIAL BUY</p>
        <p>49.99</p>
        <p>H</p>
        <p>Bundle up against the deep freeze with our down-filled coats. Choose from a selection of styles for misses and womens sizes.</p>
        <p>A. Cotton sheeting, Special buy 49.99</p>
        <p>B. Poplin stadium, Special buy 59.99</p>
        <p>C. Full length coat, Special buy 69.99 Quilted stadium (not shown),</p>
        <p>Special buy 64.99ON THE COVER:</p>
        <p>Spirited stripes and more from The Fox*. Choose colorful pants, shirts and sweaters in cotton, polyester blends. For misses and petites sizes. p^g</p>
        <p>Polyester/cotton plaid shirt $18 11.99</p>
        <p>Linen/cotton/polyester pullover.. $24 17.99 Cotton/polyester corduroy pants . $16 11.99 Womens sizes. Sale 12.99 Reg. $18 and $20</p>
        <p>Intermediate markdowne may have been token on original priced merchandise shown throughout this circular. ReducUona from original priced merchandise eftective until stock is depletod. Sale prices on regular priced merchandise effective through Wednesday, November 2Sth unleas otherwise noted. Sale does not include JCPanney Smart Values.25% OFF ALL OUTERWEAI</p>
        <p>Represents savings on regular priced merchandise. Special buys not included.</p>
        <pb facs="00096780_0225" />
        <p>^30</p>
        <p>,% OFF PACKAGED BASICS</p>
        <p>I  I Sale 2 for $12 Reg. 8.50 ea. Crossover tricot bra with</p>
        <p>- adjustable straps. Of nylon/spandex for A,B,C sizes. pi-kL. Sale 2 pkgs. for $11. Reg. 7.50 ea. Nylon tricot brief. EuuvO Cotton lined panel with elastic leg. Package of 3.</p>
        <p>Sale does not Include the Signature Collection"'.</p>
        <p>SALE 2 FOR *16</p>
        <p>I Reg. $11 ea. Perfect Shape seamless bra for average to fuller figures. Of polyester for B,C sizes. D.DO sizes available at similar savings.</p>
        <p>20% OFF</p>
        <p>Save 20% on support and control top nylon pantihose. In assorted tones and shades.  Reg.  Sale</p>
        <p>Supershaper"* sheer toe  ..... 3.00  2.40</p>
        <p>Control Top pantihose ......  3.00  2.40</p>
        <p>Total Support"* pantihose......... 6.00  4.80</p>
        <p>Quaan sizaa ara also on sala.</p>
        <p>20% TO 25% OFF ALL OTHER PACKAGED BRAS AND BRIEFS</p>
        <pb facs="00096780_0226" />
        <p>% OFF FINE JEWELRY</p>
        <p>50% off: 14K gold options. Chains in wanted designs and lengths, chaniis and earrings too.</p>
        <p>40% off: cultured and cultured freshwater pearls or stone-set earrings and pendants.</p>
        <p>Jewelry available at most large JCPenney Stores.</p>
        <p>Sale does not include Every Day Value Hems.25% OFF</p>
        <p>Shimmering gemstone rings. Emeralds, sapphires, rubies, amethysts, catseye, onyx, more. 10K or 14K settings.</p>
        <p>Excludes that jewelry where diamonds constHute the greatest value.</p>
        <p>30% OFF</p>
        <p>Sterling silver accents to match her sparkling personality. Earrings, bracelets, pins and necklaces to choose from.</p>
        <p> (if 'i </p>
        <p>TRADE-IN CERTIFICATE When you present this certificate, you can trade in your JCPenney diamond and get fuil credit for its purchase prira when you trade up to a newer, more expensive diamond.</p>
        <p>30% TO 40% OFF</p>
        <p>All diamond jewelry is on sale. Choose from a collection of romantic bridal sets, and anniversary rings. Elegant cocktail rings. Plus pendants, earrings. Handsome rings for men, too. 10K or 14K gold settings.</p>
        <p>25% off 14K wedding bands.</p>
        <p>Includes only that jewelry where diamonds constttute the greatest value. Diamond jeWWry enlarged to show detail,</p>
        <p>25% OFF</p>
        <p>All our better watches are on sale! Bulova, Pulsar, Seiko or Citizen precision watches. Classic and sporty strap styles for men and women.</p>
        <p>Sale prices on this page effective through Sat., Jan. 2nd. All percentages off represent savings on regular prices.</p>
        <p>Holiday countdo'</p>
        <pb facs="00096780_0227" />
        <p>SALE</p>
        <p>0.9912.99</p>
        <p>Sale 10.99 Reg. $15. Austin Manoi^ Performance Plus dress shirt. Basic and fashion colors. Polyester/cotton. Mens sizes UVato 17V2.</p>
        <p>Sale 12.99 Reg. $17. Austin Manor dress shirt of polyester/cotton broadcloth. Mens sizes 14/^ to 17 Va.</p>
        <p>rHE SAVINGS START NOW, SHOP TODAY</p>
        <p>SALE 3 FOR 7.20</p>
        <p>Reg. 3 for $9. Austin Manor crewneck T-shirts. Fortrel polyester/combed cotton knit. 36-46.</p>
        <p>SALE 3 FOR 5.60  .</p>
        <p>]. 3 for $7. Austin Manor briefs. Rib-knit Fortrel polyester/combed cotton. 28-44.</p>
        <p>20% OFF</p>
        <p>All mens slippers on sale. Sale 11.99 Reg. 14.99; style shown. Conifortable espadrille slippers styled in plush cotton velour. Brown or navy. S-L.</p>
        <p>Percentage off represent savings on regular prices.</p>
        <p>Sale prices on this page effective through Sat., Dac. 5th.</p>
        <pb facs="00096780_0228" />
        <p>SALE</p>
        <p>ST. JOHN'S BAYYOUR CHOICE 19.99</p>
        <p>St. Johns Bay"* gets the warmest holiday welcomes. See why right here. S-XL.</p>
        <p>Sale 19.99 Orig. $%. Wool plaid shirt.</p>
        <p>119.99 every day. Cotton chamois shirt.</p>
        <p>I Sale 19.99 Reg. $24. Cotton corduroy vest with polyester fiberfill insulation.</p>
        <p>I Sale 19.99 Reg. $24; not shown. Cotton flannel shirt.</p>
        <p>Tall alzea M-XL at similar savings.</p>
        <p>9.99</p>
        <p>MENS SWEATERS</p>
        <p>Hunt Club* sweaters in the softest wool, lambswool, or wool/acrylic blends. Sizes S,M.L,XL.</p>
        <p>Sale 19.99 Orig. $30. Striped crewneck.</p>
        <p>Sale 19.99 Orig. $30. Solid color V-neck.</p>
        <p>Sale 19.99 Reg. $25; not shown. Patterned crew. Sals price on patterned crew affective through Sat., Nov. 28th.HOLIDAY COUNTDOWN:</p>
        <pb facs="00096780_0229" />
        <p>, SAl -</p>
        <p>WSUlD4MIRsa $46lDie&amp;amp; ComlorTou  W*ws and CondorTour' ahoM. ComtorTour* aliara  acianMcily daaiQnad aliQ ahoaa mada of fit NflM quaMy Mhar on dual or Mpla danaly E. VA aotaa Man a I BtoprtcTHE SAVINGS START NOW. SHOP TODAY!</p>
        <pb facs="00096780_0230" />
        <p>SALE</p>
        <p>9.99</p>
        <p>*  10  I.</p>
        <p>S BAY</p>
        <p>YOUR CHOICE 19.99</p>
        <p>St. Johns Bay gets the warmest holiday welcomes. See why right here. S*XL.</p>
        <p>Sale 19.99 Orig. $26. Wool plaid shirt.</p>
        <p>119.99 every day. Cotton chanrais shirt.</p>
        <p>I Sale 19.99 Reg. $24. Cotton corduroy vest with polyester fiberfill insulation.</p>
        <p>I Sale 19.99 Reg. $24; not shown. Cotton flannel shirt.</p>
        <p>Tall sizes M-XL at similar savings.</p>
        <p>MENS SWEATERS</p>
        <p>Hunt Club sweaters in the softest wool, lambswool, or wool/acrylic blends. Sizes S,M,L,XL Sale 19.99 Orig. $30. Striped crewneck.</p>
        <p>Sale 19.99 Orig. $30. Solid color V-neck.</p>
        <p>Sale 19.99 Reg. $25; not shown. Patterned crew. Sale price on patterned crew effective through Sat., Nov. 28th.</p>
        <p>HOLIDAY COUNTDOWN:</p>
        <p>r</p>
        <pb facs="00096780_0231" />
        <p>SALE</p>
        <p>4.99</p>
        <p>AND</p>
        <p>Shirt Sale 14.99 Reg. $19 and 21.99.</p>
        <p>Par Four* cotton/polyester velour shirt.</p>
        <p>Or the acrylic knit sweatershirt. S-XL.</p>
        <p> Slacks Sale 17.99 Reg. $24 and $25.</p>
        <p>Par Four cotton/polyester corduroy pants. Or belted Sport Slack of polyester.</p>
        <p>Sale prices on shirts effective through Dec. 1st.THfe^AVINGS START NOW, SHOP TODAY!*10 TO *15 OFF</p>
        <p>Sale 34.99 to 49.99 Reg. $45 to $65. ComforTour"' Walkers and ComforTour" shoes. ComforTour walkers are scientifically designed walking shoes made of the highest quality leather on dual or triple density E. V. A. soles. Mens sizes. Sale prices effeeUve through Sat.Nov.28th.</p>
        <p>7'</p>
        <pb facs="00096780_0232" />
        <p>Polyester/cotton velour shirts and cotton denim jeans. Young mens sizes.</p>
        <p>Sale 21.99 Orig. $30. City Streets* shirt.</p>
        <p>Sale 21.99 Reg. $32. Bugle Boy* cargo jeans. ^</p>
        <pb facs="00096780_0233" />
        <p>Vo'^0 A n% OFF ALL KIDS OUTERWEAR</p>
        <p>25%-4o</p>
        <p>Keep them warm and cozy in any of these jackets. Polyester/cotton chintz shells with snug polyester fiberfill.</p>
        <p>A. Sale 23.40 Orig. $39. Boys bomber-style jacket. S.M.L.XL for 8-20.</p>
        <p>Sale $21 Orig. $35. Boys jacket. S,M,L for 4-7.</p>
        <p>B. Sale $21 Orig. $35. Girls hooded jacket. Sizes 7-14. Sale $18 Orig. $30. Girls jacket. Sizes 4-6x.</p>
        <p>SALE *5 AND 9.99</p>
        <p>Sale $5 Reg. 6.99. 'Forever Friends top from Fun Connections. Polyester/cotton. Little girls S.M.L. Sale 9.99 Reg. $13. New Moves rugby stripe top for big girls. Cotton/Fortrel polyester. S.M.L.</p>
        <p>SALE 2 FOR *10</p>
        <p>Reg. 6.99; each. Give him a brisk plaid shirt. Cotton flannel. Boys sizes S,M,L.XL.</p>
        <p>Sale 2 for $9 Reg. 5.99; each. Little boys' cotton flannel plaid shirt. Sizes S.M.L.</p>
        <p>n?* *</p>
        <pb facs="00096780_0234" />
        <p>i</p>
        <p>sale55,98.</p>
        <p> Reg. $72. Jaguar 5000* Series  i</p>
        <p>vinyl luggage set includes 25 pullman, 21 cany-on. and tote. Also I sold separately. Reg. Sale</p>
        <p>27 pullman......$45  35.99</p>
        <p>25 pullman......$37  28.99</p>
        <p>Garment bag $22 16.99</p>
        <p>21 carry-on......$23  17.99</p>
        <p>Tote..........$12  9.00</p>
        <p>20%-40%</p>
        <p>Oleg Cassini* Monaco II luggage of vinyl-backed jute tweed.</p>
        <p>Reg. Sale</p>
        <p>26 pullman  59.99  47.99</p>
        <p>24 pullman  39.99  29.99</p>
        <p>Garment carrier . . . 54.99 41.51 Boarding bag .... 39.99 23.99</p>
        <p>Cargo bag...... 34.99  26.51</p>
        <p>Sale prices on regular priced merchandise effective through Saturday, December 19th.</p>
        <p>40%-50%o'^</p>
        <p>I Samsonite Sidekicks* lightweight nylon luggage.  Orig.  Sale</p>
        <p>28 pullman......$120  64.99</p>
        <p>26 pullman......$100  49.99</p>
        <p>Garment bag $100 49.99</p>
        <p>Carry-on .......$ 75 39.99</p>
        <p>Tote..........$  50  29.99</p>
        <p>JAGUAR 5000</p>
        <p>45%-50% OFF</p>
        <p>Sale 49.99 Reg. $100. Leather portfolio with umbrella.</p>
        <p>Sale 54.99 Reg. $100. Vinyl attache</p>
        <p>case.</p>
        <p>?rf</p>
        <p>SAMSONITEHOLIDAY TRAVEL SALE</p>
        <pb facs="00096780_0235" />
        <p>OFF OUR ENTIRE LINE</p>
        <p>OF REEBOK FOOTWEAR</p>
        <p>SALE 22.99</p>
        <p> Reebok CL 1000 Joggers. Reg. 27.99. The perfect choice for the beginner. Nylon and suede uppers. Mens sizes.</p>
        <p>SALE 22.99</p>
        <p>I Reebok CL 1000 joggers. Reg. 27.99</p>
        <p>A comfortable, durable choice for women on a health kick. Nylon/suede uppers.</p>
        <p>SALE 29.99</p>
        <p>I Reebok Fantasy. Reg. 34.99. Designed for every active woman. Genuine leather uppers. With white terry collar.</p>
        <pb facs="00096780_0236" />
        <p>and^twaawafor </p>
        <p>''.s*</p>
        <p> getta Gno? Here's how for just3.50</p>
        <p>Get over to JCPenney as soon as you can. And do $50 worth of holiday shopping in just one day! For just 13.50 more you can take home our exclusive twenty-four-inch Bear WMh 9byGund*andc$lfr</p>
        <p>Bear pur *CatakM| SMSaleei Quaittllielt</p>
        <p>gii. *</p>
        <p>pwpw...</p>
        <p>"aidiWIWIl!'    "'</p>
        <p>'re/ol;Penney</p>
        <p>EVENT aTilTS SUNDAY. N01 IVILLE. NORTH.</p>
        <p>the</p>
        <p>Hioll|76S-1190 a.m.</p>
        <p>f |hn|. to 6:</p>
        <p>2,1(</p>
        <pb facs="00096780_0237" />
        <p>8711RCV 'I#</p>
        <p>r V7</p>
        <p>- j&amp;gt;;25% OFF</p>
        <p>OUR EVERYDAY LOW PRICES</p>
        <p>ON ALL 14K, STERLING SILVER &amp;amp; GOLD-FILLED EARRINGS &amp;amp; EARRING JACKETS (WITHOUT STONES)</p>
        <p>SEE PAGE 2 FOR ITEM DESCRIPTIONS</p>
        <p>\m</p>
        <p>Q]  OAttONO</p>
        <p>rENNIS BRACELET</p>
        <p>25% OFF OUR EVERYDAY LOW PRICE ON OUR ENTIRE SELECTION OF DIAMOND AND FANCY BRACELETS  4</p>
        <p>/*'W</p>
        <p>&amp;lt;M</p>
        <p>--</p>
        <p>DO NOT DISCARD: PRICES IN EFFECT THRU SATURDAY, NOVEMBER 28, 1987  ,</p>
        <p>PLEASE SEE BACK COVER FOR STORE HOURSFOR YOUR CONVENIENCE NOW OPEN SUNDAY 2:00 PM to 7:00 PM. THRU DECEMBER</p>
        <pb facs="00096780_0238" />
        <p>1)1 AMONi I</p>
        <p>Your Cost WTT 5U,y,'J0</p>
        <p>Your Coil Vr&amp;gt;?WY7T! SrJ99 00 Your Cost  S15)9 00</p>
        <p>Your CORl VVYWOO S899.U0 Your Cost-WiHW S4 9.90 Your Cost **^00 SJ99 00 Your Cost S99- WT S??9.00</p>
        <p>(C) Ladies' i4K Tniow Liotd  'lo</p>
        <p>.1     I  Ct. Your Cost  S1199.0</p>
        <p>';:Y/Vi !t:3  Ct Your Cost  S599.00</p>
        <p>,1.  .  Your  Cost **9^^ S399 00</p>
        <p>V V-    c , Your Cost 99-W  S299 9(1</p>
        <p>(0) Ladies' 14K Yelloyi Gold  di.-.i</p>
        <p>;FM-1. r, 6  i-l' VJ  Your  Cost  29-TT  $17 90</p>
        <p>to-''' G'-.) C  i)C  White  Gold  Ypur  Cost  WT  SI 7 90</p>
        <p>(E) Ladies' 14K Yellow Gold . r U r'^iC* ' 'i-utjC, . ;</p>
        <p>ouo, ^ ;,8:',00  Your  Cost WWW S699 00</p>
        <p>(F) Ladies' 14K Yellow Gold  ui.or-  ir.i J ,j '^v </p>
        <p>Of  Your  Cost-t+?9r90  $99.97</p>
        <p>(G) Ladies 14K Yellow Gold inm hu    'iivo  B</p>
        <p>9HL0 0.3 U  STL on  Youi  Cost 4996'   $34.90</p>
        <p>jPi/jrih.t.;  '/bal  While  Gold  Your  Cost  4999--  S34.90</p>
        <p>SOLITAIRE SOLD SEPARATELY</p>
        <p>TELY</p>
        <p>it SI  (H)</p>
        <p>St  nn</p>
        <p>ost</p>
        <p>o-.t WrHM nn</p>
        <p>nst</p>
        <p>OSt  ^</p>
        <p>1K Y(llow Gol.i</p>
        <p>v; r5  ^lilSl</p>
        <p>4DIAM0ND 25% OFFALL WEDDING SETS IN STOCK</p>
        <p>(1) Udta14K Vaiow QoM 30iamond WMding Band 975441M $305.00  Your CM HM-$149 JO</p>
        <p>(2) Hant 14K Yolow QoW S-Oianond Waddng Band.</p>
        <p>9754017-0 $355.00  Your CM 191$ JO  $I7$J0</p>
        <p>( HM* 10K Yolow QoM 2-Oainond Wadding Band.</p>
        <p>9710023J $140.00 ..........Your CM990.0 $00.00.</p>
        <p>(4) Mans 19K Yolow QoM 2-Diamond Waddng Band.</p>
        <p>9710021-0 $170.00 .........Your CMKOOJOr- 919.90</p>
        <p>m IMoo14K Yolow QoU 10mm Plain Waddng Band. 9060007-5 $290.00  Your Coot OIOO-O- 9119J7</p>
        <p>I LnMoo19K Yolow OoW 6mm Waddng Band.</p>
        <p>3130 $115.00..........YourCMOMJO-OMJO</p>
        <p>(n Mms 19K Yolow QoM 0mm Waddng Band.</p>
        <p>9000011-7 $130.00 ..........Your CM 994.W 990.90</p>
        <p>(9) Ladho 19K Yolow QoM Milgrain Waddng Band.</p>
        <p>9660031-5 $70.00 ...........'^OMMtJO-IIOJI</p>
        <p>(H Mant 19K Yolow QoM MRgram Waddng Band.</p>
        <p>96604S9-9 $75.00 ...........Your  CM J49J0&amp;gt;-990.90</p>
        <p>I LoMao19K Yolow OoM 4mm Plain Waddng Band</p>
        <p>1970.00 ...........Your  0MQ44J0* 920.90</p>
        <p>9660006-7 $70.00 MM QoM. Your 0M044J0  92CJ0 &amp;lt;11) Mans 19K Yolow QoM 4mm Plain Waddng Band.</p>
        <p>9660003-4 $75.00 ...........Your  OM-949JQ- 994.90</p>
        <p>90600044! $75 00 WMM QoM .Your OMOIOJr* 994.90 t-BnnMoammouFmmcomt</p>
        <p>a 14K Yolow QoM Sapphire &amp;amp; Diamond ChMsr Earringa. 1 T6W.</p>
        <p>8568036-1 $230.00 .........Your CM 9H0.9-999J0</p>
        <p>86680350 $230.00 .........Your CM 9110.99  999JO</p>
        <p>8 14K Yolow QoM Emarald &amp;amp; Diamond OuUw Earrings. 1 TOW.</p>
        <p>8568037-89225.00 .........YourCM9K9i99 . 999J0</p>
        <p>glOK Yolow QoM Sapphira ft Diamond Quaior Pandare 1 TOW.</p>
        <p>85680060 $235.00 .........Your CM 91 &amp;lt;0.99  999.90</p>
        <p>g^OK Yolow QoM Ruby ft Diamond dudar PanMl 1 a</p>
        <p>85680084 $235.00 .........Your CMOMOJO** 909J0</p>
        <p>8 10K Yolow QoM Emoraid ft Diamond dudar Pondam 1 TOW.</p>
        <p>8868007-2 $235.00 .........Your CM 9K0.99  99M0</p>
        <p>(7) 14K Yolow QoM 34&amp;gt;dr on BoMd Earrmgt.</p>
        <p>8572^7 $50.00 ...........Your CM 994JP- 924J7</p>
        <p>O) 14K Yolow QoM HaaitOhapedlOCiimond Earring Jacfcda. K72-130O $200.00 .........YourCoot 9199&amp;gt;90  $99.90</p>
        <p>m Ladtao14K Yolow QoM Square Ruby ft Diamond Ctiannel-SdBand</p>
        <p>9822-003-1 $740.00  Your CM 9499.90  9399.90</p>
        <p>(10) IMoolOK Yolow QoM11-Emarddft543iamondCluder</p>
        <p>S^C23-7 $215.00 Your CM MOMO  9119.90</p>
        <p>^LadMo 19K Yolow QoM Sapphira ft Diamond Cluder</p>
        <p>9782-0187 $185.00  Your CM OMOJO- 999.90</p>
        <p>(12) LoMoo* 10K Yolow QoM Ruby ft Diamond Cludar Ring.</p>
        <p>9782-011-2 9185.00 .........Your CM QHIJI* 999.90</p>
        <p>(I^WooMniillBliMit lowolCho&amp;lt;&amp;lt;.Elchadgiaat.parfumetray lop and mirrored oompartmant.</p>
        <p>4618023-2 $80.95 ...........Your OMQIOiOO  989.90</p>
        <p>tl4) 14K Yolow QoM Figree Hoop Earringa.</p>
        <p>8M0681-4 $185.00 ..........YourCMQIIOJr- $09J7</p>
        <p>(19) 14K Tricolor DiamondOW Hoop Earrings.</p>
        <p>67281287 $89.95 ...........Your CM-944iOY- 929.97</p>
        <p>(1$) 14K Yolow QoM PoWwd Doorknockor Earrings.</p>
        <p>86840080 $155.00 ..........Your CM 999iOY^ 999 J7</p>
        <p>(17) 14K Yolow QoM Ooublo SoM Ropo Btaodd Mi .20 d TW Diamonds.</p>
        <p>8572-0781 $009.00........Your CMQ499.J9  9299.90</p>
        <p>(1914K Yolow QoM Diamond Tonnis Bracold. 1 CL TW ^-0086 $1095.00  Your CMJ4I99!98-9999.90</p>
        <pb facs="00096780_0239" />
        <p> :=</p>
        <p>Q _</p>
        <p>iir'-s^^</p>
        <p>  &amp;lt;*</p>
        <p> ^ ^</p>
        <p>. XV '</p>
        <p>/yiSSf</p>
        <p>r, ^</p>
        <p> \.y</p>
        <p>E</p>
        <p>EMERALDS E ^</p>
        <p>-T</p>
        <p>D X </p>
        <p>AMETHYST</p>
        <p>r^r ,</p>
        <p>V~'</p>
        <p>E .1</p>
        <p>-&amp;lt;4-ES ;/</p>
        <p>RUBIES</p>
        <p>CITRINE</p>
        <p>SAPPHIRES</p>
        <p>ifX</p>
        <p>TOPAZ</p>
        <p>-i?X n -&amp;gt;'</p>
        <p>^ I '</p>
        <p>X-*C-Ti:S?</p>
        <p> '    -t</p>
        <p>g^) UM 14K YaNow OoM 19-Oiamond Marquise CtusMr Ring. l</p>
        <p>9822-99.9 $1350.00 ...........VoMf Coit4W.ee  $6W.OO</p>
        <p>(2) Ladtoe' 14K VaNow Qoid 19-Oiwnond Band 2 O. TW. Si04-i6-i $3100.00 .........Yaw  coal  mw.e-$17$$.00</p>
        <p>s!iffirr.'^Tr&amp;amp;%S!?s.a</p>
        <p>($&amp;gt;Laaa1aKYaMol^Oeld28^)ia^wndHorlalhoaRing: ^44M $525.00 ............YaurCealliW.tr  tlW.$0</p>
        <p>(I) Udha 14K YaBaw Qotd 7^&amp;gt;atnond CMW</p>
        <p>M94-847-2 $1185.001 Ct. TW. . .Yaur Caat&amp;lt;MJ&amp;gt;  $488.00 9904-537-g $506.00 W CL TW .. Vaar Cue! 0800:00  gOOJO 9004.538-7 $505.00 W CL WQ.. .YaurCeal OOOyr- gOO-OO 9004-105-5 $375.00 H a TW .. .Yaur Caal ooaowr* 8100J0 9904-100-3 $375.00 CL WO Yaur Oaai0040Wr* 8100.00</p>
        <p>(7) Ladtoa10K YaOaw OaM OOiatnond Heart SjwM Rit^ Sife2-935-7 $138.00 ..............Yaur  CaatWiOO'VoJO</p>
        <p>(8) UdMa 10K YaOaar OaW 3-Row Oiainond Bi^</p>
        <p>9MO023-1 $270.00 ............Yaur  Caal OWOtOO-OltOJW</p>
        <p>(II) Ladlaa' 10K Twa-Tana 7-Oiamond BUlarfly^, .07 &amp;amp; TW ^-907-4 $140.00 .............Yaur  Caal 8MMY  800.00</p>
        <p>I LadWa 10K YaOeir Paid O-Diartwnd Quijar ^</p>
        <p>319J $310.00...........Yaur  Caat OlOOJf  8140.00</p>
        <p>9904-020J $310.00 WMa QaM . Yaur Caat 0400i0r- OIM-M</p>
        <p>g$) Ladtoa'14K YaOaw QoM 18-Oiamond Oval Clualar Ring. Vk Q.</p>
        <p>9904427-5 $785.00 ............Yaur  Caal JtlOiOr 8080JO</p>
        <p>aw.%r**^Yj?saaps!a</p>
        <p>(10) UNlaa 10K YaOew OeM Emerald &amp;amp; Olamand Fancy RMg.</p>
        <p>97&amp;amp;0134 $225.00 ............Yaur  CaatOMOJT- 0110J0</p>
        <p>(171 Ladtoa* 14K YaOaar QaM Haart-Shape Cnattwm Emerald &amp;amp;</p>
        <p>10-DWnond Kim.</p>
        <p>99044054 $500.00............Yaur  Caal OOOOrOO-OOMO</p>
        <p>&amp;amp;^,ss^r^tiss&amp;amp;sf:sx</p>
        <p>^ Ladtaa10K Yaiaat QaM eJapplwa &amp;amp; 1-OiarrNirW Tuto^ 97* 965-9 $150.00 ..............YaurCaatOOOJO-MOiT</p>
        <p>(8 Ladlaa'10K YaOaar QaM 13-Ruby 0 e-Oiamond ng.</p>
        <p>%&amp;lt;X4 $230.00 ............Yaur  Caal 8140:00  8110.00</p>
        <p>) LadMa10K YaOaar QaM Paat4hapad Ruby * Diamond Ouuar</p>
        <p>J-1334 $300.00 ........:. Your Caat&amp;lt;OIOO.Or- $140.07</p>
        <p>04) LadMa'14K YaOaar QoM 7^ 013-Oiamond Ring.</p>
        <p>9706-2054 $000.00 ...... Yaur  Cool 0800Jt-loi|M</p>
        <p>(2QLadMa'10K YaOaar QoMOSapphiraft i43iamondCoraaoaR4rg.</p>
        <p>9778-511-7 $150.00 ..............Year  Caat lOOiO- 870.00</p>
        <p>I LadMa'10K YaOaar QaM I44apphn 8 7-Oiamond Band.</p>
        <p>Ul9-5 $280.00 ..........^Tour  Coal OlOOWr-8120.00</p>
        <p>(LadMa10K YaOaar QoM Sapphira &amp;amp; 6-Oiamand By4&amp;gt;aiB Farv</p>
        <p> J $310.00  Yaur Coal-OIOOJO* 40J0</p>
        <p>BLadMa* 14K YaOaar QoM Paar-Sbape &amp;amp; 12-Oamond Rmg on</p>
        <p>9904-^ $550.00 ......  Your  Caat 9800 0 8290J0</p>
        <p>m LadMa* 10K YaOaar QoM Marquiaa4hapa Amatryu &amp;amp; Diamond</p>
        <p>982004V?^.00............Yaur  Caat OlOOJr 8120J0</p>
        <p>(00) ladMa 18K YaOaar OeM Olrina 8 2-OlimorM .R^.</p>
        <p>98*4004 $15800 ..............Yaur  Cual 080.0# 070.00</p>
        <p>m) UdMa 14K YaOaar QoM Haart-Shapo CIrine 8 lODiamond rttno 75 TQW</p>
        <p>^-037-7 $450.00 ............Yaur  Coal 1080Jr- $240.90</p>
        <p>)LadMa'14K YaOaar QaM Octagonal 8KjeTopaz8i8Diamond</p>
        <p>1-571-8 $595.00 ............Your  Cool 0800J0*- 8290.00</p>
        <p>CT. - CARAT. K - KARAT, TW - TOTAL WBQHT OR - ORAM, TOW - TOTAL OEM WBQHT RMQO MAVM INLARQB) TO OHOW DCTAK.</p>
        <p>RMQ OOMIQ CHAROn MAY APPLY POWeiTAQKO OPP 00 NOT APPLY TO MBKNAMNOIALRIAOY ON MARKDOWN</p>
        <p>e'a-3</p>
        <pb facs="00096780_0240" />
        <p>25% OFF</p>
        <p>ALL DIAMOND SOLITAIRE PENDANTS &amp;amp; EARRINGS IN STOCK</p>
        <p>VI/ V</p>
        <p>/&amp;gt;&amp;lt;</p>
        <p>t</p>
        <p>!.-  ET  *.</p>
        <p>DIAMOND</p>
        <p>CUT</p>
        <p>25% OFF</p>
        <p>ALL MENS RINGS IN STOCK</p>
        <p>BIRTHSTONE</p>
        <p>RINGS</p>
        <p>^tb6W li{.  ^T\  /^'</p>
        <p>- AT. y/s  4Li- MONTHS  '</p>
        <p>available</p>
        <p>CULTURED PEARL</p>
        <p>(1) Ladtes' 10K Yaioi* Qotd Synthetic Birthstone Ring. 9658^1-3$75.00Jn. ...YourCoM4M!9r-tNJ7 9858-903-9 $75 00 Fab. . .Your CoM^taMY  $38.87 9858-9054 $75.00 March. .Your Cool 848r  $38.87 9858-907-0 $75.00 ApiN ... Your Coat448if7  838.87 9858-909-6 $75.00 May .. Your Coal8&amp;lt;8:8r $38.87 9858-911-2 $75.00 Juno.. .Your Coal8a8.fr $38.87 9658-577-1 $75.00 July .. .Your Coal 8a8ffr 838J7 9858-913-8 $75 00 Augual .Your Coal fa$f I38J7 9858-915-3 $75.00 Sffpt... Your CooHafitF 838.87 9858-917-9 $75.00 OoL .. .Your Coal 888.87 $38.87 9658-919-5 $75.00 Nov. .. .Your Coolfa8r $38.87 9856-921-1 $75.00 Doo. .. .Your Coat $48i8F  $38.87</p>
        <p>(2) LadMa'22K Ya8ow QoM 2 Pen Coin in 14K frame. 9852-815-1 $310.00 Your Cool 8a88J&amp;gt; 8148J0</p>
        <p>(3) LadMa 14K Yalew OoM V,o Ubetty Coin Ring.</p>
        <p>9652855^5 $565 00 Your Cool 888840* $288JO</p>
        <p>(8) Ladtao' 10K Yalow Gold Fancy Signet Ring with Diamond</p>
        <p>993(M)07-1 $155.00 Your Coat 888.80-- $78.80</p>
        <p>(8) LadMa' KMC Yalow OoM Figreo Signet Ring. 4BrandMa</p>
        <p>9858-5658 $8000........Your Coot 88840$48.80</p>
        <p>(8) LadMa 14K Yelow OoM Smal OvN OiamoncKXit Signet Ring.</p>
        <p>98240478 $110.00.......Your Coat 8$84r  848.87</p>
        <p>(7) LadMa 14K Yalow Gold OiamondCut Dome Ring. 98248294 $200.00..... Your Coot881840 888JO</p>
        <p>(I) LadMa 14K Yalow GoM Oiwnond8ut Dome Ring.</p>
        <p>96248098 $125.00.......Your CoatJFOJO^ 888J7</p>
        <p>mLadMa 14K Yalow Gold Pearl &amp;amp; 2-Diamond FiHgrae (%ng</p>
        <p>98524738 $230.00 Your Coat 8880.88 $118.80</p>
        <p>(10) LadMa lOK Yalow Gold Heart-Shepe Opai &amp;amp; 108iamond Ring.</p>
        <p>9852841-5 $21500 Your Coat 880848 $118.80</p>
        <p>(II) LadMa 10K Yalow Gold Ovd Opal Bypass Ring. 99300038 $75.00........Your Coal84848 $88.80</p>
        <p>(12) LadMa 10K Yalow Gold Onyx &amp;amp; 1-Oiamond ffing. 9940-503-7 $155.00........Your 000188848 878J7</p>
        <p>(13) LadMe10K Yalow Gold Onyx &amp;amp; 3-Diamond Ring. 9776-1538 $200 00 Your Coat8888.88 $88.80</p>
        <p>(14) LadMa 10K Yalow Gold Navette Onyx &amp;amp; Diamond Rmg</p>
        <p>99308014 $120.00 Your Coot 87848 $88.80</p>
        <p>(1$)Mana 14K Yalow GoM Genuine Ruby &amp;amp; 12-Diiiond Ring. 1 Ct. TGW.</p>
        <p>99088898 $1425.00... Your Coat 8888.88  $748.00 (18) Mana lOK Yalow GoM S-Diwnond Signet Ring. 98548358 $405.00.....Your Coat $808.888188.80</p>
        <p>(17) Mana 10K Yalow GoM Onyx &amp;amp; 7-Dinond Ring. 9940-5094 $385.00.....Your Coal $14840* $188.90</p>
        <p>(18) Mana 14K Yalow QoM iSOiwnond Ring. 50 a TW. 9906879-9 $1150.00... .Your Coat $788.88 $880.00 (1^ Mana 10K Yalow GoM 7-Disfnond Nuggot Ring.</p>
        <p>9908-3174 $340.00.....Your Coat$M#4r $188.80</p>
        <p>(20) Mans 10K Yalow GoM Sapptwe &amp;amp; 3-Diamond Nug-gat Ring.</p>
        <p>9736-7018 $385.00.....Your Coal $84848* $179.97</p>
        <p>CT. - CMMT, K - KARAT, TW  TOTAL WBOHT TOW - TOTAL ODA WBOHT, OR - ORAM RM08 MAY 81 MtiMQID TO 8H0W OITAR.</p>
        <p>RMO 8BRM CHAROn MAY AFFLV PMICHfTAQIS OFF 00 NOT APPLY TO MBWNANONi ALR8A0Y ON MARKOOWN</p>
        <p>J</p>
        <pb facs="00096780_0241" />
        <p>CHAIN SOLD SEPARATELY</p>
        <p>DIAMOND ^</p>
        <p>;.0 c, f AMERICAN</p>
        <p>. Tv .: f / AGiE --&amp;lt;;:' j'  .  com  &amp;gt;/:    1  A'  :</p>
        <p>'ffe  --Mfe'';</p>
        <p>8990-': n</p>
        <p>561-6</p>
        <p>8986-U3-9</p>
        <p>&amp;gt; %  y</p>
        <p>It /f</p>
        <p>STERLING SILVER BOW</p>
        <p>25% OFF OUR EVERYDAY LOW PRICES ON ALL 14K, STERLING SILVER &amp;amp; GOLD-FILLED EARRINGS &amp;amp; EARRING JACKETS (WITHOUT STONES)m.</p>
        <p>  3980-666-7  V</p>
        <p>8990-633-3  JACKETS  SOLD  SEPARATELY</p>
        <p>' J'i \i \</p>
        <p>8800-</p>
        <p>  --- 037-7J</p>
        <p>'W %</p>
        <p>^m7r:Q%%*# %</p>
        <p>9228- 'Pf</p>
        <p>7? '.  031-2    -.ADD*A*BEADS - 3mm-10mmFROM 18^ TO ^7^^  8664-050-</p>
        <p>3mn</p>
        <p>107-8</p>
        <p>108-6  ^  '  *vf  Emm</p>
        <p>30% OFF'</p>
        <p>OUR EVERYDAY LOW PRICE ON OUR</p>
        <p>ENTIRE SELECTION OF 14K GOLD CHAINS &amp;amp;</p>
        <p>. CHAIN BRACELETS</p>
        <p>Bmm</p>
        <p>A'*  8794-</p>
        <p>''y 007-8  ''</p>
        <p>8794</p>
        <p>DIAMOND-CUT 005-2</p>
        <p>' CULTURED  I</p>
        <p>BRACELET - NECKLACE</p>
        <p>'  '--it</p>
        <p>re  '</p>
        <pb facs="00096780_0242" />
        <p>CULTURED PEARLS</p>
        <p>10K a 874CV  %  V  ^</p>
        <p>\  S27-0  ^  ^</p>
        <p>9306-</p>
        <p>'*  UK  677-7</p>
        <p>DAZZLING '  S</p>
        <p>DIAMONDS  </p>
        <p>9306-625-6  /  '  ?</p>
        <p>'Hij '</p>
        <p>S572-034-0</p>
        <p>w</p>
        <p>5-  8740-</p>
        <p>-V ' 733-4</p>
        <p>'JHANCER SOLO SEPARA TEL Y</p>
        <p>'.V&amp;gt;</p>
        <p>SILVER</p>
        <p>^ 8724-5726  /-</p>
        <p>^ O  # e '5? ..r  ay.^ ^</p>
        <p>CUBIC ZIRCONIA TENNIS BRACELET  9314-999-5</p>
        <p>UN ASSORTED</p>
        <p>8835-  ^  ,</p>
        <p>500-3  ^  -&amp;gt;</p>
        <p>cn I en</p>
        <p>-  -'  QOXJ.</p>
        <p>STERLING SILVER</p>
        <p>890-40ft-0</p>
        <p>8570-987-1 ASSORTED </p>
        <p>8WO-4ii-8-.'f:*''^'</p>
        <p>f:  '</p>
        <p>W&amp;lt;-8</p>
        <p>STERLING &amp;gt;'V^</p>
        <p>&amp;gt;&amp;gt;  r"  '</p>
        <p>^  .-  311-9  UK</p>
        <p>i - Br*fld1'  8948-346-B</p>
        <p>UK  .</p>
        <p>DIAktOND-  -, V .</p>
        <p>CUT  W</p>
        <p>10K</p>
        <p>8570^)48-2</p>
        <pb facs="00096780_0243" />
        <p>9Sl0)Miaft00  V</p>
        <p>S6lSMW001Wlew  V</p>
        <p>0) Umb Lli'VIIDW 0M OuM Met I* ocagom M tnd MKiHd bncM. 931MTMIMIS  mCmUMO  IM.W</p>
        <p>WilUail'YilwtQBldawWWMtfniitiBMfcdW.IMMWWMtMmnaMKli</p>
        <p>tntyw-* SH.00 WH M</p>
        <p>(111 trihi UliM'TnTont Qum Moh Mh lacwiguM IM mmM MhM. *eiO7St1WOO  .VwrCMI4MM^S11M?|</p>
        <p>(IVWMiJMi'VMMtOaidQuMWMCKMtiiwtnguMaMMMiqri WIO-TTM 035.00......</p>
        <p>(imtlwllWiMliGcldOiMttMcmi*ioundag.dMMlt.lwmecndMndl</p>
        <p>OSI00030500 (14 MM &amp;lt;&amp;gt;' VMMt OM QumB Mdi &amp;lt; round &amp;lt;M. IMM</p>
        <p>MOOndMliWd|</p>
        <p>|4MHrtlMi tWMQMQMMWMdioMt</p>
        <p>9004-74M *13000.........  TwrOMIO</p>
        <p>OaOt-744t1l5JOOMiMM .................VwewMOi</p>
        <p>WCll LlllirVMMrOaaOuWWMnMiiBMdBOlMSMndiMOd</p>
        <p>M1I4 51*500   IWrOMOW</p>
        <p>(i| U IM*H LJttM-VW0 Qou OuM MCK &amp;gt; IfrdMMnd OMI &amp;lt; loigowlaok MHM 05755310 513500 .............</p>
        <p>(7) IM WM LMm'YMm GoU Meh It IMmi</p>
        <p>wciiodlMeM</p>
        <p>90055i55iasa0  VmOmI4</p>
        <p>WMwJMBMMWvt'iVMoOoUQuMWMclKMiaeMaa ooM iwid M Mian Mnd 067309*05109.55  ..  .</p>
        <p>( NmOMi Mm I YdkM QiM OuM Men Ml round</p>
        <p>0510051051X00..... VawOMOOOOO*</p>
        <p>-5I503 (XIMhOIMn'lToe-TanoOuMlOMGliwOirocMMMiorMMMalMMdl itMOM 5S10005451X.W  VWrOoMOMOM*</p>
        <p>(N| MM Mw'i YMm Gold OuM Mdi &amp;lt;rdh rocMnguM Meh dW ind IHch no I</p>
        <p>51005005175W   M-----------</p>
        <p>(in Mmt Min'i YalBi OHd AnadV Gum Mc ! MUM dM wd Ormki 000*0050 5iisn  </p>
        <p>(lOtXdMlHntYdMirOrtdAnidOiQMMOManrdtiiMMMClHdhindMdiM! ni57050*40. ...    '  '</p>
        <p>(10|eHlIMn'iMcktacwUoooaMraMdi X nw MW rodwre</p>
        <p>iOMrtiM0iL3OOi</p>
        <p>kor-OMjrl</p>
        <p>0500000.7 5tX......... 0</p>
        <p>(HI MM UAH'Ymow Gold OuM Meh 01 round M Md IO-753*t10.a  Mr  I</p>
        <p>(SHOMdlMniMokMornd</p>
        <p>*69*OI5aX ......</p>
        <p>mCMMMtnilMikOHlI</p>
        <p>*5350*70 5MM</p>
        <p>(1l)M|1MiiriTHiii flirifnn i^iTinTi^iirrdtiidr  ifdii Vir~T-it| wnwoindiiind II575W</p>
        <p>.^'1</p>
        <p>' &amp;gt;-  v/</p>
        <pb facs="00096780_0244" />
        <p>B</p>
        <p>(1) WoMimifc 1H4M. Pood Waraior. Indudes warming candis, oven-ptoof Nnor.</p>
        <p>^2-2854 $47.96 .............Yow Cost-ddtJT- $$4.99</p>
        <p>(^lnlMWilieiiaHllwPlal8d9-Qt0pinB*iH8iva.0vsn-</p>
        <p>prodinsr.</p>
        <p>3276007-6 S34.9S.............Your OooldMr- 919.99</p>
        <p>($1 OotonW CMdteOouidnr Ommo*'Coloeioii. Tho moal popuhr cornUnatirm across Ihs country d WMarraburg Uus w^ "Country Goose" motif. DefinlMy a charming addition tor every Wlchen.</p>
        <p>aCndelsis.Seto&amp;lt;4.</p>
        <p>M01-8 $53.95.............Your CootHtJir- $99.99</p>
        <p>aPMiiod THe. 9" X 9. Qffi boxed.</p>
        <p>8005-9 $10.95...............Your Coat-69:9r. $7.97</p>
        <p>ill</p>
        <p>$9.50................Your Coot-tMT  99.M</p>
        <p>m Wooowials Sot o( 4. Screen prims on easy care 50%</p>
        <p>pdye8ler/S0% cotton.</p>
        <p>46434304 $16.95  ............Your Cool $41.99  910.N</p>
        <p>m Pol HoMor, KNehon Towel 9 Mt</p>
        <p>4643431-2 $14.50..............Your Oool 944:9r- 99.99</p>
        <p>........... Your Cool 94949-914J9</p>
        <p>0|l Mkil TmMs*</p>
        <p>46434270 $7.00................Your Cool-99i9t- 94J9</p>
        <p>(in Mewoioonl. Gilt boxed.</p>
        <p>113.80..............YourOool#49i9-$9J9</p>
        <p>2G19004-2 JlSSs'*..............Your Oool49i9r* 97.97</p>
        <p>(ia)tpooimoL</p>
        <p>bl9^ $5.95.......................Your  Cool  $4.97</p>
        <p>(1$) Hofsro 9#loeo Como  9otvo lot Natural hardwood cul-^ boaid. 6" carver, 7" tork and 6 sloak knivoo.</p>
        <p>3303002-6 $49.95 ............Your Cool 9Mr  924J9</p>
        <p>(1^ toofo une. Mouwrloo OhuMiwara. (3ually Stoneware</p>
        <p>with dslcale posM blooms on black rka</p>
        <p>3382008-1 $95.00.............Your Oool994r  949.99</p>
        <p>V."</p>
        <p>(in longo 20-noee Nooo ChMi" MnnonMare. Service (or 4. Condsto d 4 each; dkvwr platoe, ssied piales, soudcered bowls, cups arxJ saucers. Microwave arto duhwaahar saia Decotaled with roiM.</p>
        <p>33520164 $85.00.............Your Oool9W.-9r-$49.99</p>
        <p>gMn Durand Oeedne Oleeewaiw. deer glaae with black stem</p>
        <p>(1fl9%4)B.nulao.</p>
        <p>IMS...............Your  Ooal99M-  96.99</p>
        <p>tin 1M. OoMolo.</p>
        <p>^96...............Your  Coal99!9r-  99.99</p>
        <p>(in 190a. Coolora.</p>
        <p>.31?  -V  Your  Ooal-994r&amp;gt;  99.99</p>
        <p>(in liwgo "laiilr LMoo" 19#e. CMasowaia. Indudas tour each: Ifroa. too, 12-ot beverage and lOVlMa orvthwrocks. 33S2-602-7 $27.50  ...........Your Oool949r&amp;gt; 914.99</p>
        <p>tango Moek Utoo'* l4Jlor Tliomiol Oorafo. Made d high mpact durabto plaalto vA glaas Irwr whkih to braak-resiatanL Ideal</p>
        <p>iaisatdnnerware ahoimoondnes.</p>
        <p>gntnyy Uioa" 194I. in swrt^KiS^^ with</p>
        <p>3^OKK7$im00............Your  coal 999jtr 949.97</p>
        <p>AoeoOoMMortot</p>
        <p>SSS?*  ..........omMnn - 919.99</p>
        <p>m tongo Moek LMoo" HoMooo lot Gravy, oovored butter, salt and pepper.</p>
        <p>^OIM 7.50.............Your  Coolillrtf  917.M</p>
        <p>m WootoY $9#o. CuHoty t Tool lot 9 Ulchen and 8 steak</p>
        <p>............contiwT. 9.97</p>
        <p>m  Monkd IM-Pe. nnwaia. Sorvloo comais d  12</p>
        <p>001^: dim knivoo. soupspoons, dinnsrtorks. aatato forks, ice tee spoons. bmergirsodsrtdOTltaiee spoons, ssatood forks: 24 leas-poona and 6 aarvkw pieces.</p>
        <p>3402-0069 $100.00..........  .Your  Cool 949f  $44.99</p>
        <pb facs="00096780_0245" />
        <p>(1) LoramOT SoM (Me Tabto Top WogHno Rock. Two</p>
        <p>functions combine in one solid oak table. 18x11" top, 2046" high. Made in USA.</p>
        <p>48464X)6-7 $54.95 .........Your Cooi44t:tP-134.99</p>
        <p>(2) AflRNrti Sol ol 4 Ooramic Qoooo. 4 assofted in various poses standing and laying down. Hand-printed.</p>
        <p>4552-g680 S8.95............Your  Coot PPM*-94.99</p>
        <p>(9) Artowrii Potpourri toont Ytannor. 2-piece glazed ceramic hotpot acenier with cande. Two4one diip finish on white. A potpourri pleaser. 3 x 4Vk TaM.</p>
        <p>4552-964-1 33.25 ............Your  Coot 99i4T. 91.99</p>
        <p>W Artmaili laige Teddy leer *. Oramic aWng toddy boar. Cuddly  looking charmer with hand-painted details. 4552-959-1 S6.95............Your  Coot 99d9-94.99</p>
        <p>(8) London Uothar Jewel Bok. Raised parquet-paneled Nft-top and sculptod finger groove. Features 3 removable (snap-ouO travel pouches and fulHenglh elasticized carry al. Ful tray witeptusMkied ring rote and sectioned jewelry compartments, lifts out to reveal 2 Mge jewelry compartments. Lustrous antique grainad walnut finished.</p>
        <p>4828-9S(M 931.96 .....  .Your  Coot9ltd9  919J9</p>
        <p>London LaaBisr Habooca. Fruitwood color, velveteen Ined oval froteed mirrors, mirrored back.</p>
        <p>4828C2(M&amp;gt; 932.95 .........Your  C00t99!99  919.99</p>
        <p>(7-9)Moolny avorta" LoadOiyataiOoleoiion. BeauMui. over 24&amp;lt;Mi lead crystd. Gift boxed. Made in Qermany.</p>
        <p>(7) Candto Hotdsia. 5" high.</p>
        <p>33394)07-1 925.00  Your Coat 914.99 - 912.97</p>
        <p>m VMO. TVb" high.</p>
        <p>33394)21-2 922.00 ..........Your Coat 91tM - 99.99</p>
        <p>93394)05-5 920.00 ..........Your Coat 49:99  99 J9</p>
        <p>(19) ttonay Broolc Vagetebte In. 35"H x 15te"W x 11 te"D. 47754)03 979.95 .........Your Coat99M  949J9</p>
        <p>(11) Stonoy Braolt Talar Onyun Hn. 24"H x 18"W x l2Vk"D.</p>
        <p>47754)04-7 969.95 .........Your  Coat949.-9r 942.99</p>
        <p>(12) Stonoy Brook Magadno Rack. 14"H x i5te"W x 8"D.</p>
        <p>47754)01-3 939.96 .........Your  Coat999i99 - 923.90</p>
        <p>VMM  IVboIc*</p>
        <p>47754)02-1 929.95 .......  .Your  Coat919i99  91SJ9</p>
        <p>(19) Stonoy Brook Bread Bm. 12WH x 16W x 11 Va O. 47754)054 949.95 .........Your Coat 999.99 931.99</p>
        <p>(14) Stonay Brook Mndlna Boa. l8te"Hx23"Wxi2te"0.</p>
        <p>4775006-2 959.95 .........Your Coat 9449T 937.99</p>
        <p>(IQ kaport (taaBPiaies Ciyatol Covered Cake Stand.</p>
        <p>Elegant crystal pedestal design cake stand and cover is lOVi"</p>
        <p>34000130 930.00 .........Your Coat 919.99  914.99</p>
        <p>(19) Upper Took Papar Towel Rook. Wal-mount horizontai rack. 5 x 15".  '</p>
        <p>4630-051-1 911.95 .......... .Your CootS9i99^ 97.99</p>
        <p>(17) Rational Mouaawaraa 3-Qt Caaaawls. Covered gtess casserole with teak cradle.</p>
        <p>4760005-1 923.95 .........Your Coat irr 914.97</p>
        <p>(19) (Mdkial CMno (teuntiy VIeloilan Sawins BoakoL Tapeatry basket with beautiful country design and stykzod haoits. 7 X 10".</p>
        <p>4550002-2 931.95 .........Your CootS4r. 919.99</p>
        <pb facs="00096780_0246" />
        <p>-'f </p>
        <p>(I)toeliorHocMii9#c.MIrowiwPoppwi&amp;gt;tmiiwr/HoMHr. Base, rack and covw compMe wHh radpe booMel MIr's Si .00 rebate.</p>
        <p>^013-1 S14.95.....................Your  Coal Mr-W.M</p>
        <p>(3) Anehor Hooking Round Rook. 12" round diameter DOhwamer/microwave safe. MIr's $1.00 rebtfe.</p>
        <p>2552^14-9 $6.95......................Your  Coal AM - $$.49</p>
        <p>(Q Anehor MoeMnglMemsave* Raeon Roek. Mictowave eato. Mfr's $1.00 raba.</p>
        <p>2S62-011-S $6.95......................Your  OealJM. 6$.4</p>
        <p>fflAnehar Hacking Mcwwo* DMdadDWi.VWhs&amp;amp;xage cover. Mfrs $1.00 raba.</p>
        <p>25524)12-3 $8.95......................Your  OooKSiW- 6$^</p>
        <p>unan Re. Nteiowawo Sol CorMne 4&amp;lt;$. casseroto vvilh divided dinner p cover, IM ql. caasarato with cover. l-qt. casseroto with divided cover. 2oup sing serving bowl with trivai/saucar cover.</p>
        <p>2742-069-3 $29.95 .............  YeurCoela4*Y-  19.97</p>
        <p>&amp;lt;6)MoldIMMero OoRound* .Automaticfoodrolorlormicrowave ovens. No more hot or cold spdsl Features dependab. sltont-rurming spring powered mechanism and conversant on/ofi switch Inumal reltac-ting dk re-dkectt microwaves upward into food tor mon efficient cooking. Ft even smalast ovens maiM No batteries or assembly tequked. 0" dmar. IVk" high. Mfr-a $5.00 raba.</p>
        <p>2776097-2 $10.96...................YourOaol4l4ir-gi$.N</p>
        <p>(61 Oomktg Tito Ole. Comp wkh 1 and 1 Vthquart casserotoe with</p>
        <p>1-ptoetic and 1-gia cover (intorchangeab) and 2-quart glass covered cassercto</p>
        <p>2640-1720 $26.05 ftolal ouquat.....Your CoolSMiOY - 16.60</p>
        <p>2640-127-3 $28.05 tgloo O' Uto.......Your Coot 64ir- 816J0</p>
        <p>2640-173-7 $26.95 lodoir Me........Your Cool MiOf- 16.69</p>
        <p>(10) FeOwor Old faaWened Ropeetn Ropgar instantly pops popcorn the old tashicned way. wkh bandy stirring mechanism to ensure Nl kernels pop. Hotds i4&amp;gt; to 4 quarts.</p>
        <p>2657-001-0 $10.05...................Your Coal MtOT- 10.67</p>
        <p>(II)Vlsleno* y Oetidng*. 7-piece Cook's Ctassic Cookware Set. in-cludoe; 1-quaiL 2W-quait covered sauce pans, S-quait covered sauce pot and a 10" sMtot wNh toxturad bottom.</p>
        <p>2640-152-1 $69.95 ...................Your  Cool UH&amp;amp;r- 86.67</p>
        <p>(12)OoiwlsrClriMaaltooOnaHilklr. Requiraenoios, nosaR. noatoc-trictty. Ice cream in 20-minus.</p>
        <p>2649001-1 $45.00 ....................Your  Coal I616Y  H.67</p>
        <p>(18) Ragal ORIaeo "Otay Raflaeltona'. Rich, pewter gray durabte nonstick exriors and Siverstona* intoriort. make thn cookware easy 10 ctoan inskto and 0(4. TI eat includes 1.2. and 3ot . covered sauce pans. 5qt covered Oulch oven and 10 open ky p.</p>
        <p>2874-1040 $79.95 ...................Your  Coal 64i6  46.66</p>
        <p>(14) Mayor 1lltaklMRsLHardiodizodwokWlaicomoeoone^ stoamer rack and ledpe book wRhwck recipes.</p>
        <p>27580034 $39.95...................Your  Cool HOrOT- $4.67</p>
        <p>(ie Regal Durwon Htooo 6R0. tokdeoe tool Ceokwaie. Durab. iMkitose Heel Inner end outortoyerswkh carbon itosi inner cere, light-litling oovors, hsal-ieaidani hands and knobe Dishwaihar sale, oven-prool. Includes; 1-q., 2-qt. 3s)t covered saucepans. 6qt. covered Dutch oven. 10W" open try pan (uses Dutch oven cover.) Ao Includes a handy rsdpalinalruction booMei.</p>
        <p>2874063-7 $99.95 ...................Your  Coal 66M- 860.97</p>
        <p>(16) HaaNhOdlator Ctoileal eala. Beam SCS wth eye-stontod beam gives aocura weight. Features an easy to ctoan vinyl mar 350 pound capacity, ktoal tor dtotors. MIrs $10.00 raba.</p>
        <p>26380014 $184.96................Your  CoM  M616Y  8106.67</p>
        <p>(17) Ctoheraio ORe. Oootaaaro 0L Extra thick cast duminum tor oven hedtog. StoeralonaA intortor tor easy care. Dacoralvewhedpotlem on aknond poroddn axtorior. Brown aoosni day cod phanolc handtoe. 1 and</p>
        <p>2-qLoovoradaauoapans. iVkKp. stoamer, 10"opanllrypan.4Vk-qt. Dutch oven and 9" sauto pan.</p>
        <p>23&amp;lt;0-1 *154.95  .................Your Com 64ir- 876.66</p>
        <p>(16) Rorg Oval Qaawiolrlc oale. Zero set. 2704b capacity Vinyl piat-torm greyfwhi.</p>
        <p>250^5 $28.^..................Your Com MrYT- 816.67</p>
        <p>(16) CouiMOlor Ftoaoo F360 BaMioiite train Qougo Reolo. Large.</p>
        <p>1 LED readout, stop-on activalor. Almond. MIr's $5.00 raba</p>
        <p>25980650 $59.97 ...................Your CoM MrfT  834.67</p>
        <p>(MOouiMorOlgtolao.LaraeredLEDreadoU.Tr^ swIkRi. TroubtottoeatoctrortoaolidMatocircullry. (tontornporary. skpixool vinyl rnd. 3004b. CMMclty. Requiras one O-vdtdkdinebdtoiy (not includ-od). MIr's $3.00 raba</p>
        <p>2599BeO$2999  YeurCaM84i6r.16.M</p>
        <pb facs="00096780_0247" />
        <p>WicliM cilir. ia&amp;lt;pwdiD0dpwiMiMicnappiiiMw.</p>
        <p>CM Mdi wd MNMk. Fmum iMndna u ootMuoulMd PWCMH Id lour Oino Kt</p>
        <p>3840-I3MS1M.9S....................  .............................................</p>
        <p>dougiiMHr CampMiuMiotMi. awioMaMi&amp;lt;nbigM.iMw.Mpwiddautfi heok KHpMdMloaian Buftinlwb.</p>
        <p>3736fllia*2J8........................VwOo4m&amp;gt;tMJT</p>
        <p>(H llin 111 niirtrtn nrtfi Hitiiiw ii* tfiitii trtiff "nm t  OOroMO.</p>
        <p>tiMS............................. coii*o*tr* Sttjr</p>
        <p>WawHHOdldwldDw"lliiUiaiit.iiioipocn</p>
        <p>onyopwdMiiOtwW.TlM&amp;lt;&amp;gt;coielComlodflOpliiilo.Ni&amp;gt;iiiillirtnr</p>
        <p>omiSe S&amp;gt;MS..............................r ooMtM* tnsf</p>
        <p>w OoMr n tpiid "Olio ir oiiiiliii odor. TcomuMoa. Sendo wotdo WWi ooroouwr Id cooMieak.</p>
        <p>38M-I37-4 S30.SS...............................YowOOM Wl&amp;lt;t mM</p>
        <p>MfMod oMb^ eoep*NdNi**.Twi*eF**dewoeml</p>
        <p>lood proooiMro aid. dMp. go. lofKW. knoddi luOiet. PUMO Id HM</p>
        <p>30e-l03S.9S..... .........................VofCodIMil M.l</p>
        <p>m * O** * OwpFwlidiKw. TeW id  m en Id oE Chope up e </p>
        <p>cup IMO. OIMMP pode. CMOOO. iMri fflOOtt. pouy. Id im vtnly OMryimp. Hl^dnoiitiintiriiidn iiTr T f I  "-TQ-  "-tT-  T^</p>
        <p>uiMiiwwy wiOcli. dOd dmntiirip Wilii udl&amp;gt;coiWidiwiewi  di. Wr-e&amp;gt;700ifMo</p>
        <p>3700-1(2 K9.95...............................VPW Oool W- W J*</p>
        <p>[HiiiPdioiiiioiiitM mr~n Tin-f*11r</p>
        <p>10 Cloon up. w OH OPW. MTO S7 00 fMM.</p>
        <p>370fr074 SJOoTT............................vopr COH  MO</p>
        <p>lliWoli Oioli Mt Mo Oodwr. lUTo .00 hOH</p>
        <p>370007! 13708...............................Tof CHO OWf.MOJ</p>
        <p>(lOIOooHoi* drpdiPOy* oolhoDw8W&amp;gt;H.MiPo4QinouoootimpdiiM</p>
        <p>4 cupo ele Eiov  uo CI0|IdOH GiM l dUiiig IloMMl^</p>
        <p>30WOSM saos...............................VerOMl4MO- SIMO</p>
        <p>(IHa.ColloolOdDlCiiaoo1i.&amp;gt;woaiP4cupo4tcoOH.Moicoupen</p>
        <p>Mr.OoOHtofPS&amp;amp;flONMk</p>
        <p>38340304 SM.H...............................VeHCOHWO* 81TJ</p>
        <p>n9NiHiiPWOupOiaeMk.iOaaidl7.AunRiHclpmlookMMopo coin M dioul tunMQ. RomoHblo. lipHP honglng  PedH. MTi8800 Me</p>
        <p>30301674 Oa70rT......................  Vmr  CIOH OOOdT. WTJ</p>
        <p>(1 ToppM J kOMMOP OOOH Tfp-N Touch touch conMIe-Mmir oonioi l anpyi aSOoUpeiii.SmnuHi*ollm WpownowfcKludnoDohiiW H HoH</p>
        <p>4000I107 828806 ....................  YlnOod  WWiOO.WWJO</p>
        <p>04 OI COnpoH 4 CP. a Mohmup (hw. 36nMu M. a pouw MH</p>
        <p>36800024 Sia.M. ..... .......................Tour CoH OOOdt- MI</p>
        <p>&amp;lt;18|4iWi1JCU.aiB0don Oiow nWiiliOloOTiiHiiHiw arto. CWHOlOooh. lOpoudIOHH !ati04l*i04*g4l08oMflld40w TOOuHfe</p>
        <p>SSSSo^</p>
        <p>A  OIOUIH  a  door. qua hH0 mo^</p>
        <p>SlSoaSoaooo.................  Yonronoaiaoaoo</p>
        <p>(lTiTooilooiloaOop&amp;gt;HouoCloiOuoiiwar.OuimopotcoioiiiH&amp;lt;ioco</p>
        <p>o 4001  Imi eeono nipocHMO. NnHc dH eandort kr iMhi  brai. a lock</p>
        <p>peeioi* Mhiiie wipwe oeiowi. leroeuibio ewn de Id w</p>
        <p>40730114 oaft.. .TTTT .....................Tu em8ior soojo</p>
        <p>WHiiliiWiii TOMHfOuopllwar.OoHinuouoelooniliohoiihioHiiidiiioBo</p>
        <p>up k 4 OOP wro aw eoH pbo 0800 BONUft</p>
        <p>3080002-7 fMH...............................Veur OnaOiOa OOOltT</p>
        <p>nO) WHIof IM OM Mn. Mohn 1b gotan dh toe cubH Id o 0L M mgwHM tookw. MTt 0800 leten</p>
        <p>41384102 S30J8...............................tOH O0H8* 8I07</p>
        <p>dHIMid IH0ai CoiOpiiidlOdli aoipoeor.QpieHoaoo.ouioioi34&amp;gt;. oom cono. Hordonod u cuO 4n.</p>
        <p>30400084817a  ...................Ven CooMMd-OOJO</p>
        <p>(2l)Poeli* ItauoM* CiOpiiHWMe.Mouniouiidli4chicoWn4epono 11.. opone cono, hogp hetoop ie. CotnpioMii utar ''Pewpieo Mr-ta.</p>
        <p>3HO10M 824 a..............................Vour CMoaOtot $OM</p>
        <p>(22|l&amp;gt;i|0kw eipoliiwBiiiMiilMoeii lOiiine-uilhXiieniudiopionioHeio ho probo. Mk'oaaiehoM</p>
        <p>30800804 oooia.............................Vour O0M4M4* oaa</p>
        <p>02lnoie* JeahyNiS"fleiNgbdnncoMr.SpoeMnboaingooMr. iep iou4iPnioiunHnboHloieniiooino.Oul1oaiir8ii^ pMnkim nNiekoudoep4dMo OoMMo* hoHeoHwl.</p>
        <p>soooaosooaa...............................vourCeniad ow.a</p>
        <p>M Tpooboeea RomI Mb Mar. OdNO r Pooeton uap MridlutoeHt</p>
        <p>uuwpowtnocpiowiliHdyi^indceao Ulan lopo boar onduhonawnwini. a uoMpNorHOckoiidp  _</p>
        <p>407340048M.a...............................vouteeoioa* oaa</p>
        <p>CaotToeibueearoOOooaebyToooi.OouwoMotooniund eenuleheeuih</p>
        <p>moHuie nne eenel. dne eetoi eeugo I wee  eeien modo Id htogwi cnnnb</p>
        <p>m mh u4h odiuaeba d Mhp</p>
        <p>40^4774!a...............................vurOenooM oir</p>
        <p>qo&amp;gt;Wi Oiiio PioOOnoHidlie reeai. Ainoo la ueed doannnn pactoe coeiHg wnp Whenaar to oenp oenai wa a pomeinahf. We aa boa. 3440444 830...............................VourONlJIid- mUlt</p>
        <p> ......   nm  iiiiiiiii&amp;gt;iiitMoeMM.M</p>
        <p>r popping  no 04.44ui eopecOy Rnou4bie  onar. ooplueuah POpptoO diMP</p>
        <p>buiacup UodPSCPiW 3004a74 84oa.....</p>
        <pb facs="00096780_0248" />
        <p>I</p>
        <p>(1) VIM Smmm S#lm Cwflng Stt AMclwwni lor raguiv nt cwtt. on* lor tghiar cutt*. MIr't S9 00 riMt plu* S2 00 BONUS 307D10S109S  Your OoMMitr-111.07</p>
        <p>mVIMBiWOOBPwiliiilonilMlillllwOiYir. iSOO-mo* MIrtSSOO riboMpluilZOOBONUS</p>
        <p>397(M&amp;gt;1M 116 90  Your CM JMOiOt-10.90</p>
        <p>(DCMral* CunoMiCwOngBnali.Hiii*upinoniyeOMcondi.Squ**n hondo dnoM dip Ouolvokog*</p>
        <p>3604069-9 S12.95.....................Your  CM  OOdO-06.00</p>
        <p>(4)CMral* CunaM*Sly0ngaiu*li.60-i*cancth**M&amp;gt;.tqu**abl*h*n-</p>
        <p>do. duoi vokog*. roody iighi.</p>
        <p>3604C70-7 SllK................. Your  CM  lOiOO  00.00</p>
        <p>(0) Noiolao WoloUM Oord/OoMoo* Ronr. BuO-n choigor lor 1 hour quick char^ bckid** Irarol waloL</p>
        <p>3620-179-4 664.06 ....................Your CM OOHOT-604.00</p>
        <p>M BmM 6901 RMioifooM* Itaoor. indopindoni. hOv ooMndabl* long hovlrimnw Cord or eordoooRoeherg**" only 1 hour Bu**r*ehero*r. Auio nridind* vaRog* odjuiononi indudo* trovol coo*.</p>
        <p>36760010 650.05 ......... Your OMOOOlOT . 614.90</p>
        <p>35760024 674.96 6069  YourOM660i0r-640J0</p>
        <p>(7) Pooooonie lloalioroaoBI* WoUDiy Bhowor. Plugo dtodiy iroo wH 10 rochonio PopHip iriminor.</p>
        <p>3060&amp;lt;j0i-3 654.95  Your CM 640i0r  610.07</p>
        <p>(0) WON Heir OMor But ii-pi*e*w4h*l*eirrnogn*iicclippir.4oRech-monl combe. Mroor comb, oaonto. dppor 04 and Mruciion book liHr's 65.00 roboM</p>
        <p>4126C066 624.95 .......... Your Coot OOOrOf- 010.07</p>
        <p>12-</p>
        <p>mCMolKli</p>
        <p>r. 2 had loamra* and 24 vdvdy</p>
        <p>oon roMro d 4 1*0 kMr't 66 00 robd*</p>
        <p>3604C62-4 63995  Your  CMSOOiOr*  660J9</p>
        <p>(10) NooiM Bain OalUM IMm4JoM IMMIp Mmr. Four 6MI loutao cant bghl*. 34gM odaction. 2 warm Id 2 cod lamp*. BngMr</p>
        <p>pwd angl** nwror lor1 3820^1444 634 95</p>
        <p>mnor* Loftmghiprolilominata Honzonlal *64 00 rat</p>
        <p>I wow MIrli</p>
        <p>) rabal*.</p>
        <p>Your CMOOiOt. 616.00</p>
        <p>3832477 6 6139 95 King DM  Your CM UMdO  6100.97</p>
        <p>(17) Tolodyiio WaiotPOr Pamay Dontal tyotom. 4 cdor-eodod |d ups w4h proMuro oodrd on ih* hand* Ooud* imuiaiod lor ut* w4h moudMMh</p>
        <p>Of fliher iddilivet</p>
        <p>3532434-0 639 M  Your  CM  96MP-620.97</p>
        <p>(10)PoOanoCeolourBorirMoaaagar.6iiaycomlonconird MIrtSSOO</p>
        <p>I</p>
        <p>(11) Noioleo Salln 1SM4MI Kuwpaan Turbo Oiyor. Saparai*</p>
        <p>haoMpaad eomiab Dual vdiag* lor wondd* ui* Mb'* S3 00 raba 3820-1804 624 96  Your  CM &amp;lt;IMY-616.00</p>
        <p>(12) Conalr tiol BIW. 20coaiad. waihabi* wiar* Mi laai haamp No ekpa naadad  no langlat'</p>
        <p>3010440-2 63496 .................Your  CoalJBOrOr- 624.00</p>
        <p>K68471-9 660 95  Your  CM  96440    649.07</p>
        <p>no) Otaty OaluM PM Bpwar. Had and VbwNodta-Mb  65 00 rabaie 3630472-1 63996</p>
        <p>Your CM JOOiOt-627.07</p>
        <p>(20) HaaMhcbaok Digital Than</p>
        <p>a.WorkanOOtacondtorlaa* No</p>
        <p>119) Wbidaar* MM Crbaper. Craaia* grad lodong Mdur* and vdum*</p>
        <p>^ an il OMT enmpad look or cnmpng dhm a dyi* Compact on lor aaty</p>
        <p>handdg</p>
        <p>4138-^-</p>
        <p>Sioo</p>
        <p>!-9 612 96 True I</p>
        <p>Mb* 65 00 robd* 1104234 61905</p>
        <p>YourCM|M&amp;gt;60.M no* UfMad Mabomp MMor. Compad.</p>
        <p>glMormaicuryhaardaimpadraaidani Baaptdtndlamparaiur* Ovid</p>
        <p>03 7 6896  Your  CMJOiOP-64.90</p>
        <p>(21) HaaNhehaeli Pulaonie" gHal Btood Pieaoura 6 Pule* MonHor. Sniplyinll*Mcrophon*lMPulloncComlonCunioprapl*vd ObUm ratuet d tacondt Larga (kgud dopiay dioiM blood prataur* and pude</p>
        <p>3686405-2 649 95</p>
        <p>Your CM J</p>
        <p>627.90</p>
        <p>Your CM964i0r- 01990 Biylar. 2-dMadtM-haaia Daiignad hx hr dyM* Mb'* 6500 rabri* pbt 66.00 BONUS 3610401-4 610.96   Your  CM  9&amp;gt;4iOr. 619.90</p>
        <p>(10) BioMaM PJl. BMnbat Singl* conbd Bkw. ^48360605TMn  Your  CM  6MP-644.07</p>
        <p>38324714 678 05 Btaola  Your  CM  JBOlOt  66497</p>
        <p>38324744 684 95 PulOuol  Your  CM  JOOitP-60497</p>
        <p>38324754 999 95 Ohiaan DM  Your  CM  SMiOf-074.07</p>
        <p>(22))MMnBbwdPia**iMiaiiMli9MlM</p>
        <p>.Eaty-ifrr**ddi.i*cord</p>
        <p>log and bpparad carryng caia intbuctiont mcludad'</p>
        <p>14-0014 61996  Your  CM  949iOP-611.07</p>
        <p>m Horn* 600^100. Turn* tub Mo wTwlpool MIr't 67 00 rabd* 247^4 6^96  Your  CM  66090    670.07</p>
        <p>Dabiao Hom* ipaNOOO. Mb'* 67 00 rabd*</p>
        <p>24740674 611096  Your  CM  OOOlOf-686.99</p>
        <p>Homo Bao" Aooaaaoty Kit. Mb a 65 00 r 24704^ 61995</p>
        <p>Your CM 616.99</p>
        <pb facs="00096780_0249" />
        <p>I</p>
        <p>a</p>
        <p>r UghlwefiM  Sewing  MwNiw.  Sews</p>
        <p>in iSciiM. itralght liKhM and ag-iags: bM. M.</p>
        <p>0)llMiilntMii"hBi4tawr-OuicMyramomunai^</p>
        <p>and iuzz Irom your gamionta. Indudas high apaad oadaa and aaty</p>
        <p>10 daan ttorago comparlment Cordess.'battary^oparatod 390M67-6 $12.95</p>
        <p>Your</p>
        <p>99itr-9l.9l</p>
        <p>m Maek  Daeliar Auto wMMr MaamOiy Iron. Shuts off in IfrnanuMti</p>
        <p>ol norwnotion.</p>
        <p>3064-288^ $39.95 .............Youf  Ooot 889.'9-$19.97</p>
        <p>(4) tiinboom Moidlor SaMy Iran. LigMwaigM. sloariYdry with auto tHUtcK. Extra large waMr tai% designed lor tap wat^</p>
        <p>4036-253-5 $29.K ...............Your  OoaHWrO-$19.99</p>
        <p>(9) Hoover tpMT NoovHHily forttMo CaoMar Vaeuiiin. 31</p>
        <p>peak HP motor Baoc luglloor nozde. lopeide tool storage. buM^n car-</p>
        <p>($) Moevor CawvartMa* Upright Claanar atWi AWactwiama. A mu hando with ghp. 20' cordwith wrap. 9-quart dsposatHe trap. 5-piece aRachnwrf sat. 4-poailion rug adjustment, 4 a amp motor and244$.10$-1 amSo..............Your Coal $94|9P. $79.97</p>
        <p>m Hoover Mpaod raoin. Easy^ dMt cup  no trago ra txiy 2 speed 3 5 amp motor, standard rugilloor nozzia and cord release</p>
        <p>2rM?!8'Sj^............. .Your Coal $$8i9r. $34.97</p>
        <p>($) Nagtaa Heueelraeper 3$$0 UpXgM Voe. Hoavy-Outy ultra</p>
        <p>power motor xnth edgelccmar cleaning, suction control Mtr's $7 00 rebate</p>
        <p>2478-078-5 $109 99  ...........Your  Coal $$9i9r- $79.97</p>
        <p>Nogina Houaobaopor AMadMionto. Mtr s $500 rebate 247M79-3CV99  Your  Ceal8ia99^ $14.99</p>
        <p>(9) Pelanox Intoigoney Hadlo. AMd^ with TV sound and weather bond Includes high intensity lanrarn that adjusts to 3-positions and a loud, piercing snen.</p>
        <p>3568-073-5 S39 95  Your  Coal4$$!98'-$29.94</p>
        <p>(19) FM Mart* CampoelNaelMraaaManaaMgM. Rugged case, shattsrproolIans, krypton bulb. MfrVtt.OO reboto.</p>
        <p>3846&amp;lt;eOO $16.95 .............Your  Oool4s9r-$8.99</p>
        <p>PhalAlarl* lllglt Pevrarad Naeltargoobla PlaaMgM. Mtr s $2 00</p>
        <p>3MM21-8 $19.95..............Your  CoalMiOP. $13.99</p>
        <p>(11)nratAlaft* Double 9alaiw* Smoba Ootaelor. 2 detection systems and a photoslectronic sansor m one urxi Duel chamber oniza-Mm. plus 2 teat buttons and battery check system</p>
        <p>3846^ $27.95 ...............Your  Coal $88i99  $19.90</p>
        <p>(12) Mack A Oacbar Ouaibualar* Pbia. Extra power Cordtoss. ready to use wherever needed Ful storagateharger base. Handy attachments and sustained suction. Model 9334</p>
        <p>3664-257-7 $39.95 .......................Your Coot $29.99</p>
        <p>(1 Nemlwglow* Vlo*Vae* . Rechargeable hand held carpel ctoanar EllKlivety removes spils and stains qucMy. spacwl tasi acting deodorizing cleaner duaolves stains, and a son ganie brush helps cleaner penetrate deep into carpet</p>
        <p>3906081-9 $5998 ..........Your  M944rar&amp;lt; $39.97</p>
        <p>(14) WoMR 7-Pbi 09 Haolar. Auto thermostat and 60190011 SOOwan heal satockon. Baked enamel kmsh</p>
        <p>4144008-2 $59.95 ...............Your  Cool4$9i9*- $34.97</p>
        <p>(19) WOMI (Mraoonlc HumHMIar. Cool air mist with mot miensxv control and Humk|.A.Slal control. 14 ^lon capacity Mtr's $5 00 rebate</p>
        <p>4144011-6 $59.95 .............Your  Cool 999;9r 934.97</p>
        <p>(1$)Praalo* Quam Portable Heatar. Heats objects rather than ax Area comlort can be achieved quicMy Control swSch has xiknito heat sellings. Cycles on and on automahcally . but quartz tube stays hoi -</p>
        <p>...........</p>
        <p>(17)turabaDahnaHaovjhOuly PoanrToam Vaeuuan. 32HP nionr plus Power Nozzle, rrwiorizedauiooctjust carpal nozzle. Edge</p>
        <p>(19) turaba UgrtgM Vaeuum. MuM position Oial-A Nap iraigM a</p>
        <p>lualrneni. 12 IWMar bar bnrsh rol. top-M bag</p>
        <p>24280700 $79.95  Your  Cual 999i9r- $99.97</p>
        <p>(19) Eureka Ultra UprtgM Vaeuum. Tnple Fbsr Systam. brushed EdgelCorrwrKtoanar.aulohaghiadjustmanlhaacbghi Tootsmciuo</p>
        <p>ed. 6.5 amp motor.  _</p>
        <p>24280604 921995  Your  Coal  88$.$r.  $149.97</p>
        <p>(20) Otnaefbknon Upright Vacuum with Attachwants. Poweriui gMweimByaMmwimealtachinenis Folds lor compact storage 24480130 ii 19 95 ....... Your  Cual 9$4.fT. $99.99</p>
        <p>I'a  13</p>
        <pb facs="00096780_0250" />
        <p>5 ffmiowM</p>
        <p>Rg,v ffiniipt</p>
        <p>113 timimm</p>
        <p>IMMML MWTNMmVHta*iwsBlWffl</p>
        <p>a)Mt|MiiQllM&amp;gt;tyiliw.MlirMiiat|Miiciiiir.aiilcWI&amp;lt;l&amp;gt;l&amp;gt;iB&amp;gt;i WMd dub and oenMuout pMy; 3ind MiMT. U m tMiwlDRWic knv MHk dM Sbar LEO pox* myK 2 IpHMrt ui r oolwa and kMM) poMK 3B" Mgh aMMKM tack. Modd MXaOOD.</p>
        <p>6MMS7.1 S3O0M.....................VWr OMJMMT . 21MJ7</p>
        <p>qaibimwiWw&amp;gt;byaiaw *MirMyMMiaiiLSiiaii||iik.iia1w. dual CMMtabNgb kpaaddub and ooiainuouB piar Mnauttnaieiunbla; irM|tMakai*Mmand(MknbhadiaekuiliUi0Madoo&amp;gt;andaairi caan.MaiMS&amp;lt;aoo.</p>
        <p>M-m-eiMMs......................fawCMnmup mtM</p>
        <p>Jaiimrnbar&amp;gt;Pi*iiir*&amp;gt;-iO-xoelpaandta8fbpiahpa</p>
        <p>hiiiniiij MA&amp;lt; 3)00^</p>
        <p>aBI240Mf2U................VMrOMIia4M.ttaiMNb.</p>
        <p>12-aoM S29BJ0 tr.................Vow omtmm  tinjr</p>
        <p>nTaMHWaftMlbHMda.QuanoanaaMdNeiM;Wyauianaie</p>
        <p>MML IteM SLflDSMt</p>
        <p>I   VaarCaMM4Mr.tm.t7</p>
        <p>WMiiHii P  .....  oWi  UatiMwl  iMIpltf. 0nX9.</p>
        <p>^3-1 nun........................ToarCOMttMt.mtT</p>
        <p>m Taw CMtaat Oath. Dotty* BnaittiaOcijonLMtiiiitpactpabia.LEO tacetdWtnbackitMilndbaBr. 0KB* itpaooMttr.MDdd vano.</p>
        <p>flB23WM&amp;gt;mti........................VtarCaMtlMr Mi,w</p>
        <p>m Mtt m Of tatii oiiiiota. oeimx.</p>
        <p>atMSi4 SlUt..........................vtor  TitlWitr  tut</p>
        <p>mWatltrRMaNblMMtOllHtl*tr.4dbeMitkVtpoMdeuiianiau)ui MMt 3 LED m QM Mnihi indMott. COMdbottwno Id apt PMt inpMOonntamtotp*MMlmpMMMeia*yaBlMporaN4oadt Mbat FM muing. Mod* m2300.</p>
        <p>WMBHSISMS.......................VaarCBMMr-ttM7</p>
        <p>(7) OyatmMd OMtpaM Mn Ctta. HoUi 40 COr 4 fed daago</p>
        <p>cawpaantnia.</p>
        <p>ttlOdOM 129.96.....</p>
        <p>l1htimotpatlBMWwiid190iaia itt pick MpLOdehpwptnitdMM. Auto ipMictpaW.*ialienMnidiit ltaddg.Oiaplty**tek,lndKlMinali&amp;lt;noln*andmimoiyehannd.Fdd hraaktiaMndlllodilMMOi</p>
        <p>WWM........ .....................VaarOa9t4tJ7</p>
        <p>MMeNiMllOtRMetMpa**B&amp;lt;ltPlMr.EykNicfon4n9wlaeait aietM M ti pMndhtd Ntneit conntnd . Evan 9 buton tw opant anddfltattddbBM HlWcli piatrwiwm&amp;gt; xlhtitptMiiiBdit.</p>
        <p>*I'Tr'-iiir-yiHr filmaldmnMiirhui Itftndjt dwi m.iut). I</p>
        <p>icadtMpteettdnaanddiecititdMntwwpoitMeddCtnaaH.</p>
        <p>B&amp;gt;M04t31tJ6.....................VoarCMatMr.t19M7</p>
        <p>mmmam  ......  nmm</p>
        <p>CO plow X ICO dtpliir. 4 dutdwtlt wtdwt. Sbtnd mSc aqudhw.</p>
        <p> pudMiilen ratttti fapuil Modd 3-7090.</p>
        <p>.....................VdorOaalJMM-tltMO</p>
        <p>pi) hUaaiaCtrlitiii Otiliati- *W twi tMlFM dtun rttttw idiuio paaa el 301 tpaddft pkN bolMn Sband aqudtar. Modd 1F-7I&amp;amp;</p>
        <p>77444M 912936..................</p>
        <p>(Mml |9iiiiiiaih..dwlln nack. pnmcM pichouaid. ltfott tftdL</p>
        <p>*........................vtat ernmmr- nur</p>
        <p>P90MaaMt9lttMHMtBtitaaa.CofflpdttaiMhpoiitUtCOpiayait.il&amp;gt;-cfcidHionae&amp;gt;yaigeaN:iaHh23KHitaiyiiga.90MWnNafflufflin. pit PMW. 16 Ohfflt ifflptdtnea Modd EMf23im Ttnk.</p>
        <p>a074M 93996........  VaarCaalMMr.  91797</p>
        <p>WT4j967W969Mh...................VM Oatl MOr  917J7  .........</p>
        <p>91196..............  rrnommm-vjn</p>
        <p>P9 tataMI MtniMM Ottttr. M tmd aa&amp;gt; aofd 0* Mm. 2 Mfflhoui Mdk tor. Puiaul tunatUt dNB. One dMr. 39tMy 12m TV opwwg. Magnate cdch on pHt door. 62116 X lOH.</p>
        <p>SMmiM97.....................Vaor Com IBtadV. 919697</p>
        <p>P9|M oawWiM iBMahHaM MUr. Ubwy Odi fddi ki a taUy dMaddMentahM MnidtdMlado.9at|whMtdididkMB4ncleMd donga and a padMH baM didgn. 4696 X 4796 X169-oimM dM 9ama</p>
        <p>miMtN nqubidr</p>
        <p>2*5*wa96.....................VBdrOaamaaMt. 914699</p>
        <p>1?^ eaMnale Hbd KaybaaM ah a Owni Ptda PonaUt 6now</p>
        <p>oelyphenie ddab ktybeed Ml 46 fflW ktyi. 9 hMHn dnan padi he "twn a^andndifflaffltmoiy. i2pnMtoundk i3tfgldiyaauioaooom. pentnentawledwdMxdNn dine ipwhdiilneaui lor hoffleaweeweid myonaladt UneOM dfflfflpadiandaM 9eund9Ma Madd MT-e.</p>
        <p>6666061-9999690.....................VaarOtM6969lOr. 919697</p>
        <p>OtUa aaad aBda" iv mt-920. MT-206</p>
        <p>.......................M0taiaaBr.6i9ia7</p>
        <p>P9)Bt^lB6 aut BUMitalt Ki|heaid. 46 ntddwktya. 21FM Mu-ffltit *10*12 pntdtiiMffladWWtvidietMr.pievMiiiMiBMiiwi* to</p>
        <p>6664411-2 tt1696.....................Mat CM9I8M7* 614697</p>
        <p>99641369lia6MMMlar................... 1ZmI6197</p>
        <pb facs="00096780_0251" />
        <p>fe0 STEWART</p>
        <p>m Pmaonie MMFM Mmw nsM Clock fMIo. BiA-in bocsttf an^ to peonO arco. Ambiance sound. Dual atom. Sura atomtowaka bocCiawtoa Qiaan LEOdKjW dWto-aaRinitojnalaWaooonnacttocofd.MoeW^&amp;gt;2^</p>
        <p>6874-K7-3 $59.95 .................Voor Ooal UHlt- WMT</p>
        <p>(2) SlawMt Mim IB) IM Cioek Radto (tonpaci na^'iM (splay, wake to music or atom, anooie button. Modal smsA.</p>
        <p>690M71-3 $19.95......  Your  Coal  9t.9</p>
        <p>(S) torvlea Super HI&amp;gt;Toeh Audio CaaaaMa Caaa. Padded, vinyl double-aided case holda 90 boxed to iao.unbO!adcMa^</p>
        <p>9930-053-1 $19.95..................Your Cool Wl.T- $9.97</p>
        <p>MnulaAudtoCaaaetiawWiTo jctkm plua itongo tote. iSA90li</p>
        <p>VaurOai..,.....</p>
        <p>apa^acMno. PrSitFM to*g.0na4i&amp;gt;uchcwrt^  sSl^</p>
        <p>tt0CL JRX*Fw18</p>
        <p>99744544 $99.95 .................Your Coat$?9iSr MMS</p>
        <p>(91 or railiumantia rnitalita  mrrr -f-rrr -</p>
        <p>4-apatoar ayawn, buK-in mife FM atoao LEO i(i(ealoupiary controla.</p>
        <p>Ful 1-yaar VwTOtto Modal 3-5452.  _</p>
        <p>9900^9 $59.95 .................Your CoalHI.Sr- $37J4</p>
        <p>i SU $#aali Fanie OaMa Audto CaaaaWaa. 0^5____</p>
        <p>98144924 $9.99....................Your  Oaol S94r-$9.99</p>
        <p>m TtoWMfAMini Slaioo Ra* aMi HaadpSoaaa 3;tond</p>
        <p>(9) OS AMffM Maadpheiia Radto. Cordaaa atoao butt mio head-</p>
        <p>(9) OS uumim Hsno Casaane Playar. Slareo txnMyM plwnea wilh butt-in windar/atoage oompartmam Aulo tape ahiloir in</p>
        <p>pito mode. Modal 3-5802WH.  ___</p>
        <p>8800477-1 $39.95 .................Your Coal499:9-9WJ9</p>
        <p>(19&amp;gt;la9naiea$laian raaaoRa.Stoaocaaaatiaplaybaclc Auiottpp. AiSralmaettoton. UghtwaigM headpltom M cip. L^ vtod. Indudaa proiaeoided caaaanas. eitta aat ol headphone pada. and</p>
        <p>indudaabatwiaa. Modal 08808.  _ _________</p>
        <p>9840425-1 $29.95 ................ Your Coal99i9r 91947</p>
        <p>(11) tony Sporto WaSoaan* .  tuner in water raaistaM</p>
        <p>atoc^'a headband. Thiivonly approdmatsly m" thick. Waiar-raaiatant. 2 butt-in radwgaable Nr-Cacfbaltariaa Supplod pockataue 0(&amp;gt;0Cchaftto. Miniatura IrHhaoarhaadphonaa. Suppled headband and armband prvidas aHsmative to haadband. Modal SfV-f 1.</p>
        <p>88844104 $84.85 .................YeurCool49944* 999-W</p>
        <p>(10aanPiMTaijLoM9orlablaCeiapart9laaaoai9liTuii99la XWW Stow CuaaaRa fleito. ACTC. Stoao phonograph w*M edt^ Playa standard caaaattaa. Butt-in twin atoao apaakars. Model</p>
        <p>^oWe $79.95 Burpundy ........Your Coal49Wr-jto.97</p>
        <p>88304024 $79.95 Bluo.............Your OMBB^* 949.97</p>
        <p>8830-9034 $79.95 Ivwy............YowCoal499(99 *8W47</p>
        <p>(l Panaaenie Mto aaaeaatta Rarnidar. Auto ravarwreoortyg. Vbica KkWl. Sound leval equalizer. 2apead operation. Pausa. AiA atop. MocM RN*89</p>
        <p>8874458-5 $109.95 ................Your Coal 499i99 *  979.M</p>
        <p>BtonaaB $4aalt 99 Wnula CaaaaHaa. MC80U03PK.</p>
        <p>8882-0204 $947...........................Your  Cost  97.97</p>
        <p>(l^NnaaoiiMACMeiy9attalilaCaaeat1aRatiitwlar.3-gaitiape counior. Autottop. Cuakaviow. Butt-in condensar mic. Onatorch racor-</p>
        <p>dirM. Edtt tunctkm. Lockable pause. Modal HQ4104^_____</p>
        <p>8874-1624 $23.95 .................Your CoMBBIiBr'  919J7</p>
        <p>(19)QB9poaoaaalior* Color TV ail9iAIIl Radto. Itojrto un^ cabinat to sava space and (aaturaa 5W color TV acraan. AM/FM radio</p>
        <p>and 3-way power options. Modal 7-7850.  _</p>
        <p>8800^5W^............Your  Oaal  9999.99    9919.90</p>
        <p>(17) 09 MMIisn Osatpantoir TV 9 PtoAM Radto. 5'black and ^ Rscaivss VHF charmsls 2-13. UHF1443. Saparato aMe-nto M to radk) and TV. 4-way power capablity . Sunscrasn. AC cord mdudad. MrxM 7-7150</p>
        <p>68004124 $159.to........................Your  Coal  999.97</p>
        <p>(19) Caato Poeha* Cotor LCD TV400. LigtowttM and luly pocket compatibla. High Ouatty Matrix syaton. OnatoJCh auto turwig. 3-way</p>
        <p>678l5-?i99.95 ...............Your Coal 4I9J7  99^</p>
        <p>(l9)CatoaTr^aliaeto(* 99iriRadarOotoetor^Hiah;^^</p>
        <p>no-Maa" ckrarjtry. visor or dash mount.. Mocjal WwyO</p>
        <p>8744425-5 $189.95 ...............Your CoalBMO.Of  999J7</p>
        <p>(99)OBUIIkaatoltolpf CR. Ful partomanca, ^Wianrto aj^^ cyAnkMmaiion, 2-way CB radio m ultra compat alza. MoM 859^ 6800-548-1 $74.95 .................Your Coal 99r9r* 949.97</p>
        <p>(a-19</p>
        <pb facs="00096780_0252" />
        <p>It I.n)PMiMOiilePV-1MOiMlllotoVmCNaanpMVHS7klmlght Htah iptid *HIW 6:1 po* worn lin. Art0ninuil too*. M MO W boinco. Ployti(pil SnSLP lipo ipt^</p>
        <p>684BM 61500.00...................     .^YOMrCo&amp;lt;  MI6J0</p>
        <p>NmmM Noow^ lltOlMMnI MMy lor OOotOor.Mfrowinur. ;;t;...............yocoothojt</p>
        <p> * VW Oi*e*r. VHS HO portoimenc* W ei pow exm low</p>
        <p>ouiolocuo.outtiili.iwoetolocuo.WohopooO**"'</p>
        <p>MooiiwiyonOiioieOiiiinu&amp;gt;ooplMocJcopoM^</p>
        <p>odipior. #wuidir loop tnd  in^ kiion lomo eo*ol Modil</p>
        <p>0-0006.</p>
        <p>6797S I1T9866........  Your  Oo  616NJ7miinlotlMVMhv* Cwnoiiwt ahodtptolKirtnyloni*tiocg^ cortil boo hoMi "Wi eoiiwrt 0U6 Of ploor ooiy unli M li* 0 *octi</p>
        <p>W IlMOloP 6A1J. iWrtM. *it ptnon rthioQ 10 ^ MTS Slo</p>
        <p>Ml  room Mono 0 M rtiwit FOMm buMi 1^l RMS p chinrt</p>
        <p>ttmaiiillvirthMpMtvalumi. brim. boandM)tocoioli MTS</p>
        <p>iiiMadbfi-irtrtfidueiionrtriwoiyniriikindoni&amp;lt;rimiUamrii^ onMMNMddKOdw. Srtondriy AurioPraormnino. HtMtpbow rick tor pmeo Iriwii Aiodfciy inpri to \cn tipe PW b^2^</p>
        <p>68761034 6108196 ...................Yow OMtlllOitP-6166J7WUrtiwlCrtili/IYTiwwrtOi Wbiliii WmiiIi Pirtwil. TMiiniiri Mptm- AddiMiHnmaiiooittaiolclmriiriieon.lnt tuning ond</p>
        <p>pm onW  V TV. Ew to cObli ebiiinrii. Modri V707^</p>
        <p>6836060-1 616968.....................YWri OK 6^ 6W</p>
        <p>m NM or XU186 Oriw nv. ifrpotrion. ringlo knob riKMrie tuning oyn AUk&amp;gt; Ini tuning, auto piciuro conM. aupri Aocu FMr 100* COTY pictoo tuba UnikK XtoKtol Uto ctiMrii to oMtotong ptitominei. toig trt KiKriicy. Id low ptHMi oonnmpttoi. r riNriw. Modri 646P.</p>
        <p>667M084 6049.96 ...................YorirCK8889lK.66l9J4</p>
        <p>RCri IT'n.-189 Color IV Ml KmMO OtMML Modri 689PR.</p>
        <p>687e6e0-1 r4996...................YoiCK849M99-847M9</p>
        <p>ntminr-""" ~  '</p>
        <p>nripRnrinMiniKiyriritoi. \Wnl0udtoinpulaulpUric6k RnoNninorii</p>
        <p>riiip tkiNi torttov 6(M)utton (tract ciionnri ooooM wnoii control 4oy iririM wrir- Pragnmnribtodiannrina i-buttonautoootocontri.Modri MS880R</p>
        <p>67480464 679966 ...................Yoor OK 64l9l66.689996</p>
        <p>(9&amp;gt;01 ir mioK Cooritl rolw TV. Ouriniudoiwiirio contri. Orwcfion</p>
        <p>chmnridriplay. i47toionnricoblocopobiityOliMi. Arioprtgronwn-</p>
        <p>uig. High oonitK picMo trbo Modri 8.19K  .  _______</p>
        <p>07990797 6460.95 ...................Yoor  CKIOOOlOt* 669966</p>
        <p>(6loioiion 16" BriKCKiK WK riwonriOwOriO^TV. i9koy lrtra^(^ rnoM eoTK witn i2Kitoi (iMa chonK ootm OjckKii ^ txe Kton. AK no tonina Eto#one chomiK</p>
        <p>074904006348.06 ...................Yoof  OK 6966M6  616664</p>
        <p>n9lliK NawOoMontlono" TV/VOI Oort. UbfOiyOriilMth. wood iMir puli, duri UK corion. Hridi eO"monlto rocriuw Of ir TV on lop riirit</p>
        <p>.....................YCK666.6..6666.</p>
        <p>on 01VH9 HQ ToMo Moriri VOL 3 vidiO iNOd. SpMiri ritoM In SPCP rnodii: itoiabli ilow rnottoi. ton* odMica M ipoid pttoback (EP only) Cono)K dMign. Ftoiuincy oyndioriiod tin. 199chonnri. Onocrton pf</p>
        <p>grinwning. 41 toicbon iriiii romoli corriol. 9ooni/3i-diy rin. 1-ttMCb</p>
        <p>SS5&amp;amp;^rr".'^.'^:.rY:7iL66K6r.6.6^</p>
        <p>9Ni0dVCRMl176toN60i</p>
        <p>oOh</p>
        <p>(16),  i,i  ---------------------</p>
        <p>OiQlriquatin.4wdiotiiadi.nighMiidomniiiairii. i-touch ipoort</p>
        <p>and 7-doyflpfogirin iim. Modri PV4700.  _______</p>
        <p>66490891 642900...................YoorCK 66M66&amp;gt;-6^66</p>
        <p>(13) nCA 9Mm6 VH6 VCri Mh IriKotf NkOI OoMK. Up to</p>
        <p>i-yavMm* pragiamnwf. Bfoadcaawablo fraquaneyoynOMi* tmw  AutoPiogisnniina Htoi riKd aaarcWriop. Port pow-on han oaaaana ii inaritolAKrtiilngWiuK H&amp;lt;|uiityVH8pictoaiyiWn.84wurficof-Yarif OK 664667</p>
        <p>ring cHiabMy. Modri VP1690. 6679670664</p>
        <p>iiDmrv6 6479.96............................-(14)QoMnKMghQa9lyVHL lOOchannricabifrraady lOnoaaonpoiaiv Itonato hiring. Pril 40 toKhon. i4dayf4-ivaMproafanniablaiim.Evary-dayriiMfracortlng. i34unction. lOtoy ramoia control. EatykMC^MCOfrina Modal QHV-1210M</p>
        <p>66191066 649668.............................Your OK 616M(in M OtyaMlo Paafc. 3 Eriia Hh Giada VHS vidao Hpaa M8i Mcal</p>
        <p>&amp;lt;aiynipte8toa6aCaaa.lnctidaa 62.40 labK to 9pack._____</p>
        <p>68146336 644.96 ......................Your  CK 66667 . 61^</p>
        <p>(16 Maaa6 36oak VH6 Oaaaalla Tapaa. Mriudaa 2 aiandart and 1 righ....^^^..YaurCKOwe-oim</p>
        <pb facs="00096780_0253" />
        <p>n)UnldwiXe40eCerthwFheiw. PulMftjnadWmg. pnv^oodr WpScaeble nww aiK) btfttry p*. uto fM.</p>
        <p>ttiMTOmi loudneM. Operes on 1 ol 10 naw 4W</p>
        <p>6768-128-8 S89.9S.................Yeur CoH 88&amp;lt;i8r- 868</p>
        <p>iwichto wi *h funcin In hKli. Iac7  1^^ ylandlh*oplionlor&amp;lt;JiifcNwlmouAMod^</p>
        <p>8800-6-7 184.95 .................YW Cotl t.fT-188.87</p>
        <p>(inTwdlIloniIftilWWMowPMfc WWW. Tono dMngoc^^</p>
        <p>tinoetvoluttwoortol.1uynwdular&amp;gt;OfOO^.coKlwphi^^</p>
        <p>6806^ 854.85 fl808M........ . .itm    m^T</p>
        <p>W UnHowic CoMWloiir 'Tclwiaiio Doo&amp;gt;/W8 H^. _</p>
        <p>en2-022-4 829.95 TMony Roo*......Vowr Oo48itr- 818.87</p>
        <p>8^&amp;amp;^.Tl!lSttlwiow  Yeur MWf. 818.87</p>
        <p>68324XM) 829.95 TlMOnr Mw  Vowr gwlWWY- 818.87</p>
        <p>6832021-6 $29.95 MWMWd..........YowrC^iJ8i8  818.87</p>
        <p>s&amp;amp;s r*.  'ss  . .</p>
        <p>coniralt. MocW 2-9400.  .   _</p>
        <p>6000459 889.95 .................Vowr OmM 888187' 888.97</p>
        <p>ramio MMMriM oyMm pto l6-nunir</p>
        <p>(ooMiloooNowioloDwolNaraeooooHoAnoomor.BooportoH wmM. tnoongo loMM Tol Sovor and vox^MfMIo longlh moiiooo.</p>
        <p>MoSSSsiaj*!*!*'.^  Your Coa888i87 - 878.87</p>
        <p>m ICC. Booilhiw It Moulh and ayos ore MKhio^</p>
        <p>Sw buIHn Mowrphono. Tono^uHo oworfiotil. lu obo teypod. oloc-SSmSm 8^95'";....... Yowr</p>
        <p>!3sr*s?srKr.a:^^</p>
        <p>048004082996 ................Voor Cool948Jf  818.87</p>
        <p>!tSfSP  vre-.*..)</p>
        <p>(18) OUdolo aarnm 20 Color Pilnlor. 80 cpo ttIUAO cps N.L.O.. W buBor.thofmal transfer. 100 oolof hado. *62300401.</p>
        <p>6842-0993 $169.95 ..............Your  Coal418897-  8118.87</p>
        <p>OkMolanim'NMnITaeko.    .</p>
        <p>6842-1056199.00 Clonoa.............!**?!2'K</p>
        <p>6842999-1 889.00 C94....................Vour Coot 888.97</p>
        <p>^I^MMMHwnDolllaMKlM</p>
        <p>Tvoe controltaf two typoUylo; 180 CPS in *alnnod; 30 CPS m Naar</p>
        <p>Letter QuaMy modo; bkioctional prinOng. CenfOrt2T"P2l,</p>
        <p>68289084 $399.95 4U908 Your CeitWy- 8188.87</p>
        <p>(1M Hareourt*aoo JevanovMi Computer SAT.  usar f^</p>
        <p>exwn; a proven method tor scoring high. Scores and times aulomallcaliy.PorlBM* PC* *1 "P?*</p>
        <p>68081053 839.95 .................Yow  Coot 884i8- 888.87</p>
        <p>(18) Seoleli 8X0 6H" Oishetlea. Double side, double density I0f12-paek. *58356.  </p>
        <p>6614942-5 822.79 ..................Your  Coal 9897 87.87</p>
        <p>(18) Mon 18" ROO Color Moimor. Display 80 characters sKlme vntoro5utionoie0K 240.16.7 KHz horiionlal Iraquenci, 60Hz ver-tirM iroquenciss. 13VI x 11.9 x 14.8. Model AP1020A.</p>
        <p>^50089^995 ............ Your  Cool 888897;^ W8.87</p>
        <p>(17) Rpoon Apoi S18K Dual Oihw ReraenMComputor. 1^</p>
        <p>hmsra IBM compslibto cornpum system wito CPU. Iraybosrd. OJA</p>
        <p>support MS-OOS^QW-B^C and buK-in dual dUk drive. Works 5Y4 arto 3W" disks, compsible with IBM PC software. Complole vrit PFS:</p>
        <p>^089 8tSSS *^. _. Your Coal4888187-8848.87</p>
        <p>memory; buiiNn 75.000 word wilhSpdMSwctobklractionali built-in parallel computer interface</p>
        <p>y 34 character LCD dwplay; tCartridgosavailablo:</p>
        <p>aumrm \jwmm  v*wws  ~</p>
        <p>Business Forms I. II; Resume Wrier; Term Paper Generator; 32K Expansion Modal 350-f.</p>
        <p>6828907-2 8599.99   Your  0001484897  -  8288.87</p>
        <p>OCMEO-W'-C SIW.W  ......  mwmw  -------</p>
        <p>(18)ThSoBoMoolarSyalsm-. 128K. beyondslatotot-thq-art system console. 2 high spaed, super-rasponaive conlralars. Saga Ughl Phaser*, ""i HsngOnfSalarl Hunrgarne cartridge. AC adapter. Autiofvtoeo RF swuch and cable. Adapts to erjv TV ML J019 $180.00 ...............Your  Ceal488i87  -  888.87</p>
        <p>1048K cable. 6997-0019</p>
        <p>JMN* mmamramTiuimumof_</p>
        <p>corpormtton</p>
        <pb facs="00096780_0254" />
        <p>bi*&amp;lt;naiMiaOiwid*lin|fa&amp;lt;tSOuNrfwgn</p>
        <p>tUntf'.-Ww*</p>
        <p>Our rikwOur' eontclen. lOni pNOi. iMqr M. flWC-M.</p>
        <p>isiMMMtaaMt .................vwrcm4WnsiiM7</p>
        <p>(|)Cl*TlwwITy&amp;gt;w1Wt.FtiuwipildiclwKBaii(wpW</p>
        <p>CW*l6kaaiMa4Si4M6 .................rtrncmmnmr-mtsr</p>
        <p>M*elwy.WMun.Uiweaii*n.WMiMt.dwlplieii.ifloeM on and ol IHK taH qpt. Mb cMv. Modil aiO&amp;amp;MH-iaMmtoo.......................Tow Cool wwr tiiMT</p>
        <p>MMM&amp;gt;MiMNtHlit'MMi.4ilobanoaMaM.3prinMMi nd OM IMii ooNoeMn apo.a&amp;lt;iaM mm..........................tf oi*wiir $msr</p>
        <p>&amp;lt;OMddCBWdd|io |iCcawdBiiiiwiofdC W- aeopiwwiw 1 rro aindi Mfdno ftio Tta rallllM nr 'till it    f    ***</p>
        <p>TdwOMl-dfMf^dMJT MaoDaHinwfltfdnMd</p>
        <p>(T) iMUd umt Cnnwiwll caeiwor. PnmWaWy caeuiaor * oi*Tpdr&amp;lt;aulgMpRdinNiiniiay.Dtli paean iNir.pMMtiwrMekaiipad.</p>
        <p>nmpot.</p>
        <p>mmT*in.9t.........................vawOaasdMMiMi</p>
        <p>nwy aid lonnna manwy tornpaai otoMWia. Baaay Mud</p>
        <p>ad. AC adwar opaanaL Medd hrioosat aaaMOMt7.ooAOJ</p>
        <p>canon FOidanMinloeKea The eeewi</p>
        <p>aSMXMtM.................</p>
        <p>HBadaddClifMiWatnaar.Ra</p>
        <p>la. naduaaA aaaoaa and nnhaa  ooplaa up to hgd ada tan oa^ la wga aa to a 14~. 1)w re eaawoa aadam dtow you to dnnaa ta lana * no maaa wd  a* 8ta&amp;lt;a to epata, re eeWdeea not induded nodal re</p>
        <p>ataooMttaMoo...............................mtornmmM</p>
        <p>VawOaaiMMd-nUT</p>
        <p>M Hayal nM Mia Papa tor 41 anpaatpnmaa</p>
        <p>aWHBOO S.4P...................................Yaw  Oaai  tl  Jd</p>
        <p>(Ml WH 1|R PiMmaplay MMtotor. Handtad nwdd pnna on to nwwalaandMaaintooltan anndad daa papa na. May manwiy.nonpM moda HO MLIPltS</p>
        <p>aM404MtJB  .........  tawCaalJIMd^dlMT</p>
        <p>yn*a71M0 AC Adaptor.........................YwaOaaitali</p>
        <p>(tl)TaaidliialiaiiiaidaHilaiHailiirdiiiatar.6aaaantonaaenoa)ei&amp;lt;da</p>
        <p>a ANftjre* aaia pona M </p>
        <p>M&amp;gt;081-K.M............</p>
        <p>OHt</p>
        <p>phaagnpiiyiMital IftOSM 1142.00 .... (lHlaHaMaaaiadPl a100674t32000</p>
        <p> anyltoyoaoioeanaaa Moddlt-illH.</p>
        <p>pand.MMMUaA.2y&amp;gt;'I aoaoaa-1 atoo</p>
        <p>TPwCaOlWWMa BtT ..............TawCaaitMiMa  nia</p>
        <p>I tkn oonW aarwaa and adinnaad touah oanaa</p>
        <p>aaifjr</p>
        <p>OKiaoaMaatoo.</p>
        <p>OM Nnoda ataoMM AF W-Ttonn M Lana.</p>
        <p>aosaotat tattoo.......................YwCwaiaiaitr-tt44J7</p>
        <p>(t MomH am aw UM Oaaan.  Manaoanani andan U4h Maad aan-</p>
        <p>wvaaoano and UilaMtoa Honda ladMladi Ml nawdigWMtom any igto mto good pictona-New naada baaanaa We 11000 weaao</p>
        <p>aaiMt^iotw..........................VawOaalMMr&amp;lt;-atJY</p>
        <p>(1T}0aaalMataahlaaaiJICaataHnMni0taa.-*TiiplalHBinaat"Ckariiyda eaeioi.iawiipenQi**HdBaaebudaa,aMdeameaolMann.irahapediani aaniaa campiato aji aun</p>
        <p>dwdd tod tayaaa.UgMndgrt campad dadgn tor aaaytwndtog. Canon IMA</p>
        <p>iMtodtanany  _aooao-Tii.oo......................YaweaaioawMr ataajr</p>
        <p>(tMWtanTala-TmanCanwi tap to(Ma,aMtoaaane, auto wdnt amad ladi (Ml otanlda) OX coda (84-1000). Camaa Mudaa iWum baaay. aa-TORMi tona Ol M IntowMon ICO. awaotoaflw.00 ................TawOaaitawM tiwor</p>
        <p>(liaaaatAitWHaHaltainadB Pbato ttoina tanyalaiwoi24t74.............. tawcaaiataap  awJT</p>
        <p>(Ml aali IMpad Oaae 420 dantor nylon may appad baebad aaaa ntoi aaapastootsawaoB ...................newoeetaaweta?</p>
        <pb facs="00096780_0255" />
        <p> BUiggigi.HeidedicaiMwWiiqhlwiqN</p>
        <p>fnioMuwltimwandduniy^trior.ioaiidycMWOlWdgnwr</p>
        <p>n^. Som ONI qulppad w wtwah. AvaMble m Marra Burgundy or Gray.</p>
        <p>SSaTT^..................vour  cmmmf-  imjo</p>
        <p>Spy**?'.................taw  CealM#- 44J0</p>
        <p>................taw  om-mm*  m*M</p>
        <p>smoT^:....................tawCaalr-  MJB</p>
        <p>..........yw,Oa-.-.B-J ......  420dafijarpawrflwy</p>
        <p>Mh braan  tiiin. Sonw caM acMPPad wah wha* toma</p>
        <p>aad|uaWtto&amp;lt;dartltipt.</p>
        <p>SioOMsioaw^.  VawOaatBM^r^BMO</p>
        <p>Sm^^TMOOO  ......  VowCaalWt^S1i.e7</p>
        <p>...............tawOoalIMr-tl4J4</p>
        <p>SM^wrTsiOoy. T.**!* Yaw Caal BM* M</p>
        <p>m Brown. Blue and Burgundy.</p>
        <p>..............yawCa.M.WJ.</p>
        <p>SoT^ "T...............tow CoalMM^ 9tM*</p>
        <p>YwwOaa.4.M^.tM.iT</p>
        <p>YawOaa.m.r-lirj.So'STT^...................YowOoalaal- N.W</p>
        <p>(lai PM MoMa Tlitiiweplaillr TnM PMb. Aluminum cup. 3</p>
        <p>aluminum tlWflMat. can opanar and ttirtiyyoon. ___</p>
        <p>f)IBi9.ayisoo ...............YawCaaHH.BB' tIMB</p>
        <p>i ouidda podM tide appaM cornparwM</p>
        <p>ssas*r".rrrs-m..4.as i!i!?Pamiatoam~qa!Srv^^^ **^!i^S'ar i </p>
        <p>miliwMNI^  MwSSrnanrla. hy padd-</p>
        <p>'  .'75</p>
        <p>ad. Wth play oamat.   </p>
        <p>2144036-7 S29.95 ...............Yow Coal WtrtY  tIP.N</p>
        <p>(17) Oiaoa VInyl Caiilw BadnB. Swing aaai dalachat 10 usa a* a</p>
        <p>^m-9SS8.9S ... ...........YowCaalMdiYt-t3B.t7</p>
        <p>(HI Caaaa IMiBa MU riM. ThcMy paddad wnylMandaxir ^ back pk daapSh wraiwiund bay.</p>
        <p>20MOMU2M ...............YewCaal-BNiW'-iaB.SI</p>
        <p>OySMrSwiiwCaapaWaM.Ea^</p>
        <p>2SS^-7S3196............YewCaal-WiW'-HI.Sl</p>
        <p>miWmlinp'N^I* TallWai* .JualplacatoddarinToi SS.Bp up iaihiald.buclilaaWobajl andigo____</p>
        <p>gyMM iS IMIaicr M &amp;gt; Canlw. M langlh miWaMU</p>
        <p>mJ IM iwga wlMa and loam cotaiad han*. IMures a pujad</p>
        <p>Irawl bag and a iapoailion radning atal. Eaay onaM Wd</p>
        <p>Ramowibliinlaniaaaieowr.  .  ......</p>
        <p>2i44&amp;gt;B334t799S...............Yow Cual N.Bt'lai.n</p>
        <p>gS^MIMMaSr CMiPImhL</p>
        <p>ocmbidoa MaelMwaMtMlwm^</p>
        <p>2?i^nagj5 ...............Yow cual</p>
        <pb facs="00096780_0256" />
        <p>(1) NA Mto Timk Omt 4 IMw Miiin. AvMM in 12 or 20 owg*</p>
        <p>'MOM&amp;amp;ftir......................yoor COMMMT. ttttjr</p>
        <p>n Wirt W* AMInw M Oli Aolllp Will. 23" bowl. MndH a itwor</p>
        <p>long ifo cMMgn A&amp;lt;4iMbli mr 0. MM2SA 6kiaiMl</p>
        <p>ts3a7|7!oO.....................tiorCool44ri-t114JT</p>
        <p>RtHl M* AtiM Orikor Aooig HMo. McW.</p>
        <p>aaMoi-oiiwflo  ..................  yeiifCoiiMWi4-tn.ty</p>
        <p>a Cil WM AwgwKii ffilH W4i. BB wpww. OngHOomiW ftfcoil</p>
        <p>omMlMy aOOBBNMivoit.  _</p>
        <p>11304064 S34.95 ..........................VOW ftirt I6*fr. I30JI</p>
        <p>w IMaMOM Mr MM. 30 88 (opooHf OIN thoM pUM ond dM 200 Ipo lM0712166..........................ylirCool4*fO-614J7</p>
        <p>m noww llll roiti rmilum Hnfr TTi</p>
        <p>606682.16  .......................VOWOoOIMrOO'6146</p>
        <p>pMt Mti ctwgir nd diaiging Mnd</p>
        <p>444M164 MOO..........  Vow  OOOI66640  63244</p>
        <p>(12&amp;gt;I1K6IIII|MIIII CoipillO I Mill li6niiillllliniiiilloli BatneBOHftnl. kA MimiiMo. coinpoa. auOcatnpod. dornoNcAiipoil CM ond nek*. JuoUMip lodMn.</p>
        <p>440000U 16.06 Mu*..................Vow  Cool  616*7-06.06</p>
        <p>4400404-1116.06 Nod.................Vow  Cool  416i6f-6646</p>
        <p>rOooH</p>
        <p>4400002 6 016.061 4400001-7 $16.061</p>
        <p>Vow 0ool4l6*r. 6646  13320330  6130.06</p>
        <p>(IQ Thonooo Ouort Mm 8oHi*. &amp;lt;Wh b*4 hondhi</p>
        <p>1266-032-3 6346 .............................Vow  Oool AMT-6347</p>
        <p>(86) 61001*0 VJ4. tNtao Amo KoHo. 3 non1344017-7 613.03 ...........................Vow  0*0140*167 6647</p>
        <p>(21) WHOM IM6 WMIo OoN 8*6*. Spociol pockog* 0113</p>
        <p>1432&amp;gt;1630 613.06...........................Vow  Cool 601167. 6647</p>
        <p>(12) J**k NWdooo OoMin B*w 6M imt iol IMMon MOigMod I fghMdtf* aM MM. 30 and pacNng Mdg*.</p>
        <p>_ -----(0.016644</p>
        <p>Vow 06</p>
        <p>a Cmomm C02 MM*. Hw 003 powor P*I*M por pock. 2ne Mod.</p>
        <p>I13IM)16*|346 .............................Vowa*l684r Om</p>
        <p>a Ciowin .177 Cl&amp;gt;or 8*6*1*. 330 por pocfc in lOuoM ftmite b&amp;gt; pock. 1130014261.66 ..............................V*w0*0IOH4r-846</p>
        <p>aWiiOl 8*1*111 can. 1loot66*ug*.*6oBPP*rl)l6*nrhoo*l*r COM* Mh</p>
        <p>(13) Mortoo MImmw Tool 8MdOi**L Gr* lor owing *1 your noM. Orowon bek*unnU6yMiciM*rl*elOMd.fM*n*ni*lllnialiM***ura*10!4x8xOH". 44760462 636.06 ..........................V*w0**l066l6t-62746(1l</p>
        <p>14360224 6340 "C'#l*k</p>
        <p>6146</p>
        <p>.Vow 00*1484-6146 Vow Cool 664-6146 Vow OootOMT-6146 Vow Cool 644 6146</p>
        <p>44660161 61406.........................Vow  COW 64&amp;gt;tr-61247a Mod* 6*1*1 Oonior. SiWy wn* on* au&amp;gt;*l Wo 6 Qmindod cod.</p>
        <p>44660214814*7 ...........................Vow  Cl4 6464. 8646</p>
        <p>(16)16*1*11** Tool CoMlotaiiKCoHnoi Onoltnlolocohlnoi ndM</p>
        <p>gIdoancwwaiindddooiOMiiOOMitm-.  _</p>
        <p>44760130 sm.86.........................Vow  6o*l4*64r. 8*64*</p>
        <p>(ll)MH'*tMoACkMB*''CM*** OiOLOpoiOMOl 100 *nd3001pm. W-iMd or loiwoo. Owgw tarn wo n M in juoi 3 noun. Como* eompMMiy oQuip</p>
        <p>14360364 83.30 6V06 IMoh ..</p>
        <p>14280234 63.30 0"24o*k  .</p>
        <p>14360374 62.50 "AAA" tOook 14364440 USO AA lOook .</p>
        <p>(18) Brtnkmowi Block 6Wi* Mil 7l**k66 Up W M 4m** ongWoi nn or-(fcwypomgi*. apollo Hood oCMMbM Doom. Mk-* 6400 rotoM good mi 13B1I67. 10640167 817.86 ...........................Vow  C**l 64l8f  8*4*</p>
        <p>(16)C*lii*nki8*li *86.mclid***d*pW*W*irinoow**.iportb*inpuinp* up n 123 pm U*o on low prooowo **m*.</p>
        <p>11260627 624.86 ..........................Vow  C0*l4*r    61447</p>
        <p>(17) TMokkn M6IW Oort Ooow. ir-dWnoMr by 1 *1ck-kKkid** 6 dortoi</p>
        <p>It811676ia96...........................Vow  C**l846lf-8647</p>
        <p>(16) OoMmom MiOHOI * Cooloi. SwmgOown hondo. UghMMig Id. 11260363 *14.88 .........................Vow  CodOW*-87.86</p>
        <p>(33) dock lOoMoul OoMon Bow 34*. Wood 6*L 1. 3 ond 3 wood* w4h PMmoNOOd* Mmin*i*dh**(h.lghMidii*d*hdH.</p>
        <p>13220322 6W.S6.........................Vow  0*oll66i6  *764*</p>
        <p>(84) amWoM 4618*. IM. OooCort 8rt6.410 oq. m. cooMng omo-30400 BTU dudbum*r.P*iioe*ilk*inM)***iitiMrg**ioi*o**hdl.3*id*kM*.Fu6Mngi conkd oonool*. lAoAMdlc' igniw. fud Sonkylid Mwd Meow. Fu6i*w M* wMaw UHnoi hokWo. Uw rock ond 204). Ml* mdudod. Ckwn* ** oooNng</p>
        <p>14360174 613*98 ................</p>
        <p>(18) aw*** ChoNleok. 6 Hx box. 1060010066*3  ...............</p>
        <p>(8*)8ll</p>
        <p>.Vow Cool 84**)*-*11*4*  Vow Cool 66d. 8*47</p>
        <p>IW 8ri6 BocM*. aioeli. 1230 w*R</p>
        <p>10640170 611*46................... .....VOW Cl 0I6WI6I. 67644</p>
        <p>(27) Ckoi*o6 *U 6*. M 8*0 CM Qri*. iWooMin opoMne omit. *n *4. m. coding MO* mckidH awingAwtyo womiing rock. Rom mM" Rong* &amp;gt;oeli. Pudibuoen igniW. occuaug* ond iMd Mdeoior on kd Mng* ghd Mwd eonod* Owl OMMMO* Wd H bunw. 40400 6TU. 6dd idi gwy wed bdWn dM*. W down koM dm. 2 Idddown dd* didwt. Lug* window m hood.</p>
        <p>10000466 *39**5 .......................Vow Olll IM*l67  t1**47</p>
        <pb facs="00096780_0257" />
        <p>SSSffl.........................--*K2ir2</p>
        <p>sssssBT. , gs!'im!*</p>
        <p>Mrmft.GMIWlMlglM. J  ,   T^eW*r.M7  MM-HWOil</p>
        <p>ttssrsr</p>
        <p>n Ki* iMiMib  Cw    mm</p>
        <p>imMiieuiMdMM. Etura</p>
        <p>HBpwwMii</p>
        <p>MdMiwUlMMlMnpeMlQrpMpwglp- tof MvrMMlMrtMlMipanMMtMi iieMtMtMJS</p>
        <p>USA. njXHmoMJS.</p>
        <p>YewCWMMiSr.SM.f7 (N|DpMlfCI</p>
        <p>of rahee tarn your eML For</p>
        <p>SSNMmw. EMidMlMiiiint MMi. QfMlorM^i</p>
        <p>OMMMlMlHlMLMMallMMdifMISMIBHS</p>
        <p>(Hl</p>
        <p>kNSSM</p>
        <p>iW^  ___________</p>
        <p>lilCMtSlM*SM.fOMlhMBafM7MMIe^MMlj!U^</p>
        <p>1I9S-10141BSSS.................... tSwOMHMr</p>
        <p>MI^lMMrOMI*lMfM&amp;gt;Mlirsili niiMMLCOeonM&amp;gt;ilD.Mf.</p>
        <p>MdM0MMWMtlf*I*WHMUi(liOt</p>
        <p>MWKSn*</p>
        <p>tdSOAlMh</p>
        <p>I.GMSIIMH0II</p>
        <p>OHM</p>
        <p>t&amp;amp;Hk</p>
        <p>.................TsmCiiIIWBiS7.SI1S&amp;lt;7  fatMnSng.wiMMigatMr(</p>
        <p>ms mmm ism bmmum is i&amp;gt;. stmm</p>
        <p>nggMOL AdiMIMIifMl AdiuMMIiMMSmeM 11MHI7Mt.t6  ......</p>
        <p>HttMfilUlllWSSSISil MMMtiaif.</p>
        <p>SMS WWMWM*dMA*eSse*1MaWl-</p>
        <p>Miys^^^  ....., n'i I</p>
        <p>MM SSeSSSsD****^'*!*".*^..  MwM</p>
        <p>tftKLSL</p>
        <pb facs="00096780_0258" />
        <p>' ]</p>
        <p>(1) HMbie NockN Curt JMMwtaa DraaMd for Ihs MO*. poMaUe</p>
        <p>wtti cuilna hair.</p>
        <p>7876-174^ .96..................*  Voor  CoatCMT- M.N</p>
        <p>(I) MaM Hol iMha* . Cod rnodala rth taahior) look. Sok) taparale-ly. Mlr-i S3.00 raba good tau 1201/87.</p>
        <p>8062-084.7 $27.85 .................Vcur CoalOatM - $18 J7</p>
        <p>m Colaoo Cwna Wd*^ . Each aiiih *iy. tooad fiyiori hrtf. includea btuah. jornalic bag. haif fWti* afKl dalu* od*t Arto inciud** b8i</p>
        <p>carflteala and adopOon papara. Mfr'a $5.00 ra^_____</p>
        <p>7888-101-4 $38J5.................Vaiir Caal $88 JT- $24.18</p>
        <p>(4) Oolaoo Cabbag* NWi KIrta nm iart. Can ba Hartad wilh dhar C Bunk Bada. )uil r* raal bunk*, includ** cornly tnadraia and aoft</p>
        <p>7867.1 $21S5.................VourCoalCW!8*-$14J8</p>
        <p>(5) Cotaoo MMa BaM NaWaa. Qanuina 14* Cabbag* Pak2) Klda thd OKI ba Uy knnwriad in Miari Hai raahabl* Corno ha and a I iHto lo**l or waHieWh. OulN* ara appropna</p>
        <p>7688-86M $3485.................Yaur Oaal8Wi8r- $2$.88</p>
        <p>(8) Naato My UMa Pony Nowbom Tirtna* . SmaMr than Iha baby</p>
        <p>pona*, tha twin* ara awaal and cuddly rilh a nowborn'a aofl riipy holr.</p>
        <p>lndudiaaoc**aoria*.Eachaaldaaparaialy.</p>
        <p>17878-1788 $8.85....................Tour  OaolBMr* $780</p>
        <p>(TIPlayaliaBlBioaaBaPapi.Apnachoolar'abHdraialngdoWSnaoba</p>
        <p>Popaai8looablodolBwiaaayK*a**ouMi and long loiMnghair lar* fun lo comb Id HyM Arma and loga are par ol aach ou ao * aaay lo pioy draaaupl</p>
        <p>8150-752-7 $14.86..................Yoor  Coal-84i88  $8J8</p>
        <p>m Nieaewe Jaapairty* . Playwa chalenge each o#w on a wide ranga ol Maraalng and MottmIm topic*. 310 5 playara, agt* 1010 ackA</p>
        <p>81540183 $14.86..............  .Vour  CoalHi8r&amp;lt; 88J7</p>
        <p>m CartM ir ailigamaiow. Haevy paddad brown vinyl cao* laaouraa Tan Praaiig* Siripa* and i*R playing laid wllh iiehad pokM.</p>
        <p>7842002-5 $18.98  ................Vour  Coal8Mi8r&amp;lt; $8.84</p>
        <p>(181 raBwia Portar Biurtiaa Ola. U*a your logic and imagtnalion</p>
        <p>lo aack down th* murdar. weapon and acea ol Ihe crime.</p>
        <p>8138003-2 813.85 .....  Your  Coal  Mr-$884</p>
        <p>(11) llen radtoy Opeialloo. Perform III* operation bU don't allp-or you g buaad. For ago* 8 to 14 year*. 8C bauario* not indudad 78320033 $1285........  Your  CaalOOiOr' $788</p>
        <p>(1S)8aWiowTiMalPunidl* PaahalPlayoir .ThepartetgiAlor daiwd players. HaiKHiald acorakaapera. two * d card*.</p>
        <p>8234017-5812.85 ...................Your  Coal 88rff 88.87</p>
        <p>(iq PlayaliBal ABC Btook Train. Train and block * on fraa-rolng whoala. biduda* 30 norviowc wooden block*. Age* 20 years 8150-1030 $18.86.................Your Ceal.B*8i8P  $10.87</p>
        <p>(14 ahatootu Miialed TV. VMKh iho bov and IM Manda parade acre** iha acraan wMa a marry melody plays. For ages 1-4 years</p>
        <p>81820120 $10.96...................Yaur  Ceal 88i8T  $8.89</p>
        <p>(1$) Nanai JaoMn-TlieOluale4ax. Three musical surprisa lor ago* IVktoSyoars</p>
        <p>80620040 810.96 ..... Your  Ceal 8888* $8.89</p>
        <p>(18) NaabraOol In Shape Bill* I Wotkoul Phia. Shape up. tone up</p>
        <p>with Ighiwaighi dumbbalB daalgnad lor gkt* aga* 5 and up. WKh color-M larryclolh headband and log warmers</p>
        <p>7878-133081586 .................Yaur CaN 848i8P  $10.87</p>
        <p>(17)PlayalieBlBuaPaahNBaaNltrar.8haBreainantnilrrorand two Mandly beam plu* beads Ago* 10 24 months</p>
        <p>8153104-1 $22.96 .................Yaur Caal B18i8f-$18.87</p>
        <p>(IN Shaleoia BNN Ortiro*. Eight acHviiias no 100*0 parts For ages</p>
        <p>8182^ $12.85...................Your  CealOONt  $880</p>
        <p>NO RAINCHECKS - DUE TO SEASONAL NATURE OF TOYS</p>
        <pb facs="00096780_0259" />
        <p>mm</p>
        <p>OVER 50% OFF</p>
        <p>OUR REGULAR SELUNQ PRICE ON ALL MASTERS OF THE UNIVERSE FIGURES AND ACCESSORIES</p>
        <p>NEWBMQHT</p>
        <p>(1) Commbta Boyt Big Bow WX. V^ite gumwdi tires. 4 bolt pillow block stem. Front and rear caliper brakes. Silver-Grey.  _ ______</p>
        <p>7670-127-5 $99.95  -Your  W-W</p>
        <p>(4) Pwser Wheele Jeep* Renegade* . Po^</p>
        <p>83MtS4^&amp;amp;9\SirCl^^K|0J1 81&amp;amp;Ss $67.95 .. .Your Coat SWiS* - M|W7</p>
        <p>WWonderttoeWefcJ^ -?2SrSKffi</p>
        <p>keeps baby in place as t acts as p walker. Ren^</p>
        <p>seat an^ frame easily corwyta to spniy 8462-0160 $34.95 .. .Your Coal&amp;lt;aMB-- $91.97 Praalon To! Trainer. ^   </p>
        <p>81480030 $35.95 . Jow CoaUJMJ</p>
        <p>Mail coupon to Mattel tor a Mfr s $3.00 rebate. Offer good thru 121/87.  ^</p>
        <p>8^-049-7 $29.95 .. .YourCoal-Ht.iS'- $19.9$</p>
        <p>(8) New BrtaM Taldng Sllwer RaM 44 Trato^</p>
        <p>detailed en^, coal terxler. box car arto caboose with</p>
        <p>talking freight station. Features working headlights. 7 C batteries not included. ^  </p>
        <p>8104007-3 $64.95 .. .Your C(^9l4^ $4^0</p>
        <p>aPwfcer Bromara Nerfoop* . Official in^ b^-I and hoop. Ages 5-up. MaH coupon to Parker Bros, for a^.M%Xoff good th^^.</p>
        <p>8138025-5 $5.95......</p>
        <p>(im Qaloob Crash i Beah Bet Com con^e 2 battery operated destruction cars and a bashing nng</p>
        <p>to contain the action.  ______</p>
        <p>7790011-6 $36.95 ... Your Coatj999f - $2t.97</p>
        <p>(11) New BrlgM Raro Irael 0^. Battery-ope^ (not included) rernote control car, 15 long with fuHy detailed interior dud sfckcontrol.</p>
        <p>8104008-1 $28.95 .. .Your CoalOt^-$19.97</p>
        <p>(12) Hasbro Tranaterrnera Decepllow 8pe^ Vaam laadara. These deadly flPjYers lead ^r</p>
        <p>tewT into battle. Each transforms from monster to veni-</p>
        <p> Your Ooaty9-W;9$</p>
        <p>(13) Parlwr Bromara Monster Mash" yiyOte^</p>
        <p>Wacky, slap-happy action turns ptayera iKo hunters of the gootertM^ everl wm specW THWACKER- hands, players scurry to^ and up the Monster cards that match Monsters on the</p>
        <p>automatic Monster-Maker MacNne.......</p>
        <p>81380340 $16.95 ... .Your Ooat049i9B - $9.99</p>
        <p>NO HMMCHBCKS - OUe TO SEA80NU. MMTUHE OF TOYS</p>
        <p>a</p>
        <pb facs="00096780_0260" />
        <pb facs="00096780_0261" />
        <p>mtrnrnmmm-</p>
        <p>muThkMittVi</p>
        <p>H</p>
        <p>(V/ \ -f'</p>
        <p>:%',B.</p>
        <p>52^1</p>
        <p>.f</p>
        <p>. ;l</p>
        <p>^ , I</p>
        <p>km  .</p>
        <p>IV  I.-. -^  .-  ^</p>
        <p>BLONDIE</p>
        <p>BY DEAN YOUNG &amp;amp; STAN DRAKE</p>
        <p>X JUST TOLO Ion MY 60ooNess;</p>
        <p>7</p>
        <p>that gobs it </p>
        <p>X RBNT6D A CABIN IN THE WOODS POR THE HOLIDAVS</p>
        <p>BUT, DADDV^ NCVBRJTHlS IS AOOOP YEAR L6AYE HOW ON  TO  START</p>
        <p>THANK5SIVIN6</p>
        <pb facs="00096780_0262" />
        <p>Y HANK KETCHM</p>
        <p>Lets play somethm. lumoutb fiock is. / bea wild turii^</p>
        <p>and III shoctr you with my musicet.</p>
        <p>ANDY CAPP</p>
        <p>.V n iTm  :BY SMYTHE</p>
        <p>rlrc;3 '.v f</p>
        <p>mi fiMiui.y ouKiis</p>
        <pb facs="00096780_0263" />
        <p>CALVIN AND HOBBES</p>
        <p>BY WATTERSON</p>
        <pb facs="00096780_0264" />
        <p>FOR BETTEB OR FOR WORSE</p>
        <p>V</p>
        <p>BY LYNN JOHNSTON</p>
        <p>by Hal Kaufman-</p>
        <p> iUIITftTlbiMrtiiuMtaral.S,lbti10itflflnMinli M m fl0M rawtaSt.</p>
        <p>of iw ataraM a rIgM to Ital flit tiini a tadi hdiliiM tnfl vtfflctl</p>
        <p>and dtwn roan only (not dtagofWiaaraloloM. No fair poaUng boiow.</p>
        <p>Wit a 'it mm mi m</p>
        <p>Q</p>
        <p> THMa807TNi*aiNiDWfda.tachwNhflitaaintflvt IIIllS,inFWWOppOKIWilmllingK. P.H. BOnwOiuKOigin wifli flit laflar tl."  -MMiiiwfMitMi</p>
        <p>rllOflDTIflf^ SiMlIni vHh tht woid HAP, tat tbcNMi, add on# Itilar and laananga Mara at naoaaaaiy In aactiaHpfotormanaar'</p>
        <p>CAN YOU TRUfT YOUR lYfir Thart art at loatt ala diffar-aaidilfl can yaa ftafl tflamt Cflack aaawara wNli Hum flalaw.</p>
        <p>MOORL PONCRI Apply arayana ar 4 aagawma abata; 1 Htd. U. l-flaah. t~Lt Qraan.</p>
        <p>lapnaatiaaaptAHpiataflwaiJnpYYwuMHtPHii^</p>
        <p>iwiyinMHHa&amp;gt;i&amp;gt;MMY*pM.aiiiMY-at&amp;gt;io*MtiigtattiiiiifliO</p>
        <p>1. A abort alaap (Maaflybiplaoa).</p>
        <p>a.fltiaalatglBM.</p>
        <p>ARodyotlwara.</p>
        <p>AM ar piapaflar flrbianomR.</p>
        <p>k lailb, Mira. Jupk</p>
        <p>lar, Vanua, ale.</p>
        <p>Altar oompMng tNa axofOlaa,aaal(youoain NNb out a dMarant aal of worda to UN ttia (flagram iMIarly. pick MCKfll Can you find flia latn flanla aaNaoia MotaT tiSniirTXrr  datana  aarafully  batora  yaa  anawor.</p>
        <p>' i&amp;gt;</p>
        <p>SKLLBINDill</p>
        <p>KORIIOpoinlaforualngalltba .....</p>
        <p>baa compiata warfla:</p>
        <p>LlYIRAflll</p>
        <p>TmH acara t palnta aacb far all -</p>
        <p>HBHI AniiP^ mK</p>
        <p>Tty ta acara at liaal n flflbfli.</p>
        <p>ii,..V i</p>
        <p>MBMMM</p>
        <pb facs="00096780_0265" />
        <p>BY JIM DAVIS</p>
        <p>HR</p>
        <p>('^s^y</p>
        <p>'' 'i'sVik^''-</p>
        <p>iVEmoiWBp-mB^Exmnip \ meiR fefiw-ieniMEAW</p>
        <p>nvMmYHA^/tnl iniroof?</p>
        <p>ftw</p>
        <p>IWW WHU 6C 0MK MOi.</p>
        <p>5&amp;gt;v~,</p>
        <p>* .&amp;lt;2S5wNW#lltoeitis^ </p>
        <p>^ '/mmmtmtmmmm nMJiwsiiwmwwia-- ms&amp;gt;y</p>
        <p>Mill</p>
        <p>r'i' ' ' ^ i'!?:</p>
        <p>cmm%^ $mmmmf ittlffit SMMNCH.</p>
        <p>mrJWfTmi!]</p>
        <p>CMC6Kf 0QC9</p>
        <p>imnH mmnt 10</p>
        <p>aooKTtJ</p>
        <p>tm we mce ^</p>
        <p>OOIL...IMK 1 THE UCKI..JM JM.</p>
        <p>...NAlT..,eC THCniflllN CUMN?.. ZCNITH,eOilie 0^ WITTi AOUT</p>
        <p>cm% ivcsiMom...in. JMiTf...</p>
        <p>mmknu! mSmmci</p>
        <p>ur</p>
        <p>AUNT MVr* MElP MTIijHC MstE</p>
        <p>...looKf  zmiiH,</p>
        <p>iMa fW MMT cirino MHK O0F</p>
        <p>ax/iS^mR</p>
        <p>^OOMOMO*- XT IWTT HMMIICH V TMf HOU 9FIN0 MTH TN$ OlllO...</p>
        <pb facs="00096780_0266" />
        <p>i-v.'C;-</p>
        <p>BRN LOSER</p>
        <p>BYARTSANSdM</p>
        <p>HAGAR THE HORRIBLE</p>
        <p>BY DIK BROWNE</p>
        <p> M ^  V'</p>
        <p>UC.C</p>
        <p>Ve.,. - ' - &amp;lt;</p>
      </div>
    </body>
  </text>
</TEI>