<?xml version="1.0"?>
<TEI xmlns="http://www.tei-c.org/ns/1.0" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://www.tei-c.org/ns/1.0 http://digital.lib.ecu.edu/tei/xsd/tei_P5.xsd">
  <teiHeader>
    <fileDesc>
      <titleStmt>
        <title>
        </title>
        <author>
        </author>
        <respStmt>
          <resp>Text encoded by</resp>
          <name>Digital Collections</name>
        </respStmt>
      </titleStmt>
      <publicationStmt>
        <distributor>East Carolina University. J. Y. Joyner Library</distributor>
        <address>
          <addrLine>Digital Collections</addrLine>
          <addrLine>Joyner Library, East Carolina University</addrLine>
          <addrLine>East Fifth Street, Greenville NC 27858-4353 USA</addrLine>
        </address>
        <date>2012</date>
      </publicationStmt>
      <sourceDesc>
        <bibl>
        </bibl>
      </sourceDesc>
    </fileDesc>
    <encodingDesc>
      <samplingDecl>
        <p>All quotation marks retained as data.</p>
        <p>All end-of-line hyphens have been removed, and the trailing part of a word has been joined to the preceding line.</p>
        <p>All smart quotes have been converted into straight quotes.</p>
      </samplingDecl>
      <classDecl>
        <taxonomy xml:id="LCSH">
          <bibl>Library of Congress Subject Headings</bibl>
        </taxonomy>
      </classDecl>
    </encodingDesc>
    <profileDesc>
      <creation>
        <date>
        </date>
      </creation>
      <langUsage xml:lang="en-US">
        <language ident="en-US" usage="100">English</language>
      </langUsage>
      <textClass>
        <keywords scheme="#LCSH">
          <list>
            <item>
            </item>
          </list>
        </keywords>
      </textClass>
    </profileDesc>
  </teiHeader>
  <text>
    <body>
      <div type="other">
        <p rend="align(centerbold)">[This text is machine generated and may contain errors.]</p>
        <pb facs="00091594_0001" />
        <p>Weather '</p>
        <p>VuliMe cMImw timck We*wsiay. CmUmm mM.</p>
        <p>91$t Yea.</p>
        <p>NO. 105</p>
        <p>TRUTH IN PREFERENCE TO FICTION ,</p>
        <p>GREENVILLE, N.C. TUESDAY AFJERNOON, MAY 2, 1972</p>
        <p>12 Pages-Today</p>
        <p>INSIDE READING&amp;lt;</p>
        <p>S-- HRhig (DMB|riaiato ^ge C  OMtaariM Page 12 ^ Aerial Maypiag</p>
        <p>PRICE 10 CENTS</p>
        <p>Victories Spur More North Viet Attacks</p>
        <p>Chief Law Officer For 48 Years</p>
        <p>J. Edgar Hoover Dies in Night; 'Natural Causes'</p>
        <p>WASHINGTON (AP) - J. Edgar Hoover, director of the Federal Bureau of Investigation since 1924, died Monday night at his home at the age of 77, the Justice Department announced.</p>
        <p>Hoover, the nations diief law officer for 48 years, had become a l^ehd in the United States, shaping the FBI into a massive, powerful federal agency.</p>
        <p>Acting Atty. Gen. Richard Kleindienst issued a one-paragraph statement in which he said Hoover's body was found by his maid at approximately %30 a.m. today.</p>
        <p>it is with profound personal grief that I announce that J. Edgar Hoover passed away during the night at his residence, Kleindienst said. His personal physician informed me that his death was due to natural causes.</p>
        <p>The jut-jawed FBI head was permitted by presidential order to continue in his $42,500-a-year government job after reaching the mandatory retirement age of 70.</p>
        <p>Hoover, unmarried, dominated the bureau during his lifetime as no man in any other federal agency. Wielding vast power, he was said to lavish on the FBI the pride and psses-siveness of a stem and watchful parent.</p>
        <p>He joined the bureau as its acting director in 1921 after several years as a $990-a-year Justice Department law clerk, and became director three years later. Bom in Washington, D.C., on Jan. 1, 1895, Hoover received his law degree from George Washington University and lived all his life in</p>
        <p>the Difltrict o( Columbia.</p>
        <p>He had a fondness for dogs, for his garden and for horse-racing, confining himself to two-dollar bets. But nothing transcended his devotion for the FBI.</p>
        <p>As much as he loved the bureau, Hoover hated communism. He reduced the Communist party in the United States to a shell, riddling the organization with agents so that members never were sure who they were talking to.</p>
        <p>Tlie FBI grew from a small government investigative armfounded in 1908 after demands by President Theodore Roosevelt that something be done about political and business fraudsto a massive organization of some 15,000 employes, including 6,700 special agents. When Hoover took command in 1924, the number of agents totaled loss than 500. "</p>
        <p>And the bureau Hoover joined was badly organized. Politics played an important role in its functioning, and violations over which the bureau had jurisdiction were few.</p>
        <p>Within the government, there were growing reports of corruption and scandal among high officials. Even the Bureau of Investigation was said to be touched.</p>
        <p>Atty. Gen. Harlan F. Stone picked Hoover to clean house, and Hoover did sowriting his own ticket.</p>
        <p>Over the years there have been demands from critics that Hoover step out as FBI chief. Sen. George S. McGovern, D-S.D., in his current campaign for the Democratic presidential nomination, has said he would replace Hoover.</p>
        <p>Only this week ccdumni^ Jack Anderson told a congressional committee that Hoover prepared dossiers on prom&amp;amp;ient Americans not accused of crime. Anderson said he had seen copies of FBI reports on sex activities, and said some of these were givi to President Lyndon B. Johnson during his term in the White House fof bedtime reading.</p>
        <p>Hoover gnxuned no one for his shoes, but he often expressed the wish that the next director come from within the</p>
        <p>FBI rankf.</p>
        <p>During the years of Hoovers reign there never was a known case of scandal inside of the FBI and Hoovers stock remark about his agents was: They cant be bought.</p>
        <p>Hoovers parents, DickersOn Naylor Hoover, a Coast and Geodetic Survey employe, and the former Anna Marie Scheit-lin, niece of the first Swiss consul general to the United States, came to Washington in the early part of the 19th century.</p>
        <p>By GEORGE ESPER Associated Press Writer</p>
        <p>SAIGON (AP) - Flushed with victory in the far north. North Vietnamese troops launched new attacks today in the populous coastal lowlands and forced South Vietnamese troops from another base in the centrarhighlandf to the west.</p>
        <p>With all of northernmost ()uang Tri Province in enemy hands, the North Vietnamese radio boasted that the new province to the south, Thua Thien, which includes the old imperial capital of Hue, was doomed.</p>
        <p>The South Vietnamese were trying to set up a defense line north of Hue and 35 miles south of the demilitarized zone.JIue is 32 miles south of ()uang Tri.</p>
        <p>Authorities began a drive to weed out suspected Viet Cong agents in Hue,'a city of 200,000 now swollen with 150,000 refugees. Officials disclosed 600 suspected Viet (3ong agents had been seized in Hue the past two days.</p>
        <p>The North Vietnamese conquered ()uang Tri Province by</p>
        <p>using a wide variety of weapons new to the war. tanks, long-range artillery, and st^is-ticated antiaircraft artillery. To this was added today a heat-seeking missile.</p>
        <p>Brig. Gen. Thomas W. Bowen, deputy senior U.S. adviser in the far north, said the missile, fired from a hand-held launcher, was used for the first time ip the war and txYxight down a U.S. helicopter The four-man crew, a U.S. adviser and two Vietnamese were killed.</p>
        <p>With the battlefield situation deteriorating rai^y in parts of South Vietnam, top U.S. and South Vietnamese offlcials met to review the 34-day-old North Vietnamese offensive and map their next move.</p>
        <p>U.S. Ambassador Ellsworth BunkCT  Crei^ton  W.</p>
        <p>Abrams, commander of U.S. forces in Vietnam, conferred with President Nguyen Van Thieu for over an hour in Independence Palace.</p>
        <p>The battlefield situation at noon was;</p>
        <p>--Communist forces pressed their drive to conquer all of</p>
        <p>nmlhem Binh Dinh Province along the central coast with new assaults on Landing Zone English, a regimental, head^ quarters that is the last strong-point in the region.</p>
        <p>Fire Base Lima, on Highway 14 about six mites norUi of the provincial capital of Kon-tum City, was abandoned after heavy attacks. Up to 800 defenders fell back to tighten their defensive ring around Kontum City.</p>
        <p>The Saigon command announced that more than 40o shells slammed into Landing Zone English on Monday, inflicting modrale casualties.</p>
        <p>The attack was resumed early today. North Vietnamese troops drove to the barbed wire perimeter where they l||cked in heavy fighting with the government defenders. All U.S. advisers had been evacuated Monday.</p>
        <p>(Communist forces have extended their control to about 200,000 people along South Vietnam's central coast following</p>
        <p>the capture of the three northern districts in Binh Dinh Province.</p>
        <p>The U.S. 7th Fleet announced that a fifth aircraft carrier, the Midway, had arrived from its base in Alameda. Calif., to join in air operations over North and ^th Vietnam aimed at slowing the North Vietnamese onslaught. It marked the first time in the war that five carriers. each with 65 to 75 planes, were operating off Indochina at the same time.</p>
        <p>U.S. fighter-bombers flew 649 strikes against North Vietnamese positions across South Vietnam. about two-thirds of them along the critical northern front below the DMZ</p>
        <p>U.S. B52 heavy bombers carried (Hit another 75 strikes and moved their attacks closer to Hue. Several raids were 10 to 15 miles west of Hue.</p>
        <p>The targets were enemy troop concentrations and staging areas, and the raids were the heaviest in more than four years.</p>
        <p>Subdivision Standards In Election</p>
        <p>County Set</p>
        <p>By STUARTSAVAGE Reflector Staff Writer</p>
        <p>An ordinance setting minimum standards for subdivisions in Pitt County was adopted by the Board of County Commissioners yesterday afternoon.</p>
        <p>The boards action was taken following a public hearing at which several individuals voiced the (^ion that the ordinance was a good, workable plan.</p>
        <p>Although surveyors Irving Station of Tar boro and W. B. Duke of Beaufort COunty  both of whom do work in Pitt  questioned how certain sections of the ordinance would be in-</p>
        <p>Crumpler Is Elected New Chairman Of City Housing Authority -</p>
        <p>By TOM BAINES Reflector Stoff Writer Marshall W. (Woody) Crumpler Jr. was elected chairman of the Housing Authority Monday night during the commissions, annual elections and business session.</p>
        <p>M.W. CRUMPLER. Jr.</p>
        <p>Crumpler succei^ Ih*.</p>
        <p>L. Wooten, Greenville physician who has completed two five-year terms on the board and nearly a year as chairman. Dr. Wooten will continue to serve as a commissioner until a successor is appointed by the mayor.</p>
        <p>Commissioners elected Dr. Charles Price, a professor in the .history Department at East arolina University, to the vice ctairman post f(inerly held by Crumpler.</p>
        <p>The new chairman, a district engineer with Carolina Telephone, has been with the company 17 years. He joined the firm in his hometown of Fayetteville and held posts in Whiteville and Williamston before moving to Greenville in October of</p>
        <p>Cmmpler^s appointed to the board in AuMt of 1970 to flU the</p>
        <p>Hines Returned To Winterville Board</p>
        <p>WINTERVILLE - E. C. Hines was re-elected as an alderman on the Winterville Town Board in the municipal election held</p>
        <p>tncium</p>
        <p>Hines received 268 of the total 341 votes cast yesterday while hi&amp;amp; xi[gxineat Clinton Anderson received 72 ballots. One write-in ' ballot was cast.</p>
        <p>1''</p>
        <p>Hines, elected to his fifth term on the board (rf aldermen, is a Winterville native, He attended the Winterville schools and is emfdoyed by the Pitt County School Bus Maintenance</p>
        <p>by Charles Howard. He is married to the former Chloe Peters of Marion and they have two children, Marshall III, 11, and David Pridgen, six.</p>
        <p>The authoritys executive director. Col. A E Dubber,'who has tendered his resignation effective June 1, attmded his l|st regular Housing Authority mec^ng last night. His successor, Joe M. Laney Jr., was introduced to the board.</p>
        <p>Dubber, who had served as executive director of both the Housing Authority and Redevelopment Commission since 1962, attended 108 regular commission meetings during his ten-year tenure and toi annual, sessions.</p>
        <p>Dr. vy^tai said that Dubber had beX faithful, diligent and progressive as director and had pushed the authority throu^ some difficult times. In business during the regular session, commission attorney Kenneth Hite reported that he is closing out the last three percels in Newtown and should be ready to take a deed in the area in a few tfsets. Tie noted that there are still several streets that have Garage.  to be closed there but that</p>
        <p>He is married to the former matter will come before the City Edna Adams of Ayden and they Council, have three children.  Dubber  said  that he had been</p>
        <p>ineinber of the no^ied by the Departm^t of voiunteer fire Housing a^ Urban Deirdop-ir^ent that plans^for- the 78 units</p>
        <p>terpretated. btRh men praised the set of regulations.,</p>
        <p>Duke tdd commissioners, It is a minimum standard you are setting here, and said such standards are needed.</p>
        <p>Willard Dean, head of the Farmers Home Administration in Greenville and Ed Yancey, Agrictilkire Extension Service chairman also praised the Boards action in estaUishing regulations for subdivisions.</p>
        <p>The subdivision ordinance  recommended by the Pitt Ctounty Planning Board  is designed to guide and regulate the subdivision of land within... the county in order to preserve the public health, safety and welfare.</p>
        <p>The new law sets standards and regulations for coordinated street systems, dedication of utility easements and rights-of-way, for the planned arrangement of streets, structures and open spaces, in an effort to avoid congestion and overcrowding.</p>
        <p>Minimum area for lots under the new ordinance has been set at 10,(X)0 square feet - with no lot having less than 75 feet frontage (except those fronting on a cul-de-sac) OF less ^an 100 feet in depth. Larger lot sizes (a minimum of 20,000 square feet) will be required in areas not served by public water systems.</p>
        <p>Following passage of the subdivision ordinance, Cotn-missicmers held a meeting as the Board of Equilization and Review; however no one appeared at the session and the meeting was adjourned imtil June 5 at 2 p.m.</p>
        <p>The board discussed briefly the proposed four-laning of N.C. 11-U.S. 13 North of tho Tar River and how the road project would aHeet the Pitt-Greenville Airport if the widening was carried out on th West side of the present two^ane road.</p>
        <p>Highway Commissioner Arthur Tripp met with the board and said Highway E^ngineers are itinued on page &amp;lt;)</p>
        <p>By VERNON A. GUIDRY Jr.</p>
        <p>Associated Press Writer</p>
        <p>WASHINGTON (AP) - A federal district judge has overturned the 1969 election of United Mine Workers President W.A. Tony Boyle for flagrant violation of the law and ordered a new vote.</p>
        <p>The date and the machinery of the new election will be settled later, after all parties submit proposals. Judge William Bryant, who tossed out the election, will fix the details.</p>
        <p>, Bryant issued a 33-page opinion Monday which held that the activities of Boyle and other incumbents violated the law and may have influenced the election, the test required by federal law before a union election may be set aside.</p>
        <p>Boyle had argued that he had done nothing wrong.</p>
        <p>In order to find in favor of the union incumbents, Bryant wrote, The court would be f(Hx;ed to swim upstream against the tide of evidence too strong to resist.</p>
        <p>J(rfin Owens, union secretary-treasurer, and George J. Titler, vice president, the two other in-ternatttBy bfflcgrff ion, also^ill face a new election. Boyles present term was to expire in 1975.</p>
        <p>At the end of the bitter 1969 campaign, Boyle emerged winner over an insurgent faction led by iM*esidential candidate Joseph A. Jock Yablonski.</p>
        <p>Yablonski, his wife and daughter were shot to death Dec. 31, three weeks after the electicm.</p>
        <p>The election case began after complaints from Yablonski forces brought an investigation by the Department of Labor. The secretary of Labor then filed the suit, challenging the ejection on grounds that the incumbents used union facilities and money to win re-election.</p>
        <p>A spiAesman for the union had no comment on Bryants decision.</p>
        <p>In Beckley. W.Va., James Leeber, President of UMW District 29, said: I dont think the election should have been thrown out. Leeber also said there is no question the Justice Department is harassing Boyle.</p>
        <p>Another district president. Leonard J. Pnakovich, head of District 31 in Leonard, W.Va., said there were some irregularities in the election, but there are irregularities in all electionsstate. city, and national.</p>
        <p>This is good news for all rank-and-file miners, proclaimed Yablonski's campaign manager, Mike Trbovich. in a statement. We, the Miners for Democracy, are planning a steering-committee. convention in CTiarleston, W.Va., within the next two weeks. It is possible we will come out with a slate of candidates for the  new election.</p>
        <p>Just Waiting</p>
        <p>MAYBE NEXT TRIP  South Vietnamese refugee children, waiting to be evacuated from the central highlands city of Kontum, watch as a twin-rotored Chinook helicopter .arries out a cripple choppter. War victims trying to flee the enemy columns closing in on Kontum from three directions were bottled up along Highway 14 Monday*, by sporadic actkm in the Pleiku Pass, leading to Pleiku City. (AP Wirephoto)</p>
        <p>VSA Bu^ Committee's Opposifion</p>
        <p>WASHINGTON (AP) - The U.S. Information Agaicy has survived a Senate committees effort to cut spending for propaganda films, broadcasting and pamphlets by 25 per cent.</p>
        <p>The 57-15 vote Monday to restore the money to the USIA budget ended lengthy debate on the propriety of the agencys propaganda role.</p>
        <p>As that fight ended, the stage was set for another long debate on whether Ctongress should cut off funds for the Indochina war.</p>
        <p>Sen. John Stennis, D-Miss., offered an amendment late Monday to kill a provision denying money for U.S. military operations in Indochina after Dec. 31.</p>
        <p>By restoring $45 million to the USIA authorization bill, the Senate overturned cuts made by the Foreign Relations Committee and</p>
        <p>pushed the spending ceiling up to $200 million for the three propaganda activities.</p>
        <p>As our opposition steps up its eff(His to influence the world, the need for an effective information program on our part is infinitely greater, said Sen. John Tower, R-Tex.</p>
        <p>'Ihat was the essence of the speeches of several senators in favixr of the amendment offered by Sen. Gale McGee, D*Wyo., to restore the money.</p>
        <p>Opponents argued that the cut was a test of principle because President Nixon had ordered the USIA, on grounds of executive privilege, to withhold planning documents from the committee.</p>
        <p>The decision to withhold the information lays the groundwork for a dangerous precedent," said Foreign Relations Committee Chairman J.W. Fulbright, D-Ark</p>
        <p>ECU To Opn Nationwide Training Plan</p>
        <p>By carolYyER Reflector Stoff Writer</p>
        <p>Hines is a Winterville</p>
        <p>Details of a comprdiensive natkmvride training program to (XMnbat alcoholism in industry were annoynceti yesterday by</p>
        <p>dunded under  legislation</p>
        <p>designed to combat the growing U.S.  alcohol  problem.</p>
        <p>Congressman Jones said.</p>
        <p>direcyor. The day-to-day functioning of the program wiH'bc the responsibility of Brayom Anderson.</p>
        <p>departmentthe Winterville tribe of Red Mm and the Winterville FWA Church.</p>
        <p>Anderson, 36-year-oId brick hnason, attended the Greenville and Winterville Schools.</p>
        <p>He is a member (4 the NCAAP and the Conley High Sdiool Advisory Council.</p>
        <p>( Hines was elected for a fhree-year term on the board.</p>
        <p>in Newto^ have been mafl 1&amp;gt;acS iiluthority. He that the cominission should aUe to advertise the^units for bids by the flrst of Jtme.</p>
        <p>Mrs. Baliye C, Streeter, director of tenant affairs, reported that all 65 units in N. C. 22-1 (Meadowbrook) were, oc-^ (Ceethmed oe pagf 8)</p>
        <p>East Carolina University will</p>
        <p>and East Carolina University coordination of the training Program for North Carolina.</p>
        <p>profptun. The training institute4^eraH development and design will be kaowB as the NatioeaL ef &amp;gt;^curriculum will be done by Occupational Alcoholism Hanry Cin^t^lc^;  df</p>
        <p>Training Institute.  Mental Health Training Institute</p>
        <p>Four key men are 0. the  Ufverrty.</p>
        <p>Carolina University staff. Program director Byrd point-WUliam Byrd, director of conr ed out that this program is ex-tinuing education for the Scho&amp;lt;d ' pected to result in the establish-of Allied Health and Social ment programs and policies Professkms, will be |ogram which will enaMe em{doyers to</p>
        <p>'  '  '  I</p>
        <p>.  -  .        t  ^</p>
        <p>Identify alcohol ixroblems early "in the wOTk force. Early iden-tificaticm and referral will put the employee in contact with community counseling services</p>
        <p>nie chief Pk^am coaaultant  ,</p>
        <p>CT  ilinliliaiii*  anJ  ran.h  maliiialed;</p>
        <p>to accept help.</p>
        <p>president Dr. led W. Jenldns,</p>
        <p>The $295,000 program, ponsorteiil; by the National Institute of Alcob(d Abuse and Alcoholism (NIAAA) could ihiRke East Carolina University a national center fw the training (rf occiqMtional alcoholic con-sidtants. Dr. Jenkins said. It is the tir&amp;gt;t project of its type to be</p>
        <p>The emidoyer beciTmes an active ally of the helping agencies m thC'-^eooesf-and allows the omfdoyee to continue on the' job while receiving medical and couns^ing assistance, he said.</p>
        <p>A 19-day training conference will begin June 11 at a North Carolina site yet to be an-</p>
        <p>nounced. Two participants from each state in the United States will attend. They wUl be fulltime employees in their respective states, one working witii business'' and industry and &amp;gt;oMMkMdlli^-HMate and local governinent' employment systems.</p>
        <p>Illustrating the scope of the proUem, Dr. Jenkins said that</p>
        <p>teceiit fIflW report on Akobd and Health r^orted that alcohdiam is coMing industry between $ and $10 billion a year,, not conaidertBg the human saffering involved, this pioneerings effort must reduce this tragic ton, he said.</p>
        <pb facs="00091594_0002" />
        <p>ernevee. N.C.I^Mtiagr. May S. if</p>
        <p>fch To fital Health</p>
        <p>PIft</p>
        <p>Month At Durham Meet</p>
        <p>Candidate At Pink Hill</p>
        <p>0|iMt Stasavidi, directcr of at!^&amp;lt;tUtil~ tt East Carolina UiifvMifty,-Im been named head el Mental Health Month by Pitt County Mental Health Asabdatieo, accordmf to David B. Raid, Jr., president.</p>
        <p>^annual obeervancc in May is part of National Mental Health Mmith being conducted throughout tbotnation by mental health asaociations.</p>
        <p>Staaavich came to Greenville</p>
        <p>in 196S frrnn Lenoir Rhyne OoUege as the Pirates head football coadi. A, year later he assumed the dual role of directfNT of athletics and football eoadi. In Cjecember of 1970 he relinquished his football duties to devote full Ome to directing an athletic ix)gram.</p>
        <p>Stasayich was honored in 1999 and 1964 as National Coach of the Year and was named District* Coach of the Year fve times. He</p>
        <p>is a member of ttie Hdms Hail of Fame, and was, inducted into North Carolina Sports HaU of Fame in December,</p>
        <p>A native of Georgetown, HI., he is married to the former Hatan Warlick of Hicfcory and they have three grown children, Rebecca Ann, Mary Helen and Walter Lewis.</p>
        <p>In accepting the appointment Stasavi&amp;lt;^ said: I am hiqip^ to serve in this capacity, for I consider mental health the most</p>
        <p>Hearing Is Set In Winterville</p>
        <p>WINTERVILLE - The Winterville Town Board Monday night set May 15 as the date for a public hearing to discuss rezoning of the Ed Fleming property from residential to general business.</p>
        <p>The property, located on the northeastern comer of the N.C. 11 and Boyd Street intersection, is listed ih the tax books as lots 11 through 17 on tax map 20B.</p>
        <p>The rezoning, recommended by the Winterville Planning and Zoning Board, will be done so that a radio and electronics shop can be established on the property.</p>
        <p>The hearing will be held at 8 p.m. in the municipal building.</p>
        <p>The tax lien sale for 1971 delinquent taxes will be held June 12 at 12 noon in front of the municipal building.</p>
        <p>of the bond issue. ^ </p>
        <p>It was reported that water, sewer and electric lines have been installed in Rbinson Heights No. 2. To date, 10 building permits have been issued for that subdivision. Electric lines have been installed at Shamrock Terrace.</p>
        <p>Mayor Walter Dail was authorized to contact Rivers and Associates, Inc., to obtain the cost of a pre-treatment plant at the Winterville Machine Works.</p>
        <p>The board accepted the town election returns from Rommie Mallison, registrar.</p>
        <p>n.ARENCE 8TA8AVICH</p>
        <p>Pitt Student Is Elected To Post</p>
        <p>The property will be advertised for sale in the local newspapers on May 15, 22, and June 5.</p>
        <p>J. P. Corey and Cecil Worthington, representing the safety council of the Winterville Chamber of Commerce, petitioned the town board about establishing crosswalks for pedestrians in the town. They also asked that additional parking spaces be added in certain areas of the town.</p>
        <p>The matter was taken under advisement by the board.</p>
        <p>liiie town board went on record as favoring the clean water bond. The town has two projects under consideration which would be helped by the passing</p>
        <p>ELIZABETH CITY - Ruby Jean Murchison, a junior at Elizabeth City State University, was elected treasurer of the Student Government Association /it the school last week.</p>
        <p>Miss Murchison is the daughter of Mr. and Mrs. James Redmond of Rt. 5, Greenville. She is a graduate of Stokes-Pactolus High School.</p>
        <p>Miss Murchison is currently serving as treasurer of Delta Sigma Theta and treasurer of Thaila Sororisis, honorary fraternities.</p>
        <p>She was named to the deans list for this marking period at the universitv.</p>
        <p>local store windows painted bv a client from Cherry Hospital, Uie</p>
        <p>"briefs to be carried by television station WNCT during May, and the movie "Only Human which will be telecast ovet* Channel 9, WNCT, at 12 noon on May 21.</p>
        <p>Open Coffee House</p>
        <p>Bike Beat Car InMinistry Program</p>
        <p>Rush-Hour Race</p>
        <p>aNCINNATI, Ohio (AP) - A ten-speed bicycle whipped a 1959 model car Monday in a 4/-mile race at rush hour Monday to publicize Bikecology Week.</p>
        <p>Les Gesell, a graduate student in physics at the University of Cincinnati, finished two minutes ahead of Jerry Bone-cutter, an industrial supervisor.</p>
        <p>Gesell said he won the trek from the university to the Northside area because he was able to move through stalled</p>
        <p>flights.</p>
        <p>Initial service of a proposed Christian Coffee House ministry in Greenville was launched Saturday night, with Ricky Mill, district supervisor of Campus Crusade for Christ, as guest speaker.</p>
        <p>The Music Factory, on East 14th Street, was site of the rally, with music, testimonies, and Christian witness supplementing the principal message of Ricky Mill.</p>
        <p>Among the active participants on the inter-faith program at the , first rally were a group from the Black Jack Free Will Baptist Church, Wayne and Ruth West from Flymouth,BA &amp;gt; Barney Cline of Winston-Salem.</p>
        <p>Other groups will be included in succeeding programs.</p>
        <p>Main emphasis of the messages was the motivation that Jesus Christ has givm to persons whose lives have been changed by the Christian commitment.</p>
        <p>Participants in the Christian Youth rally noted the relaxed, informal, and happy atmosphere in the meeting. Light refreshments ware served during the evening.</p>
        <p>The event was sponsored by Christian student grouj; from East Carolina University, augmented by concerned kjmen^ and minkrte^ Greenville area.</p>
        <p>ITS UP TO</p>
        <p>DURHAM-Howard G. Dawkh^. direeter of tfae Bastera CkroUna Shdtifwl Worfcshop and Rehabilltiation Center, GreenvUIe, Is partklpating in the community programs for the meidally retard, being hMd here this week.</p>
        <p>Sponsored by the Mentally Retarded Training Institute of the University/Of Ndrdi Caixdina at Chapel HUl, the workshop is being bdd for persoi invdved in mentally retarded programs in the southeastern United l^tes.</p>
        <p>"Speaking before the group this afternoon, Dawkins 'explained the operation of Eastern Carolina Workshop.</p>
        <p>"The purpose of this workshop is to provide personnd services and facilities for evaluation and training of the mentally retarded and physically handicapped persons to enat^ them to perform useful and renum-erative work ii^ch shall include, but not be limited to the establishment, maintenance and operations of a facility ^ the  mentally  retarded,.</p>
        <p>Dawkins said.</p>
        <p>Dawkins, Is to facilitate the economic and social adjnsbneol of the mentally and physically handicapped individuals IB years of age or older whose are not bMng met by a^Mtoig tociUties.</p>
        <p>Dawkins discussed the procedures of the evaluation program and the acceptance of new clients. *</p>
        <p>The curriculum at the workshop includes: furniture refinishing, chair caning, picture framing, sub contract and assembly; social adjustment; academics; carpentry; com-merical housekeeping; welding; home nursing; work activity; and brick masonry.</p>
        <p>**Tbe capacity oi our facility is 129. ^e have 68 cUents at the present time, Dawkins said. "The clients we train are the mentally reUrded, cerebral palsy, deaf, physical and notkmally handicapped.</p>
        <p>Mack Howard, Republican First District Congressional omdidate, was guest speaker at the annual Loyalty Day ceremonies sponsored by Pink Hill Veterans of Foreign War Post Number 9814 on Sunday.</p>
        <p>Howard, a veteran of Viet Mito and a member of the Greenville VFW Post, stated *T think H is fitting that this Loyalty Day is sponsored by such a tremendous organisation as the Veterans of Foreign Wars. Perhaps more than any other organisation in our society today, the members of the VFW can stand tall and uy God Btees America becaufee they are t^ men who have put their lives on the line for her.</p>
        <p>The Republican candidate, who resigned from the Army in January to run for Congress, said of the VFW members "they are the men who went to the trenches in 1919.... the men who crushed the Nazis and the</p>
        <p>l8paBase...aBd mere rsoantly thts are iw mm who have knawn fta sound of battle in the jHB0ea and rira pnddMs of VMatoB.</p>
        <p>"Whether we agree wflh the political grindpie for whkk they to0it er net. Howard said, "We nmM be proud of their effort, prehd of their eene and fathers, mid proud of fiwm as Americaas.*</p>
        <p>J    m</p>
        <p>nvHw nwyu # JMBMpni</p>
        <p>raMiSni</p>
        <p>WmImwmIPNMmm</p>
        <p>  dMWOM aBhaUuk FAB-</p>
        <p>TBTB* rwmm a si f Mk U Bslps MB ema u^ imme loofsr. firaar, ^aaBkw. f)</p>
        <p>to</p>
        <p>Zas MORTGAGE</p>
        <p>$1,500to</p>
        <p>$5,000</p>
        <p>NO COMMISSION  NO POINTS</p>
        <p> Phone-Write or Come in Now! </p>
        <p>A majo|^^ purpose of the -' workshop,' according to</p>
        <p>Tt^ is felt that we are developing one of the best evaluation programs in our area, Dawkins added.</p>
        <p>The program will end Friday with an evaluation of the training institute.</p>
        <p>CLAIM ERRORS WASHINGTON (AP) -Lawyers for Lt. William Calley have filed suit with the Army Court of Military Review charging fiie Army made 32 errors in convicting Galley d the 1988 My Lai killings.</p>
        <p>LIBERTY</p>
        <p>FINANCIAL PLANNING. INC.r.</p>
        <p>310 EVANS ST.-^-GR. FLOORPHONE: 752-6181 QraenvHle, North CaroUna 27834</p>
        <p>Opin  6.  Frktoy  til  7  l*M  '</p>
        <p>t35-72</p>
        <p>critical aspect of total health today. Society has become more complex, making communication very vital to getting along. In recent years it has been learned an individual can be mratally ill, just as illness effects other functions of the human body. It behooves each of us to give this problem our attention by attacking it in a positive way. We need to suppoi  our Mehtal Health Association in' Pitt County, continuing to keep it one of the best chapters in the State.</p>
        <p>Stasavich said he encourages the public to give thought to the 20 million victims of mental illness in the United States when they view the scenes in</p>
        <p>Wf BIHI ItsiM nil Not incrMM Local Or Stato Taxaa</p>
        <p>Vota Censura</p>
        <p>Of 4 Offlcars</p>
        <p>WALLA WALLA, Wash. (AP)  The Student Congress of Whitman Ck)llege voted Monday to censure four student body officers vbo last week demanded that President Nixon return a football jersey presented to him by the schools football team last September.</p>
        <p>The censure motion, which cited the officers for "gross misrepresentation of the student body in a knowing and secretive manner, was approved in a 16-5 vote.</p>
        <p>The congr rejected a motion to censure the football team for giving the President its jersey No. 1 when he stopi^ in Walla Walla on route to a meeting with Japans Emperor Hirohito in Alaska.</p>
        <p>The student body officerg said last week they wanted the jersey back to {x)te8t the Prea-idrats "recent expansion of the war in Vietnam.</p>
        <p>IfvoiiVe</p>
        <p>oottohavea</p>
        <p>newcac</p>
        <p>f</p>
        <p>weVegot</p>
        <p>what youVe got</p>
        <p>to have toset it.</p>
        <p>A Wachovia Auto Loan. Fast. Convoniont. And easy to live with. Ask your deaier to arrange it. Or you can arrange it yourself. Simply by stopping in and taiking to one of the people listed below.</p>
        <p>'OWochovia/Greenvffe</p>
        <p>Wachovia Bank li Trust* N.A.</p>
        <p>AAeadowbrook/Harold Staton  University/Walter Jones, Jr.  Washington  A  Fifth  St./lorn Allen</p>
        <p>Pitt naza/jullus Budacz  West End/Blll Hudson</p>
        <p>\</p>
        <p>J .</p>
        <pb facs="00091594_0003" />
        <p>V</p>
        <p>Serve Up An Election Year Siete Conductor .Reacted Family Colliects Frogs</p>
        <p>To CKd VBehavior Of All Shapes,. Sizes</p>
        <p>By RICH OPPEL AsMctetc4 PrcM Writer TALLAHAS^. Fla. (AP) Want to aerve  goodpoittio cal stew? Itll be eMy. wtth Myrna Shevint new Democratic Caucus Cookbook, which has recipes from political personalities radi as Sena. AHen J. EUendbr and Stpart Symiiigton and others fixun wives of political figures such as Muriel Humphrey and Cornelia Wallace.</p>
        <p>Mrs. Shevin, an opera singer, mother of three and ttte wife of Florida Atty. Gen. Robert She-vin, said ^ hatched the cookbook idea last summer, and ^ the cooperation of the Democratic Womens* dubs oi Fknri-da.</p>
        <p>I sent out requests to about 700 personsgovernors, senators, congressmen, "-mayors, state officials and party ttffi-cials, she said. We got about 200 recipes back.</p>
        <p>The book goes to the printers in June, and Mrs. Shevin hopes to begin sales at the Democratic National Convention. About 250 {Miges long, it will sell for $5.50. It is illustrated with&amp;lt; ink sketches of scenes from the Florida (M*esidential primary by Fred Albert</p>
        <p>m</p>
        <p>POLITICAL SOUFFLE Mn. Rirfwrt Shevin, wife of Floridas attorney general at left spoons up a little cheese souffle for Floridas first lady, Mrs. Doima Loo Askew, in a recipe check for a cotdcbook Mrs. Shevin is compiling for the Democratic National Conventimt.</p>
        <p>By Abigail Van Buran</p>
        <p>! liNt ar CMwn suiwia. v. Maw sias. skj</p>
        <p>' DEAR ABBY: Reoently, durlnf. a syniihaoy coocert there was a child in the aadteace who laughed, spoiw loudly and behaved hoisterouiMy onoe. but several tfanes during tbe perfof***^</p>
        <p>The parents did not have the asase, or ooositeation for others, to land the cMM ftem the auatorium after the first offense, tho many in the sndieace were visibly irritated.</p>
        <p>, Finally,, the conductor himaolf turned on fiie podium and looked into the audience with dlabelief!</p>
        <p>I have had the same cierlenoe daring church sermons with crytiM babiee. despite the fact that the cfanrefa provides nursery fadfities.</p>
        <p>Condnctors, ministers, and speakers spend hours in pteparatiOB, gad such intarruptiona spoil the mood of the</p>
        <p>garniplafady</p>
        <p>When will selfish parents realiae that they should not bring elilldren to affairs of a serimia nature imtU they are old enough to be an aceeptahlt part of the audience?</p>
        <p>IRRITATED IN CAMP HILL, PA.</p>
        <p>Mrs. Shevin said proceeds would be distributed among the Democratic womens organizations in Florida, with some going to the national com-</p>
        <p>Homemaker*s Haven</p>
        <p>By Evelyn Spangler</p>
        <p>Pitt Home Agent</p>
        <p>SPRUCE UP THE HEARTH FOR SPRING</p>
        <p>It happens every year. Warmer weather comes and the call of the outdoors is irresistible. Chances are the temperature will be well on the sunny side when you notice the uncleaned fireplace that kept things cosy this past winter.</p>
        <p>Spread newspapers the hearth and take out those chunks of logs. Scoop ashes into bags and discard. Finish prefiminaries by vacuuming any remaining a^ dust.</p>
        <p>Give fireidace brick and hearth a good scrubbing with thick suds applied with a stiff brash. Rinse and let dry. If possible, take the screen and fireplace tools outside for a thorough cleaning. Use a scrub brash and plenty of lather to shine things" up. Rinse with a hose, or dip the tools in a pail of water and pour the rest over the screen. This could be a good cleamip project for children.</p>
        <p>If the tools are made of solid brass they will benefit from buffing with metal polish. Steel and wrought iron dont need any extra treatment, but might be wiped with a cloth slightly dampened with v^etable oil.</p>
        <p>After cleaning, select an interesting large container to fill with seasonal fresh flowers and leaves or arrange with artificial varieties. Fw examfde, an early American theme can be carried out with a brass or cx^per coal scuttle, medium-sized milk can or an old pickling crock. A contemporary flare can be achieved with a wicker basket or by covering a large potato chip can or plastic waste basket with a mod design adhesive backed vinyl. A large, but squatty vase is suitaUe with traditional decor and the Mediterranean motif is carried out with scrolled wrou^t iron containm.</p>
        <p>When using cut flowers and leaf branches, they and the water have to be replaced from time to time and the cmtainer washed. Besides being e^ier to change and clean, a glass or metal vase to hold the waterand arrangement may be necessary to use with some decorative containers that have open work or are not waterproof. In any event, use florists tape, clay or frogs to secure the arrangement.</p>
        <p>Place the arrangement on the hearth in front of the fir^lace, to one side, or even in the fireplace iteelf, replacing the usual log grate. Su^ flowering brings the outdoors in and adds a colorful freshness to a room.</p>
        <p>A STAIN REMOVAL REFERENCE GUIDE</p>
        <p>Know the best stain remover in your home? Its your favorite soap or detergoit. Best because its always on hand, inexpensive and safe to use. Next time you find a roblem stain on a washable fabric, try the fdlowing metKxls:</p>
        <p>Blood, meat juices' soak in cold water about 30 minutes. If ^eteur pemama^ worii aaap^ or deteiiet uite-t. taiir i^ launder as usual.</p>
        <p>Chocolate, &amp;lt; gravy, lipstickwork paste of soap or detergent into stain, launder as usual; if grease remains, sponge with cleaning fluid.</p>
        <p>Fabric softener stainrub with bar soap and launder as usual.</p>
        <p>Fresh fruits and juicesprewash in cold water, thi hot. Bleach if necessary.</p>
        <p>Mildewrub paste of soap or detergent into stain, launder as usual. If stains remain, sfuinkle with salt and lemon juice and dry several hours in direct sun.</p>
        <p>Milk, egg, ice creamsoak in cold water, rub paste of soap or</p>
        <p>mittee.</p>
        <p>. Here are a few recipes from the same kitchens that swe George Wallace, Mayor John Lindsay and Sen. Eklmund Muskier</p>
        <p>CORNEUA WALLACES SOUTHERN PECAN PIE 4 cup granulated sugar 1 cup li^t corn sjhnip Seggs</p>
        <p>4 tablespoons melted butter 1 teaspoon vanilla 1 cup pecans, chopped 1 pie shell, uncooked Cook sugar and syrup wtil mixture thickens at 228 "^degrees. Beat eggs well, add melted butter to syrup mixtures and add hot syrup slowly to beaten eggs. Add vanilla and nuts. Pour into unbaked pie shell. Bake in 450-degree oven for 10 minutes, then reduce heat to 300 and bake for addi fional 35 minutes. Serves six.</p>
        <p>5 whole peppercorns Basil, thyme and parley</p>
        <p>6 white or yellow turnips, peeled and sliced</p>
        <p>8 niedium carrots, scraped 4 parsnips, peeled if you like 10 small oni(ms, peeled 8 medium potatoes, peeled 1 green cabbage, cored, cut in wedges  f</p>
        <p>Place beef in kettle, cover pan. adding spices but no salt. Bring to a boil; skim off fat. Cover; simmer 3-4 hours. Add all vegetables but cabbage, cover pan. Cook 20 minutes. Add cabbage; cook until ail vegetables are tender, about 25 minutes.</p>
        <p>Place beef on hot platter, sur rounded by vegetables.</p>
        <p>DEAR IRRITATBD: Never.</p>
        <p>DEAR ABBY: I heve tide terrible complex about being emell boaomed. Where did I get tliie complex in the first piece? From my huibend. theUe wbqro.&amp;lt;</p>
        <p>Hes ell the time loddnc et the pictures of thoee big boeomy girla in tbe megexinea. And whenever e stacked girl walks 1^, he precticelly twiati Ida neck off kxdting. I feel IRe crawling into a hide aomewhere, or hitting him for making me feel so inferior.</p>
        <p>Would a smell girt like me feel better if she had her bosoms surgically enlarged? Rs erosaed my mind a few times. How long would it take? I might want to surprise my husband.  CHEATED</p>
        <p>DEAR CHEATED: I dent recMamead sarpristag year hnslMiad. If yoarc ceasidering that type of sargery, talk tt ever with Ua first. Seaw aca ke te leek, bat they prefer their wives as Netare aede ea.</p>
        <p>MARY LINDSAYS BROWNIES</p>
        <p>2 eggs</p>
        <p>2 squares bitter chocolate ^4 cup sugar ' I cup light brown sugar 4 cup butter ' 2 cup chopped walnuts &amp;gt;2 teaspoon vanilla 1 cup flour 1 pinch salt</p>
        <p>Beat eggs; gradually add sugars. Melt butter and chocolate together and let cool. Add to egg mixture. Add vanilla, flour, salt and nuts. Place in a greased 9 by 9 inch square pan and bake in a preheated 325-de-gree oven for 35 minutes. Let cool; cut into squares.</p>
        <p>Officers Named By Auxiliary Thursday Night</p>
        <p>DEAR ABBY: Someone aaked why so many peale walk into a restaurant and sit at a tnUe with dirty disbss when clean tables are availsble. You suggested that it might be the coziness of clutter.</p>
        <p>You were too polite, Abby. You could have said because they feel miHv at home in messy surroundings. Or perhaps, they hi^ to snitch a tip left fw the waitress by the previous diner.</p>
        <p>By so doing, you possibly would chave shamed a few people Old of their habit.</p>
        <p>"JUST SUGGESTING IN SJOi DIEGO</p>
        <p>FORT SMITH, Ark. (AP) -If the fairy tale of the princ^ and ibie frog were .true, the princess could wear out her mouth trying to turn MaUe Winters* frogs into princes. Mrs. Winters has 3,124 of thm.</p>
        <p>"Were just s frog-buying family, she said, "Ive been married for neariy 46 years to a wonderful, fi^-buying husband.</p>
        <p>Her hustend, Quinn, isnt the only frog-buy^- in jhe Winters clan. Their son, Lcloy, also often purchases additions to the famUy coUections.</p>
        <p>The frogs come in all sizes and shapes. One weighs 70 pounds; one is only a dot.</p>
        <p>They are made from agate, turquoise, jade, onyx, opal, obi-sendia, ivory, candy, tallow, straw, silver, bronze, gold, pewter, brass, wood, shell, iron, glass, rabber, china, mother of pearl, even volcano ash.</p>
        <p>"I also collect any pictures, books, jokes, poetca^ and greeting cards that are about frogs, said Mrs. Winters.</p>
        <p>The collection includes frogs emblazMied on beach towels, beach bags, other towels, shopping bags and aprons.</p>
        <p>Mrs! Winters, 64, said the collecting of frogs began in 1936 when she and her daughter, Louise, then four years old, were in Mexico.</p>
        <p>"She put a coin in a gum machine and got a plastic frog as a prize, Mrs. Winters said. "She gave it to me."</p>
        <p>More than 600 of the frogs in her collection come from Mexico, and 96 are stuffed-type frogs</p>
        <p>Friends in six countries have sent frogs to her. Mrs. Winters said.</p>
        <p>The collection occupies a dozen show cases and three rooms of the Winters house. There are 84 frog-shaped banks, 72 frogshaped salt and pepper shakers, a frog-shaped straw end table, frog-shaped egg-hold-</p>
        <p>en, jewdry, you name it.</p>
        <p>Theres even a nine-piece froggy orchestra depicted playing "Bullfrog Bluet. ^</p>
        <p>Mrs. Winters knowld^ of frogs does not end with the stuffed or manufactured variety There .are, she said, 25 species d real frogs ranging in size from less than an inch to about one-yard.</p>
        <p>WCTU Meeting Set For Thursday</p>
        <p>Mrs. Eula Andrews will give the program Thursday night at the meetihg of the Womans (Ihristian Temperance Union.</p>
        <p>The dutch dinner meeting will begin at 7:30 p.m. and will be held at Jerrys Cafeteria, located on EV^ans Street.</p>
        <p>"Safe Guards for the Home will be the program topic and Mrs. Gladys Scoville will give the ^votional on Roots of Oiaracter.</p>
        <p>All members are urged to be present.</p>
        <p>Parents ought to limit the amount of between-meal snacks so a child will be ready to at mealtime</p>
        <p>LOSE WEIGHT NOW</p>
        <p>VICALTCIN can trim you down naturally. No special axtreis-ing, no starvation diafs, no dangerous drugs. VICALTEIN, a pleasant tasting tablet utilizes a balanced formula of Protein to curb your appetite as well as furnish Vitamins, Minerals and Carbohydratas to keep you fteiing fit. Use common sense, a natural diat is</p>
        <p>best for you. VICALTEIN pro-it at</p>
        <p>Vidas a natural protein diet an average daily cost of only 31c. Oevalopad and used by physicians for over IS years. If you don't lose weight, you dont lose your money. We refund it.</p>
        <p>Eckerds Drugs</p>
        <p>JANE MUSKIES NEW ENGLAND DINNER 4-5 pound corned brisket of beef</p>
        <p>Cold water to cover &amp;gt;2 bay leaf</p>
        <p>New officers were named at the meeting of the Ladies Auxiliary of VFW held niursday evening at the Post Home.</p>
        <p>Mrs. Merle Austin was named president and other officers are: Senior . Vice President, Mrs. Carrie West; Junior Vice President, Mrs. Ruth Evans; Treasurer, Mrs. Margaret Brown; Chaplain, Mrs. Myrtle Meeks, Guard, Mrs. Rose Lee Williams; Conductress, Mrs. Margaret Joyner; and Trustee, Mrs. Genes Boyd.</p>
        <p>The installation of these new officers will be held at the Post Home on May 18.</p>
        <p>During a business session conducted by Mrs. Meeks, president, plans were completed to join the Post in a program of Lit-A-Bike to be held May 21. This {M*ogram will provide a reflector tape for safety to all</p>
        <p>DEAR JUST: Ym eold be right. It oever occarred te M. Aad Vm sare It has aever aeoured to ethers vrim weald aever coaslder dolag sach a lewdewa tidag. Bat ID het after this hiU prtet. a let ef Ahhy readers wifi iMwer agala sU at a aMSsy tahle hi a lestaaraat.</p>
        <p>PraMeau? Traat Ahhy. Far a perseaal repfy, write to ABBY, BOX mm, L. A.. CAUF.  and eMieae a staaiped. addrei ed eaveiepe.</p>
        <p>persons with bikes, free of charge.</p>
        <p>The auxiliary wijl contributa to the North Carolina Department toward a donation of $3,000 to Bowman-Gray Hospital for cancer research.</p>
        <p>It was decided to {xesent an American flag to a Girl Scout Troop in Greenvilles.</p>
        <p>Plans were completed to give a birthday party for veterans at</p>
        <p>the VA HokpitaT, Fayetteville. A delegation from tbe Post and auxiliary will attend.</p>
        <p>Mrs. Abby Williams was welcomed as a new member.</p>
        <p>LAUTARES JEWELERS</p>
        <p>Diamond Setting, Remounting And Repairs Done On The Premises</p>
        <p>Greenville's Only Registered Jeweler</p>
        <p>AMCfriCAN GfM SOCKTV</p>
        <p>Lemon Custard Pies Dieners Bakery</p>
        <p>IIS Dickinson Avt.</p>
        <p>detergit into stain, launder as usual.</p>
        <p>Paintsoak in turpentine or paint remover; rufo paste of soap or detergent into stain, launder as usual.</p>
        <p>Rememfoer that stains are easier to remove when they are fresh. Try to treat them promptly. The longer stains are left on fabrics, the more difficult they are to remove. In some instances, spots will remain regardless of the procedure used.</p>
        <p>DOWNTOWN PITT PLAZA</p>
        <p>Best Siiggestion For Mother's Day</p>
        <p>See Our Large</p>
        <p>&amp;gt;</p>
        <p>Selection Today!</p>
        <p>WEDNESDAY'S</p>
        <p>SPECIAL</p>
        <p>Yorn Dyed Jacquard 100%</p>
        <p>I Polyester Deible Kilts |</p>
        <p>full pieces off our regular $4.99 yd.</p>
        <p>These are material .</p>
        <p>SPECIAL</p>
        <p>77</p>
        <p>I</p>
        <p>YARD</p>
        <p>Fresh Bedding Plants Arriving Daily!</p>
        <p>.V</p>
        <p>Petunia^ Salvia/ Pansy, Sweet Williams, Verbena, Blue Mink Ageiium, Sultani, Lantana, Begonia, Coleus, Pepper and Tomato Plants, Boston Ferns.</p>
        <p>g</p>
        <p>Dress Carnival</p>
        <p>JCPenney</p>
        <p>Pitt Pkn^CH-OpM ovary night 'til 9:30Charge Hi</p>
        <pb facs="00091594_0004" />
        <p>iWfiiir^i^^ MMtler. GrNsviBe. N.C.TMiiay. May 2. lf72</p>
        <p>#0fnary Systam's Arohie Tasted</p>
        <p>UTTLE</p>
        <p>ME BiOW YOUR HORN!</p>
        <p>It is noJoy to kick a man when he is down, hut the ^^(i^wal of Sen. Edmund Muskie from the pi:esidehtial primaries may again prove the need for the grueUihg presidentail primary system.</p>
        <p>The senator was his own worst enemy as^4 IH*oceeded through the various state primaries. said and did things which lost him support.</p>
        <p>Mixed Bag In Congress Race</p>
        <p>By BBYAN HAISLIP</p>
        <p>RALIEGH  This is the year of the second chance, newcomers and coalition politics on the Congressional trail.</p>
        <p>It also has the earmarks of a time when incumbents will fare, comfortably in the elections to select North Carolinas ll-member delegation.</p>
        <p>The one exception in the May 6 primary is in the Second District. There Rep. L. H. Fountain of Tarboro is in a race with Mayor Howard Lee of Chapel Hill for the Democratic nomination.</p>
        <p>Lee. the states only black candidate for Congress, has waged a vigorous campaign aimed to draw together intellectuals, blacks, and working people of both races.</p>
        <p>BRYAN  ^</p>
        <p>HAISLIP 1</p>
        <p>Even so, it would have to be classed a major upset if he should knock off Fountain, the 20-year incumbent.</p>
        <p>Only one other present Congressman. Rep. David Henderson in the Third District, is involved in a primary. Joseph Edwards of Mount Olive, a first-time runner, is on the ballot with Henderson for the Democratic nomination. Henderson is regarded an easy winner.</p>
        <p>Action In Open District Three districts left open are where the action is on May 6  the Fourth, where Rep Nick Galifianakis chose to run for the U.S. Senate: the Seventh, where Rep. Alton A. Lennon, a Democrat, is retiring; and the Ninth, where Rep. Charles R. Jonas is stepping out after 20 years a Republican Congressman.</p>
        <p>Democratic races in both the faurth ^ and Seventh districts are close, and runoffs may be necessary to decide the winner.</p>
        <p>Six candidates are in the Fourth District scramble, and none has gained a clear edge. A second primary seems certain, but who will be in it remains impossible to tell. .</p>
        <p>Wake County, with the population advantage, has four in the running. They are: Charles Bullock, a business and political newcomer;</p>
        <p>who tfed unsuccessfully for Congress six years ago; Jyles Coggins, a builder and State Senator; and Archie McMillan, attorney " and forn^r legislator.</p>
        <p>rae field is rounded out by Wnse Grabarek, former ^urham mayor, and Ike Andrews of Siler City, House majority leader in the 71 legislature.</p>
        <p>With the big Wake vote split, Andrews or Grabarek</p>
        <p>may havfi.a chance to gel in a run-off.</p>
        <p>Rose Tries Again Charles Rose of Fayetteville is taking a second shot at the Seventh District seat. He challenged Lennon two years ago, but lost.</p>
        <p>Organization from his fijst try may give an advantage to Rose. His two opponents are Doran Berry, former Superior Court solicitor, and Hector McGeachy, a state senator who opted for the Congressional race after considering running for lieutenant governor and attorney general.</p>
        <p>While Rose appears the  leader, either Berry or McGeachy could force the race,jo a second round.</p>
        <p>Jim Beatty of Charlotte, a state legislator and one-time star athlete, is favored in the Democratic primary in the Ninth District. He is opposed by Jack H. Firpo, a Charlotte businessman.</p>
        <p>Republicans have primaries in the First, Seventh and Ninth districts, Three GOP Primaries In the First, Mack Howard of Greenville and J. Jordon Bonner of Hertford are matched for the nomination to oppose Rep. Walter B. Jones in the general election. Contenders in the Seventh are Jerry Scott of Whiteville and William M. Nixon of Bar-nesville. In the Ninth, James Martin of Davidson and Graem Yates of Charlotte are the contestants.</p>
        <p>Those disticts where all is quiet for the primary will see two-party action in the fall.</p>
        <p>Eric P. Little of Wilson will run for the first time as GOP nominee in the Second DiiStrict. Jack Hawke of Raleigh, defeated in a dost race in 1970, will run again as the Republican candidate in the Fourth.</p>
        <p>Other races shaping up include the Fifth, where Rep. Wilmer^ Mizell, the Republican incumbent, will face Brooks Hayes of Winston-Salem, former Arkansas Congressman; the Eighth, where Rep. Earl Ruth, Republican, will  be</p>
        <p>challenged by Richard Clark of Monroe, state legislator; the Tenth, where Rep. James T. Broyhill Republican, will run against Paul L Beck of Lenoir; and the Eleventh, where Rep. Roy Taylor. Democrat, will be opposed by James Ledbetter  of</p>
        <p>Asheville.</p>
        <p>At the same time that we have a new training program for welfare recipients  to teach them a trade, the federal government comes out with the announcement that the minimum wage will soon be raised to $2. Imagine paying a minimum of $2 per hour to get "your lawn cut   Adams (N Y.) Jefferson County Journal.</p>
        <p>The Daily Reflector</p>
        <p>INCORPORATED 209ro(anrhe Street.Greenville, N. C. 27834 EstibUshed 882 Published Monday Hirough Friday Afternoon and Sunday Morning</p>
        <p>DAVID JULIAN WHICHARD, Chairman of the Board JOILN S. WHICHARDDAVID J. WHICH ARD Publishers Second Qass Postage Paid at Greenville, N. C.</p>
        <p>SUBSCRIPTION RATES Payable in Advance Home Delivery By Carrier Motor Route Monthly t2.25</p>
        <p>127.00</p>
        <p>13.50</p>
        <p>6.75</p>
        <p>One Year Months Three Months</p>
        <p>(Prices Include, Tax By Mail except In Pitt Co. Add i percent)</p>
        <p>MEMBER OF .</p>
        <p>ASSOCIATED PRESS The .Associated Press is exclusively entitled to use for publication all news dispat-' dfis</p>
        <p>otherwise credited to this paper and also the local news published herein. All rights of publications of special dispatches here are also reserved.</p>
        <p>UNITEp PRESS INTERNATIONAL</p>
        <p>/tdvertising rptes and deadlines availablj^ upon request Member /\u4it Bureau of Circulation.</p>
        <p>ThisNte not to say that Sen. Muskie is not an abfo man. 'However the jMresitlency is the most dei^nding position on earth. The man who holds it must be hard as flint, and the primary system belpsr steel him for what is ahead; either that or it eliminates him aUmg the way.</p>
        <p>Sen. Muskie made a blunder in Manchester, New Hampshire and perhaps again in attacking Wallace voters following the florida primary. This helped ^ode his huge base of su|^rt.</p>
        <p>Astronaut Splashdown Now Calmly Accepted</p>
        <p>There was hardly a quiver of concern for the Apolla 16 astronauts last week as they returned through the atmosphere to splach down in thOv Pacific.</p>
        <p>The maneuver has been done so well so many times that we have come to accept it as routine.</p>
        <p>There is still nothing routine about a moon flight, however, and the Apollo 16 crew has brought back a cargo of priceless geological specimins which should give us further answers to our origins.</p>
        <p>The crew and their associates can take satisfaction in a job well done.</p>
        <p>Foreign Policy Tensions High</p>
        <p>sensitivities in Foggy Bottom would be little more than a footnote in history. In fact, however, the issue is far larger than Rogers.</p>
        <p>Thiis, Rogers own inner resentment of the public dominance of Kissinger is only a pale reflection of the resentment throughout the higher ranks of the State Department bureaucracy. One target of this passion is Kissingernot so much Kissinger the man but Kissinger the chosen instrument to plot and carry out Mr. Nixons ambitious foreign policies. The other target is Rogers himself, fairly or not regarded as a passive Nixon agent in the State Department who out of loyalty, refuses to battle for his own constituency.</p>
        <p>A prime example is the bitter sturggle now going on between the State and Treasury Departments for control of U.S. economic policy abroad. Secretary of the Treasury John B. Connally, a skilled and ruthless infighter, is seen by high-ranking State Department officers as filling a policy vacuum created by Risers reluctance to start a fight that would embarrass Mr. Nixon.</p>
        <p>One result of this is the prediction now bring privately voiced that State, Department operatives themselves will soon take on the fight to preserve States traditional influence over foreign policy.</p>
        <p>The idea that State is a supine bunch of cookie-pushers is inaccurate, in the words of one high official. When the worm turns, it will turn with a vengeance.</p>
        <p>The Wha House seems to be aware that resentments are rising at State and that Rogers own dilemma is acutely embarrassing. Following Mr. Nixcms trip to China, when Rogers was lett out of the single meeting with Mao Tse-tung, Mr. Nixon dispatched him to Capitol Hill to brief Congress on the Peking summit.</p>
        <p>Likewise, Rogers was the (Continued on page S)</p>
        <p>By ROWLAND EVANS and ROBERT NOVAK</p>
        <p>WASHINGTON-Sensitivities to ever-increasing ridicule of the" once-powerful State Department and its boss. Secretary of State William P. Rogers, have now risen to a danger point so alarming to foreign embassies that Rogers and the all-powerful Henry Kissinger seldom are invited together to social or diplomatic functions.</p>
        <p>A case in point were the two separate dinner parties that the Canadian embassy wisely gave in preparation for President Nixons state visit to Ottawa on April 13.</p>
        <p>The first, on March 10, was for Rogers. Kissinger was the guest of honor at a similar dinner just before both men accompanied Mr. Nixon to Canada.</p>
        <p>The, understandable reason; Rogers, denied the traditional role of t)e Presidents pre-eminent foreign policy adviser, has been so overshadowed by the glittering Kissinger for so long that he now instinctively avoids all but official en-coulfters. Most of these are eithqpiover the telephone or in the Wnite House.</p>
        <p>Likewise, Rogers, a cool, dispassionate gentleman on ihe outside with iron self-control, has conspicuously boycotted traditional Washington forums such as the annual dinners given by the Gridiron Club and the radio and television correspondents where the press roasts Washingtons high and mighty.</p>
        <p>Again, the understandable reason; Rogers has been so shellshocked by invidious Rogers Kissinger eompaf isions that he will go to almost any lengths to avoid them. In the words of sympathetic, long-time Rogers friend: Bill takes the pain with grace and forbearance on the surface, but it ties his stomach in a knot.</p>
        <p>If this tension were limited to Rogers himself, who long ago decided that loyalty to President Nixon transcended all else, the heightened</p>
        <p>Strength For Today</p>
        <p>LIFE OF THE SPIRIT</p>
        <p>The promise of (Kristian faith is not just improved life but new life. The Biblical declaration of that truth is if any man be in Christ he is a new creature (or creation) (II Corinthians 5:17). The Apostle Paul, who wrote these words, had experienced a transformation of life in almost a split second. He was the Great Persecutor one day and the next day he was starting out on a career that would cause him to stand out among the great personages of history. To the very end of his life, the Apostle Paul appeared to^fKave troubles galore. Tradition has it that</p>
        <p>Augustin^ of Hippo JuiiLaa instantaneous conversion. Dwight L. Moody, the great Evangelist, had a similar experience. For most people, however, spiritual growth is gradual. A good home, godly decent friends, wise teachersthese give us the setting in which the spiritual life grows ejid achieves.</p>
        <p>There were evanglists in the early Christian Church, and there are evangelists In the modem Christian Church. AJpst of these evangelists whom we either encounter or read about in newspaper or magazine appear to be sincere, honest and effective persons. Once in a while there is a drop-out. And what a cry goes up, about such a dropout. The word hypocrite is on hundreds, and perhaps thousands, of tongues. Some complain that they lost their Christian faith because of a hypocrite with whom they came in contact.</p>
        <p>It cannot be denied that we</p>
        <p>By JJ. KILPATRICK</p>
        <p>I-- </p>
        <p>McGovern Defense Plan</p>
        <p>Several months ago, not long before the primary in New Hampshire, Senator George McGovern called a press conference to release a 56-page statement of his views on national defense, ^ew persons were taking McGovern seriously then. The statement got a fair play in the press; it drew some editorial comment, pro and con; it faded from the news a few days hence.</p>
        <p>NcGovern went on to startle the experts in New Hamp^ire; he broke even in Florida; he swept to a solid victory in Wisconsin; and last week in Massachusetts he raced home with 52 percent of the vote. At this writing, he leads the field in terms of committed delegates. A great many persons are taking him seriously now.</p>
        <p>The Senators carefully detailed statement on an</p>
        <p>alternative national defense posture thus invites our reexamination. It represents the candidates considered thinking on an issue of great national importance. This is what McGovern would recommend if he were elected President of the United States.</p>
        <p>The Marine Corps now numbers roughly 207,000 men. McGovern would cut its strength to 140,000 by 1975, by reducing its three combat divisions to two.</p>
        <p>He would recommend that the Air Force be cut from 753,000 to 476,000. He would reduce the number of interceptors by slightly more than half. For the tim being, he would preserve the Minuteman missile system, but plans to upgrade Minuteman should be discontinued. Deployment of the Safeguard system</p>
        <p>Other Editors Say Bond Issues, Too</p>
        <p>(Goldsboro News-Argus)</p>
        <p>Overshadowed by interest in major state and local races, two important issues also will be on the ballot on primary day.</p>
        <p>North Carolinians are being asked to decide the future of proposed bond issues for a state zoological park and for assisting local communities in financing new and improved water and sewer facilities.</p>
        <p>We regard both issues as important ones and deserving public support.</p>
        <p>There was some dissatisfaction over location of the state zoological park at Purgatory, near Asheboro.</p>
        <p>As one legislator to the News-Argusr There isnt much enthusiasm for it east of Highway 301.</p>
        <p>Of course there could be only one zoo and it couldnt be located in everyones backyard.</p>
        <p>But th zoolopca^  Piu*gatory is withing driving</p>
        <p>distance of most of the people of North Carolina.  ^</p>
        <p>At the zoo every effort will be made to create as closely as possible a habitat similar to the natural environment of each animal.</p>
        <p>This is to assure happiness for the animals as well as pleasure for the visitors.</p>
        <p>A $2 million bond issue is [xroposed for the zoo.</p>
        <p>The other bond isisue is for $150 million.</p>
        <p>It will enable the state to share in the cost of local water and sewer projects.</p>
        <p>But it goes far beyond that. If the state provides 25 per cent of the cost of such projects, the availabily of federal assistance funds increases from 33 per cent to 55 per cent of totaLcosts.</p>
        <p>This means local governments have to put up only 20 per cent of the cost of such projects.</p>
        <p>Both issues deserve favwable consideration.</p>
        <p>should be halted. Prototype developmnt of the B-1 bomber also should be halted. Development of the F-15 should be ended.</p>
        <p>At a time when the Soviet Union is dramatically expanding its naval forces, a Presidait McGovern would reduce the United States Navy from 605,000 to 471,000. He would cut the fleet from roughly 700 ships to 341. He has small use for aircraft earners: He would cut their number to six. He envisions only 130escort vessels; in this \ield no further construction is required. He is doubtful that amphibious assaults ever will be required in the future; he would preserve only enough vessels to serve a single Marine expeditionary force.</p>
        <p>The Army has an authorized active-force of 942,000 men. McGovern would cut this to 648,000. He recommends a limit of ten general purpose divisons, down 25 percent from present levels. An part of its NATO commitment, the United States maintains four and one-third division in Europe; McGovern would cut this to two. He would of course withdraw all land and air Torces from Indochina. The remaining division in South Korea Should also be returned to the United States.</p>
        <p>McGovern places  the</p>
        <p>nations baseline defense budget, excluding the costs of Vietnam, at $75.5 billion in the current fiscal year. He would reduce this figure to $54.8 billion by 1975.</p>
        <p>In justification for  these</p>
        <p>drastic reductions,  the</p>
        <p>Senator makes a number of excellent points. He observes, for example, that the armed forces in 1969 were maintaining about one-fifth more colonels and captains with a total force of 3.5 million men, than there were at the peak of World War II with a force of over 12 million.  He</p>
        <p>denounces, with great justification, the scandalous waste and bungled defense programlof recent years. He _</p>
        <p>(Continued on pagk'^)</p>
        <p>A Poll For All Seasons</p>
        <p>By F. RICHARD CICCONE AsMclated Proaa Writer</p>
        <p>CHICAGO (AP)  Aootber poUtaker rang the doorbell agabi lait weekaBd.</p>
        <p>Some people are on the lists for pornographic mail or in-vitatioRS to all-expense-paid trips to Mexico to look at parking lots. I get all the pcdHakers.</p>
        <p>Ifi, are you watdiing television?</p>
        <p>Yeah.</p>
        <p>Who are you watching? Kareem Abdul Jabbar. What primaries is he entered in?</p>
        <p>Hes not in a primary. He plays professional basketball for the Milwaukee Bucks.</p>
        <p>I see. Well, Im conducting a {Mivate poll on the presidential candidates 'and the primaries.</p>
        <p>But the niinojis primary was over a month ago.</p>
        <p>Yes, I know. But our client is very interested in learning who you would have voted for if you hadnt voted for the man you did vote for,</p>
        <p>WhyT</p>
        <p>Well, sir, you see since there are so many clients, excuse me, so many cantdates, and so many primaries, its very likely that some candidates will drop out of the race and that would strengthen our clients position, especially if he could secretly reveal the results of a iH-ivate poll showing that he would have won various primaries that he lost.</p>
        <p>Oh.</p>
        <p>So, would you mind telling me who you would have voted for if you didnt vote for the man you voted for.</p>
        <p>Dont you want to know who I voted for?</p>
        <p>Its immaterial. It only matters who your second choice would be. Sometimes its better to lose in New England, the South, the Midwest and the Far West as long as you can say you were the next choice. That shows broad appeal. Whats the difference why you lost so long as you lost?</p>
        <p>I think its like sports. Its nice for managers and coaches to say they lost because of the layoff or because of the tight (Continued on page 5)</p>
        <p>40 Years Ago Today</p>
        <p>By GWYN COGHILL May 2.1932 A run-off election to settle the aldermanic race in the Third Ward was in prospect here today following the ^ fhattle of ballots at the court house yesterday when voters were given a chance to select five members to the Board of Aldermen from a wide field of candidates. The election was conducted in a quiet orderly manner and nearly five hundred persons voted during the morning hours in spite of the overcast skies threatening rain at any moment. Voting picked up sharply during the afternoon when candidates launched their last roundup of supporters in all parts of the city.</p>
        <p>'The principal speaker at the meeting of the Rotary Gub last night was J. J. White. Mr. White told of plans now underway for bringing a barrel manufaturing plant to the city and urged support of the club to make this possible.</p>
        <p>Paperwork Costs A Big Bundle</p>
        <p>By ELMER ROESSNER Paperwork is one of fcspslness largest ov^heads and may also be one of the activities most mismanaged by management. That is the gist of a recent siminar sponsored by Oxford Pen-daflex Corporation and Administrative Management magazine.</p>
        <p>Business forms apparently are among the leading viUains because of inefficient design. Almost two-thirds of the average companys business forms could be</p>
        <p>Systems, ticked off a number of figures indicating how poorly paperwork is often handled;</p>
        <p>-F A single misfile can cost the average company $68.</p>
        <p>ELMER</p>
        <p>ROESSNER</p>
        <p>F Mwe than-one-third-of most companies in-file reports are obsolete,</p>
        <p>drawer takes up to 4,500 documents  $180 a drawer or $900 per five-drawer cabinet.</p>
        <p>-F A filing cabinet that takes six square feet of floor space costs another $48 in rent a year.</p>
        <p>-F Only one-twentieth of the average offices records will ever be referred to again after three years and most could be destroyed after six</p>
        <p>'years,  ........  "  ........</p>
        <p>Roughly speaking, one third of the records in offices</p>
        <p>nothing is ever, ever, ever thrown away.</p>
        <p>imi^</p>
        <p>and that^we koep wondering why the world didnt go to pieces centuries' ago. But C:heer up. There ar a lot of bad people in the world but they are an insignificant minority compared with the good, honest, straightforward men and women we encounter daily..</p>
        <p>By Earl Doughiss</p>
        <p>-raduood. by. about one-third. Thii, in turn, would lower their cost by as much as 25 to 40 per cent. " ^</p>
        <p>Because forms make up 75 to 90 per cent of a companys Tecords, revising them would result insubstantial savings.</p>
        <p>One of the seminar palneUsts, Gloria Wilkes, vice president of Paperwork</p>
        <p>average business offices records today will never be referred to again.</p>
        <p>-F The run-of-the-mill company generates from one and 6ne-half to two cubic feet of records per employee pec. year and there are about 3,000 documents in a cubic foot.</p>
        <p>-f It costs four cents to file a document and one flle</p>
        <p>today and another one-third put in dead storage outside of the office. This would leave one-third on hand that might be heeded in operations sometime.</p>
        <p>what It must be like in government where everything is done in tripUcate, at the lea$t and</p>
        <p>Hawaii Farm Trend Follows Mainlands</p>
        <p>Hawaiian farms are bigger and worth more per acre, but fewer in number, according to the Department of Ckim-merce.</p>
        <p>.The average farm was 484.1 acres with a $204.82 per acre vjilue in 1964. Five years later the average farm had grown to 528.2 acres with a $296.82 per acre value. The number of farms declined from 4,864 pm</p>
        <p>A little over znillion acres are being cultivated in Hawaii. And more than 60 per cent of the acreage is operated by corporations. Only about 18 per cent is "or</p>
        <p>farm families; 16 per cent by partnerships; . and the -balance by institutions, cooperatives^</p>
        <pb facs="00091594_0005" />
        <p>1W Dafly RcAeclor. GreoiviDt. N.C.Ttocaiay. May t,Angry Complaii^ts Are Sounded In Housing Hearing</p>
        <p>By G. C. THELEN Jr.</p>
        <p>AwaciateJ PrcM Writer</p>
        <p>WASHINGTON (AP) - They came by the bo^, theae angry homeawnera from the na-tkmf major inner dtiea.</p>
        <p>Theif eomplaint was abnht the Federal Housing Adminis-tration and the decrepit, FHA-certified and -insured houses sold through the governments scandal-ridden inner-city lioine ownership program.</p>
        <p>Their official voice was the National Peoples Caucus, an infant amalgam of 368 grassroots organisations representing white ethnics, blacks and Spanish-speaking Americans.</p>
        <p>The whites concern was the blockbusting, deterioration and abandonment that struck their neighborhoods because of- the home ownership programs. The mfaKMrities were angry about the shoddy housing foisted on them.</p>
        <p>bouse she bought frwn u real-estate agent:</p>
        <p>**Iie took my husband to see the house on out oecaaioo. There wore people living in tt at the tim. Sinoe the tomiture was . in place and carpeting on the floor, we did not noCiee ny</p>
        <p>The only thing we noticed was we had sand waDs and a</p>
        <p>dirt floor in the basement. The real-estate agent told ns not to worry because the owners would be made to make repairs in the basement in order to receive FHA approval.</p>
        <p>T behev|d him. He called ui up and told us the basement had been taken care of and that certiflcationB bad been issued on the phsnbing, rooffaig, electricity and woodwork.</p>
        <p>We made settlement and came directly to flie house .... The basement had not been ce</p>
        <p>mented and plastered. The real estate man was notified, bid be said there was nothing he ooidd do.</p>
        <p>*T approached FHA and the mortgage company. Each said it was now my responsibUity. eveu though FHA had 'approved the house. No sooner had we moved in than thi de</p>
        <p>partment of licensee and inspections came to our bouse and listad the existing buflding-code vtolations.</p>
        <p>Crosby's Oscar Has Raturnod</p>
        <p>It all spilled forth in a bear- Stanford Bars ing romn of the Senate antitrust</p>
        <p>and monopdy subcmnmittee. The panel was opening a probe of the financial machinations responsiUe fm* scandals in New York, Philadelphia, Detroit, Chicago and St. Louisscandals the government estimates will brii^ 240,006 housing abandonments nationwide in the next few years at a cost to the FHA of $2.4 billion.</p>
        <p>Shockley Course</p>
        <p>Carmel McCrudden of Philadelphia told the subcommittee about the $9,000 FHA-certified</p>
        <p>Local Stadents</p>
        <p>On Dean's List</p>
        <p>TWO local students made the Deans L4st_at Wayne Community College, Goldsboro, during Winter Quarter.</p>
        <p>The students were Michael W. Robinson, Box 131, Winterville, watchmaking; and Linda C. King, Box 567, GreoivUle, dental hygiene.</p>
        <p>STANFORD. Calif. (AP) -Dr. William Shockley has been refused authority to teach a course at Stanford University on research methods involved in 1^ theory that blacks are less intelligent than whites.</p>
        <p>A special faculty committee had recommended 3 to 2 that Shoddey be allowed to teach a graijhiate ourse in the subject for one quarter without credit.</p>
        <p>Lincoln E. Moses, dean of graduate studies, said Monday he vetoed the course because of doubts about Shockleys objectivity and expertise in genetics. Shockley shared the 1956 Nobel Prize in physics as a coinventor of the transistor.</p>
        <p>SPOKANE, Wash. (AP) -The search for the Bing Crosby Oscar stolen from Gonzaga University a wedi has ended with th retinn of the golden</p>
        <p>stable-  ^</p>
        <p>Gomaga officials said the Oscar, sUden frmn the schods library and replaced by a three-inch statue of Mick^ Mouse, was found in the University Chapel by a priest Monday.</p>
        <p>On Friday, the universitys newspaper, the Gonzaga Bulletin, ran an inte|pview with an anonymous person who said he had masterminded and carried out the theft because I wanted to make peo|de lau^.</p>
        <p>Crosby, who won the award &amp;lt;for his perfmrnance in the .1944 film Going My Way,donated the Oscar, his gold phonograph jpecmds and other memOTabilia to the Roman (Catholic university here that he once attended.</p>
        <p>To compty with the buOdiiig code, to date I have paid $1,900 for a baserasm floor and $170 for electrical work. I still have a $1,900 phnnMng job yet to be done.</p>
        <p>Gale CSncotta talked about a bousing conspiracy she said is destroying her neighborhood on Chicagos West Side.</p>
        <p>'The first stage could be called the *red-lining^ process,</p>
        <p>Shot In Leg</p>
        <p>said Mrs. Oncotta. 'Tor some reason banks and savtogs-and-loan aOsodations refused to give mortgages or even home-imprOvement loans to homeowners in our netghborhoods. Tliey say the risk is too high.</p>
        <p>'mat thatred-lineis reaUy saying is 'seU, move out; your neighborhood to going down the drain; blades and Latinos are moving^to and its going to cost you more to stay.</p>
        <p>the pe^ bejgan to move. And the neighborhood real-estate agents left with them, leaving their once-pros-peroos neighborhood to the</p>
        <p>.falockboster and pank-pe^failer who deligid in raping communities for a faM buck and who ply file streets of the ghetto, recruiting blades and browns for the new slum-fated area.</p>
        <p>Alfiiough FHA (^wned up the market for low-money-down government-backed loans, it also opened up the market for the wheder-deder. fast-buck artists using FHA as its tool of trade, Mrs. Cincotu said. </p>
        <p>The end result is that the buyers are left with a federally inffed home containing-thbu-sands of dollars in needed repairs with which they are</p>
        <p>unable to contend. The home gage house ahfi pdd by the becomes abandoned, the roqrt- government, said Mrs. Cin-gage is bought up by the mart- cotta.</p>
        <p>ElECT</p>
        <p>JIM HUNT</p>
        <p>LIEUTEWUIT GOVERMfR</p>
        <p>rMoeaa sv etTTcacoMMiTTsa eoa jiMiwNti</p>
        <p>By Guerrillas</p>
        <p>Kilpatrick . . .</p>
        <p>Ciccone Col. . .</p>
        <p>(Continned from page 4)</p>
        <p>schedule, you know.</p>
        <p>Yeah, but the fans dont believe that.</p>
        <p>What fi&amp;amp;^ey believe? They believe if you lost its because you werent good enough.</p>
        <p>Im sorry, sir. My client could never accept that as a poll result. Thanks anyway. See you after the California primary.</p>
        <p>Youll still be taking primary polls after the last primary?</p>
        <p>Oh, sure. At least several candidates already have asked for samplings lowing that most people dont believe in primary results anyway.</p>
        <p>Hal Boyle b iU</p>
        <p>(Continned from page 4)</p>
        <p>is convinced that his recommendation would produce armed fcnrces both leaner and tougher than those now in being.</p>
        <p>Yet many experienced observersmen who could not possiUy be ridiculed as Cfolonel Kimps or as victims of paranoiadisagree strongly with the basic assumptions that underlie the McGovern recommendations. They see potential danger to the national security that McGovern does not see. They are concerned, in ways that McGovern is not concerned, at the Soviet Unions relentless gains in first-strike nuclear capability.</p>
        <p>Is McCfovem an extremist as to natitmal defmse? In my view, yes. And voters may discover, as the campaign rolls akxig, that in sudi other fidds as welfare reform, the gentleman from South Dakota is farther olit yt&amp;gt;</p>
        <p>Evans-Novak .</p>
        <p>(Coatipiaed from page 4) principal Nixon spokesman to (fongress after the Easter weekend Communist invasion of South Vietnam. Following his testimony on Afwil 17 to the Siate Fcn^ign Relations Committee, President Nixon, Kissinger, and White House aides (diaries E. Cols&amp;lt;m and Clark Mac Gregor all made a point of telephoning him congratulations for a masterful performance.</p>
        <p>If that failed to make the point that the White House loves Bill Rogers, Mr. Nixwi is now sending him &amp;lt;m a tour of European capitals starting May 2, to end at the summit meeting in Moscow on May 22.</p>
        <p>But in the rising sensitivities at the State Department, such flattery siinply underlines the public humiliations d the past three years.</p>
        <p>Indeed, as long as Kissinger remains Mr. Nixons fcx^ign policy alter ego, the only salvation for State is to have Kissinger take Rogers job a solutim that both hard-headed realists in the State Department and s&amp;lt;xne highly-placed Administration officials dsewhere now believe is a l(mg-8hot possibility in a second Nixon administraticm.'Ask Terry Sanford</p>
        <p>Talk direct by phone with PRESIDENTIAL CANDIDATE Terry Sanford. Ask Terry about the issues that you care aboutthe issues that face North Carolina and the nation.Call COLLECT (7D4) 332-1271</p>
        <p>between 6:30 and 9:30 tonight. Ask Terry Sanford. Hear his answers on statewide television.Live tmi^t at S-'IORM.CHANNB.d'WNCI^ CHANNEL 2 WFMY-CHANNELII-WTVD CHANNEL6-WECT CHANNEL3-WBTV CHANNEL7-WSRA</p>
        <p>Paid for by a lot of Paoplo for Terry Sanford?</p>
        <p>BELFAST (AP)  A man was shot in the legs during tbe ni^t apparently as punishment for violating Irish Republic Army guerrilla codes* British army headquarters reported today. No details were available.</p>
        <p>The incident at the town of Newry, on the border between Northern Ireland and the Irish Republic, followed a series of ^xfrfoaions Monday that killed one man. injured 15 others and -caused $36,4 jnilUon damage to a Belfast textile factory.</p>
        <p>The raid was blameid on the 'IRA. Mrs. Ann^Dickson, former member of Parliament for the area, said she believed the plant was picked out because it had brought so much peace and hai^riness to the town. This tragedy, she* said, especially if it results in layoffs, will bring the whole community down again.</p>
        <p>Sbme 20o  the 1,200 jobs the (dant provided were expected to be lost because of the dam-</p>
        <p>DRY</p>
        <p>5 SHIRTS LAUNDERED M.25</p>
        <p>n</p>
        <p>CLEANING</p>
        <p>PRICE</p>
        <p>age.</p>
        <p>-6U96N  </p>
        <p>GOOD FOR WED, THURS &amp;amp; FRI NO LIMIT</p>
        <p>1/2 MR. CLEAN 1/2</p>
        <p>DRIVE-IN Price  CLEANERS</p>
        <p>1501 DICKINSON AVE</p>
        <p>CWR Mt Accrwigriiv CiGtWNB WRWIH It SrMfMln.</p>
        <p>OUPON GOOD FOR WED, THURS A FRI</p>
        <p>NO LIMIT</p>
        <p>1/2 UNIVERSnYy2</p>
        <p>Price</p>
        <p>ONE HOUR CLEANERS</p>
        <p>Price</p>
        <p>CORNER</p>
        <p>CMtRM Mwtt Ac</p>
        <p>SL'*</p>
        <p>ctWpRwy</p>
        <p>4tti A GREENE ST.</p>
        <p>CtotMiif WtMM It It SrMfM In</p>
        <p>North Carolina cant afford an investment in the past.</p>
        <p>Lets send Nick to the Senate.</p>
        <p>Its our future.</p>
        <p>When Congressman Nick Galifianakis announced his intention to run for the United States Senate, he offered a profound reason why we should elect him to this important position.</p>
        <p>The fundamental issue in the 1972 election, he said,  is which among us is better equipped to move forward with our people during these rapidly changing times, for twentieth century problems must be met with twentieth century solutions.  *  ,</p>
        <p>Nick Galifianakis is a young man seasoned by 12 years of experience in Congress and the State Legislature. His leadership looks to the future, not the past.</p>
        <p>His 75-year old opponent has asked for just one more term because of his sniority. But North Carolina cant afford an investment in the past.</p>
        <p>If were serious about wanting seniority in the U.S. Senate, we must make an investment now in leader-</p>
        <p>,_______...f''</p>
        <p>ship that can solve our problems today and in the years ahead.</p>
        <p>We must elect Nick Galifianakis to the .S.- Seuai#.- -</p>
        <p>mm.in's SEND NICK 10 TNE SENITE</p>
        <p>mn CMMty CommniM l&amp;gt;r NkkONllfiaiMkU Lmn L. Maoro. Jr.) CtiainnM</p>
        <p>i</p>
        <pb facs="00091594_0006" />
        <p>Mtf WiiBrtir, Gryfflc. H.C,^Tmtimy, My t, tm</p>
        <p>Stock And . Market Reports</p>
        <p>RALEtH (AP) - (NCDA)  North Carolina egg markets walker.</p>
        <p>Supidies fully adequate Dtnand fair</p>
        <p>Prices paid producers and handlers for cmisuma* grade eggs in cartels deljvCTed nearby outlets:</p>
        <p>Grade A large whites': 37-38, mostly 37^-38 Meum, whites: 33-34 Small, whites: 29-32</p>
        <p>RALEIGH (AP) (NCD)-North Carolina hog markets today are mostly steady. Tops of I23.00-23.SO at Rocky Mount;</p>
        <p>22.25-23.25 at Wilson, Kinston, New Bern, Benson, and Lum-berton; 22.00-23.00 at Tarboro;</p>
        <p>22.25-22.75 at Bethelr 21:50-22.50 at Siler City and Denton; 23.00 at Salisbury; 22.75 at Greensboro. -0-Poultry</p>
        <p>United Utilities  I8V4</p>
        <p>HeuUein  51^</p>
        <p>Jeff4&amp;gt;ilot  48V4</p>
        <p>Wickes  42%</p>
        <p>Wachovia Realty  31%</p>
        <p>Ekrkerds  37%</p>
        <p>OntralSoya  29V4</p>
        <p>OVER THE COUNTERS</p>
        <p>ComUnedlns Franklin Life Hardees NCNB</p>
        <p>Piedmont Air Integon Little Mint" (Donner Homes Guardian Care Tri South First Provident</p>
        <p>31-31%</p>
        <p>21-21%</p>
        <p>33%-33%</p>
        <p>54-54%</p>
        <p>12%-ir/k</p>
        <p>13%-14</p>
        <p>11%-12V4</p>
        <p>4%-5</p>
        <p>12V4-13</p>
        <p>28%-29V4</p>
        <p>5%-6%</p>
        <p>by THE ASSOCIATED PRESS Prev.Mid-Close.day 42% 43</p>
        <p>RALEIGH (AP) (NCDA)-North Carolina poultry markets today ar^ generally steady. Supplies are fully adequate at most points. Demand is fair. Heavy hens at farm 13%-14, mostly 14. FOB plants 16;18%^ Li^t type at farm 4%-S.</p>
        <p>NEW YORK (AP) - Stock market prices declined moderately today as the downward momentum of Mondays session continued. Trading was slow.</p>
        <p>The 11:30 a.m. Dow Jones average of . 30 industrials was off 1.66 at 940.62. Declines led advances on the New York Stock Exchange by more than 5 to 3.</p>
        <p>Prices on the Big Boards most-active list included West-inghouse Electric, off 1 at 5OV4; Alaska Interstate, up 1% at 46V4; HCA Industries, up % at 11%; General Motors, off % at 78; and Coca Cola, off % at 129 V4.</p>
        <p>Following are selected 11 a.m. stock market quotations: Burroughs  167</p>
        <p>The</p>
        <p>Meeting</p>
        <p>Place</p>
        <p>TUESDAY 6:30 p.m.Greenville Toastmasters Gub meets at Three Steers, Memorial Dr.</p>
        <p>7:30 p.m.Greenville TOPS Club meets upstairs at Elm Street gym 9:00 p.m.Chapter No. 149 Order of Eastern Star 8:00  p.m.Pitt Co.</p>
        <p>Alct^olics Anonymous meets at AA Bldg., Farmville Hwy.</p>
        <p>WEDNESDAY 12 NoonMay Fellowship Day, sponsored by Church Women United, will be held at St. Pauls Episcopal C!hurch 1:00 p.m.Worship service in Pitt Memorial Hospital 1:30 p.m.Wednesday Afternoon Duplicate Bridge Gub weekly game at Elks Gub</p>
        <p>1:45 p.m.Orientation and pre-registration kindergarten IX'ogrm for 1972-73 at Agnes Fullilove School Thursday</p>
        <p>6:30 p.m.Kiwanis Gub meets</p>
        <p>6:30 p.m.American Legion Auxiliary covered-dish supper at, the Legion Home</p>
        <p>7:30 p.m.The Womans (Christian Temperance Union will hold a dutch supper meeting at Jerrys Cafeteria Friday</p>
        <p>8:00 p.m.Pitt Couty Al-Anon (^roup meets at AA Bldg., Farmville Hwy. Telephone 756-3222 or 7564)567</p>
        <p>MEET WEDNESDAY Members of the Knights of Pythagoran, sponsored by Mt. Hermon Lodge No. 35, F and AM, are requested to meet with District Deputy L. B. Anderson on Wednesday at 7:00 p.m. at Mt. Hermon Lodge.</p>
        <p>MASONIC NO-nCE There will be a stated commu-nication of Grimesland Lodge No. 475 Tuesday at 7:30 p.m. All Master Masons are invited. Dinner will be served at 7 p.m.</p>
        <p>Jaems E. Healthy Master Charles Gaskins, Secretary</p>
        <p>Am Tel t Tel Am Brand Atl Rich Beth SU Boeing Air Borden Co Burl Ind Campbell S Caro PAL Celanese Corp Ches* A Ohio Chrysler Coica G)la Dan Riv Mills Dow Chem Duke Power DuPont G East Airl Eastman Kod Firestone Rub Ford Motor Cen Elec Gen Foods Gen Mtr Cen Tel A El Ga Pacific Gerb Prod (ioodrich BF (ioodyear TAR Gulf Oil Corp IBM</p>
        <p>Int Paper Int Tel A Tel Kayser-Roth Liggett A Myers Lockh Air Loews Th Monsanto Nabisco Natl Distillers Norf A West Penney JC Pepsi Cola Radio Corp Rep Stl Reynolds Ind Seabd Ck)ast Sears Roebuck Sou Ralwy Sperry Ctorp Std. OU Calif Std Oil NJ Stevens JP Texaco Inc Textron Inc Un Carbide Uniroyal US Ply Ch US SU</p>
        <p>Va El A Pwr Wachovia Westing El Weyerhsr Winn Dixie Woolworth</p>
        <p>45% 63 31% 21% 29% 37 27V4 25V4 6J% 'l7% 33% 130 9% 91V4 23%</p>
        <p>45% 62% 31% 21% 29% 37 27</p>
        <p>25% 61% 57% 33% 129V4</p>
        <p>90% 23V4 165% 165 26% 26% 118% 117% 24% 24% 69V4 66% 29% 78% 30 45% 34% 27% 3IV4 24% 382% 383 38% 38%</p>
        <p>Judge Bars Reallocating SC$ Funds</p>
        <p>FAYETTEVILLE - U.S. Eastern District Court Judge John Larkins yesterday ordered funds earmarked by the U.S;^Soil CoMervaUon Service for the Chicod Creek watershed project in Pitt and Beaufort Counties be held for the {HPject until a suit now before the federal court is settled.</p>
        <p>Judge Larkins week before last issued a" temporary restraining order holding the finds until yesterdays hering alter it was thought the SCS would reallocate the $500,000 set aside for the channelizatkm project to fund simiiai projects:^ in other parts oi the country.</p>
        <p>The iNToject was halted in March when Judge Larkins  siding with the several environmental groups seeking to stop work on the project  said an environmental impact statement should be filed outlining the projects effects on the ecology of the area.</p>
        <p>The statement has since been filed with the Presidents Council on Environmental. Quality and Judge Larkins said be would rule on the issues in-volvd in the near future.</p>
        <p>Larkins indicated he soon issued a ruling on a motion made April 26 by the U.S. Attorneys Olffice that the environmental groups not be allowed to bring suit in the case because they are not directly injured by the project.</p>
        <p>obituaries</p>
        <p>Williams</p>
        <p>FAUOJkND - Mrs. Maude Dupree Williams, 86, died Sunday morning in Pitt 'Memorial Hospital after a lingering illness. </p>
        <p>Funeral services will be comfaicted Wednesday, 3:30 p.m. at St. J(^ Baptist Churdi with Elder Lester Moye (rfficiating. Burial will follow in the church</p>
        <p>cemetery.</p>
        <p>Bfrs. Williams was a member of Tyson Creek Primitive Baptist Church with Elder Lester Moye offciatng. Burial will follow in the church cemetery.</p>
        <p>Mrs. Williams was a member of Tyson Creek Primitive Baptist Giurch for 35 years.</p>
        <p>Surviving are her husband, Mr. Noah Williams Sr.; f&amp;lt;Mir daughters, Mrs. Rubelle Drak&amp;lt;^, Mrs. Viola Wooten and filrs. Ruby L. Johnson, all of Falkland, and Mrs. Gara M. Johnson of Greenville; four</p>
        <p>Cbmm .</p>
        <p>Mr, William H. Coburn of Rt. 6, Greenville dted at his hmne Saturday evening. He was the husband of Mrs. Delia Mooring Cobum, Fifwral arrangements are incomplete.</p>
        <p>mw----</p>
        <p>inowioMi</p>
        <p>Mr. E. Thomas MooreRdd, Jr., age 71, died Monday in DanvUle, Va.</p>
        <p>He is survived by his wife, Vera B. Moorifield; one dau^ter, Mrs. Robert L. Mills Jr. of Greenville; three brothers^ and three risters, all of Virginia.</p>
        <p>In lieu of flowers, the family requests that contributions to the Heart Fimd be made.</p>
        <p>Mourns</p>
        <p>Friend</p>
        <p>WASHINGTON (AP) - President Nixmi, in a personal and emotional tribute, today</p>
        <p>home, Noah Williams Jr. and David Williams, both of Washington, D.C., and WUlie Williams of Falkland; one stepson, Jack Jones of Bruce; a sister, Mrs. Mary Zue Gorham of Grenville; a toother. Manee Dupree of Fountain; 13 grand-children-and I2#gret--grandchildren.</p>
        <p>The body will be at Hemby Memorial Funeral Chapel in Fountain after 6 p.m. Tuesday until one hour before the funeral. Family visitatiojpyiin&amp;gt;e from 8-10 p.m. Tuesday night at the funeral chapel.</p>
        <p>67%</p>
        <p>29%</p>
        <p>78%</p>
        <p>30</p>
        <p>45%</p>
        <p>34%</p>
        <p>27%</p>
        <p>31%</p>
        <p>24%</p>
        <p>See Difference In New Lunar Rocks</p>
        <p>54%</p>
        <p>20%</p>
        <p>69%</p>
        <p>12%</p>
        <p>56</p>
        <p>54%</p>
        <p>57%</p>
        <p>17</p>
        <p>78%</p>
        <p>74%</p>
        <p>82%</p>
        <p>37%</p>
        <p>23%</p>
        <p>75</p>
        <p>64%</p>
        <p>53%</p>
        <p>20%</p>
        <p>69%</p>
        <p>12%</p>
        <p>55%</p>
        <p>54%</p>
        <p>57</p>
        <p>16%</p>
        <p>78%</p>
        <p>74%</p>
        <p>82</p>
        <p>36%</p>
        <p>23%</p>
        <p>75</p>
        <p>64%</p>
        <p>109% 108% 97% 96%</p>
        <p>33%</p>
        <p>56%</p>
        <p>29%</p>
        <p>30%</p>
        <p>33%</p>
        <p>48%</p>
        <p>18</p>
        <p>25%</p>
        <p>33%</p>
        <p>56%</p>
        <p>70%</p>
        <p>30</p>
        <p>30%</p>
        <p>33%</p>
        <p>48%</p>
        <p>18</p>
        <p>25%</p>
        <p>31%31% 18% 18%</p>
        <p>75%</p>
        <p>51%</p>
        <p>52%</p>
        <p>52%</p>
        <p>39%</p>
        <p>76</p>
        <p>50%</p>
        <p>51%</p>
        <p>52%</p>
        <p>40%</p>
        <p>Poses Threat For Pay Board</p>
        <p>SAN FRANCISCO (AP) -West Chast longshore boss Harry Bridges says a shutdown of all U. S. ports is possible if the Pay Board trims a contract agreement won by East (^st longshoremen.</p>
        <p>The Pay Board will consider the International Longshoremens Association contracts covering Atlantic and Gulf coast ports. It already-. has trimmed the Pacific Coast contract won by the International Longshoremens and Warehousemens Union.</p>
        <p>ILWU President Bridges, writing in the union newspaper 'Ihe Dispatcher, said Monday a joint agreement of the ILA and the ILWU for walkouts in all ports is still in the works,and very much alive.</p>
        <p>SPACE CENTER, Houston (AP)  Scientists who observed the first of Apollo 16s moon rocks say they appear to be different from any brought back by previous crews.</p>
        <p>Inside the first bag unpacked Monday were four large rocks covered with gray dust which obscured features. The samples were gathered by the first astronaut team to explore the moons highlands.</p>
        <p>Dr. Patrick Butler, a Manned Spacecraft Center geologist,</p>
        <p>His Turkey-Call 'Too Realistic'</p>
        <p>LITTLE ORLEANS, Md. (AP)  A 19-year-old Frederick, Md., youth was wounded when his turkey calls were too realistic.</p>
        <p>State police reported that Gary William Gark was sitting in a tree using a turkey call device to lure game Monday when he was shot accidentally by another hunter,. Nelson R. Bussard, 33, of Hagerstown.</p>
        <p>Gark was admitted to Cumberland Memorial Hospital in fair condition with 12-gauge shotgun pellet wounds of the head, neck and chest, police said.</p>
        <p>said that despite the dust Oiey appeared to be similar to many of the Apollo 14 rocks but theyre much lighter. They seem to be composed of dien: ent material.</p>
        <p>One of the rocks weighed about 10 pounds, Butler estimated, and the others were smaller. All were cracked, as if they had been hit by meteorites, he^ said, and one appeared to be white and sprinkled with black glass.</p>
        <p>Most of the early samples are to be transferred to radiation laboratories for analysis of their composition.</p>
        <p>Those opened Monday represent only a small part of the record 245 pounds of rocks collected in the Descartes highlands by astronauts John W.</p>
        <p>Young and Giarles M. Duke Jr.</p>
        <p>The scientists hope that locked in some of the rocks will</p>
        <p>be evidence that the moon was ,  ...  . ,  .  ,</p>
        <p>wracked by volcanoes in its for-  indicated the agenda for</p>
        <p>the County Commissioners</p>
        <p>mative years more than four billion years ago,</p>
        <p>Based on Revision observations of the astronauts on the moon, some U.S. (ieological Survey experts believe the evidence will be found, but they want to defer any positive conclusions until the Apollo 16 material is analyzed over the next several months.</p>
        <p>meeting on Monday was too crowded to permit consideration of the budget.</p>
        <p>As a result, the school budget and the separate request for consideration relative to the site of the proposed new middle junior high school was delivered to the county manager today for future consideration by the Ckiunty Ckimmissionere.</p>
        <p>EXTENDED WEATHER OUTLOOK FOR N.C.</p>
        <p>Widely scattered showers Thursday through Saturday, mainly in the afternoons. Temperatures will run in the 70s with overnight lows in the SOs.</p>
        <p>^ BLOWN IN INSULATION</p>
        <p>AOd Insulation to your Homo and cut your Air jponditionino costs tMs summar.</p>
        <p>Call Evenings 758-4881</p>
        <p>MACK HOWARD</p>
        <p>U.S. NKKSS</p>
        <p>Ripdllta Mnry Wiy I</p>
        <p>mam av ASACK NonvAeo comjm.</p>
        <p>eOR CONORIiS, WM. MONROI, CMAIRMAW</p>
        <p>sons, McCoy WUliams of the mourned the death of one of</p>
        <p>his closest friends and advisers, FBI Director J. Edgar Hoover and ordered flags at all public buildings and in-stallati&amp;lt;Hi8 lowered to half staff.</p>
        <p>Within minutes after Hoovers death was announced publicly the President appeared before^ reporters at the; White House tot speak of his profound sense of personal loss at the death of Hoover. Nixon described him as a truly remarkable man who served the country for 48 years under eight presidents with unparalleled devotion to duty and dedication.</p>
        <p>Because of his indomitable courage against sometimes vicious attacks, he made certain that the flag of the FBI will always fly high, Nixon said of Hoover whom he said had been his friend for 25 years since he came to Congress ^s a freshman l^islator.</p>
        <p>The White House also distributed a formal statement by the President in which Nixon said that Hoover could truly be called a legend in his own lifetime.</p>
        <p>School Budget Delivered Today</p>
        <p>Dr. Cleet C. Cleetwood, Superintendent of the Greenville City Schools, today reportedthat the citys school budgeT, reported in a story in this paper on Monday to have been delivered to County Manager Reginald Gray on friday, wa not actually delivered until today.</p>
        <p>The superintendent explained that on Friday he took the budget to (iray to place in his hands. Dr. Geetwood noted that</p>
        <p>Six Singers To Festival</p>
        <p>Six young singers from J. H. Rose lOgh-^OcbQol and their teacfaer-chm&amp;gt;eton, Miss Louise HoCQer, will depurt Greenville at 4:00 a.m.IlniE^y  R lAg 4^</p>
        <p>day event, the SUte Choral Festival at the University oi North Canrtina, Greensboro.</p>
        <p>Four girls and two boys will rqiresent Rose at the state s^ ... Cathy Rfilson, Helen Posey, Julie Gurganus, FSye Manning, Mike Vinson, and Will Bfoore.  _</p>
        <p>The Rose contingent will join singers from more than 50 other North Carolina High Schools to form a j^ister diorus of 500 voices. The large group will work with Dr. Don Moses of Indiana University in five rehearsal sessions of two hours during the two days.</p>
        <p>The climax of the festival will be a concert featuring aD 500 voices to be held Friday at 7:30 p.m. at Aycodi Auditorium on campus at UNC-G.</p>
        <p>Selections will include Vivaldis (Horia; a choral vmrk from Fiddler on the Roof; and Schutzs Eihre sei die, Christ.</p>
        <p>Tickets will be on sale at the door prior to performance. Preicra are |1.()0 for adults and 50 centrs for children.</p>
        <p>Galifianakis To Visit ECU</p>
        <p>Nick Galifianakis, Democratic candidate for the U.S. Senate, will be at East Carolina Univeristy Thursday at 12:30 p.m.</p>
        <p>He will be in front of the University Union for about 30 minutes to meet the people and students.</p>
        <p>Grumpier...</p>
        <p>(Continued from page 1)</p>
        <p>2upied during April and rent there averaged $30.98.</p>
        <p>In N.C. 22-2 (Kearney Park), 157 units were rented and residents paid an average of $35.41 in rent. One vacancy in the 188-unit N.C. 22-3 section of Moyewood existed in April, Mrs. Streeter said last night, and rent there averaged $29.02. All 40 units were rented in N.C. 22-4 (Moyewood) and rent averaged $35.71 for the month.</p>
        <p>Subdivision 4</p>
        <p>Unc Lto 1</p>
        <p>looking into the poi^ of widening the road OQ the etfrtern side of the present higliwi^ h) the area of the airport, but said no dedsk has been reached.</p>
        <p>Commiastaaers agreed to have reiwesentatives meet with representatives ot the Oty oi Greenville, ^e Airport Authority and Hi^way Ccmi* mission officials in an attempt to woric out a solution to the problem.</p>
        <p>' The Airport Authority has voiced objectkms to ttie con-stmctkm of two additkmal lanes to the West of the present road. They said such a move will affect the required glide path to the airporFs ^in runway as established by the Federal Aviation ^Atbmity.</p>
        <p>In other action yesterday Commissioners set the week of May 7-13 at Vtounteer Firemens Week; proclaimed Senior Gttzens Week in Pitt in honor of the 5,236 resident? of the coimty who are 65 years old or older; and designated the month of May as Gean Sweep Month  encouraging all civic minded individuals and groups to join in (xbjects and activities that will make the county a cleaner, more ijoyaUe place to live.^ Ckimmissipners last month passed a reaplution encouraging . voters in Pitt to cast ballots for the iHXjposed $150 million state bond issue.</p>
        <p>The money will be used to aid municipal governments in the state construct sewage collection and treatment facilities and build water supply systems.</p>
        <p>' a</p>
        <p>Mrs. Streeter In Council Post</p>
        <p>Mrs. Sallye  C. Streeter, director of tenant affairs for the Greenville Housing Authority, has been named to ttie board of directors of the Carolinas Council of Housing, Redevelopment and Code Officials.</p>
        <p>Mrs. Streeter, whose election came during the Councils annual conference April 12, 13, and 14, will serve a one-year term on the board. The director is one of ten board members serving the council.</p>
        <p>The Carolinas Council includes both North and South Carolina.  </p>
        <p>Three More Are Charged</p>
        <p>Three mere peraooa havR been arrested in ooonectkin with bhe April 15 bredng-entering and larceny nf the W.I. Jacfcaon service sUtion and grocery on Rt. 1, Grilton.</p>
        <p>Pitt County Sheriff Ralph Tyson said that deputi^ arrested (Hander Garrett, 42, of Rt.' 1, Grifton and Doretfaa Farrell, 46, Rt. 2, Grifton, on charges of recieving stolen property.</p>
        <p>He said that Paid Bright, 36 of Rt. 1, Ayden, was charged with breaking-entering and larceny fidlowing his arrest Monday. Bond for Garrett and Bright was set at $3,000 rach, the sheriff said, and at $1,000 for Doretha FarreU.</p>
        <p>Sierifi Tysm said that a hearing has been scheduled for May 10 in District Court here. The three arrests totnight the total to six arrested during the investigation of the Iteeak-ih.</p>
        <p>Deputies recovad a cash roister that was stolen fnmi the business and other merchandise, the sheriff noted.</p>
        <p>Endorse Family Vegetable Plots</p>
        <p>WASHINGTON (AP) - The House has joined the Senate in endorsing family vegetable gardens.</p>
        <p>It sent to President Nixon without a dissenting vote Monday a Senate resolution urging that each American family, where practicable, plant a vegetable garden to fight inflation, save money, get exercise and have the fun and pleasure of family vegetable growing.</p>
        <p>She said that her staff spent the month verifying and completing information on residents  .</p>
        <p>ho are affected by the Brooke ' lb-poor towns Monday.</p>
        <p>Amendment. The revisions</p>
        <p>OFF TOE LIST WASHINGTON (AP) - The Williamston-Plymouth area of Northeastern North Carolina was removed from the nations</p>
        <p>TERMITES?</p>
        <p>CALL</p>
        <p>Ivey Coward</p>
        <p>CO., INC. YOUR COWAR-DEX MAN</p>
        <p>Tel. 752-5175</p>
        <p>Ask about our $25,000 termite damage repair warranty.</p>
        <p>on</p>
        <p>rent charges under the amendment has resulted in some decreases in monthly rents in the four housing areas, she noted.</p>
        <p>(Commissioners authorized the attendance of three persons at the SERC-NAHRO annual conference scheduled for June 11-14 in New Orleans. Normally, two staff members and tme commissioner are authorized to attend the housing confotences.</p>
        <p>0CT</p>
        <p>JM HUNT</p>
        <p>LIEOTEIIAIIT 60VEHI0I</p>
        <p>rAio p&amp;gt;o IT eiTT CO. coMUMirrcB aea jim hunt</p>
        <p>WHITEHURST</p>
        <p>FOR</p>
        <p>JUDGE</p>
        <p>Again, I would like to take this opportunity to iet you the people</p>
        <p>Pamlico counties^l</p>
        <p>Peace for 4 years, and having tried m criminal during that period, all of which Court Judge add to my qualifications to hi</p>
        <p>\</p>
        <p>of Pitt, Carteret, Craven, and Pamlico counties^know that having been in law enforcement for 10 years as a member of The N. C. Highway Patrol gives me what I feel is an inside look from the stand point of the problems an officer has in enforcing the lawis of our country. They are doing a good job in enforcing the law and bringing those accused of law violations to court. It then becomes the duty of the Districf Court Judge, after hearing the evidence presented, to determine the persons' guilt or innocence and to render fudgment accordingly. This is where I feel, that having been a Justice of the</p>
        <p>tried many cases; both civil and )f which are now tried by a District Judge add to my qualifications to hold this position.</p>
        <p>I feel that the 10 years I served on the Highway Patrol and the 4 years I was elected Justice of The Peace for Pitt County qualifies me more so than the year and a half I served as magistrate; since under the new court system the duties of a magistrate are limited only to writing warrants, setting bonds, accepting pleas of guilty to minor violations, and hearing minorcivil lections, etc.</p>
        <p>It will be impossible for me to contact each of you individually and ask for your yote, as this district covers a large area.</p>
        <p>I have not at any time asked for contributions in my campaign as I feel your vote in helping me to become one of your next District Court Judges is more important than money, so I am asking you now, vote experience and vote W. E. Whitehurst for District Court . Judfle,u subiect to 4hq JAay 4. DesM^atic-Ppimary;</p>
        <p>Your Vote &amp;amp; Support Will Be* Deeply Appreciated.</p>
        <p>CortrBf, CrovBii, Pomlico and Pitt Countiab</p>
        <pb facs="00091594_0007" />
        <p>SportsClassified</p>
        <p>TUESDAY AFTERNOON, MAY 2, 1972Bugs Split With W&amp;amp;M; Watch Spiders</p>
        <p>WILLIAMSBURG. Va - East Candna University's Pirates must wait and watch now, and then maybe pull out a victory of their own before the week is up.</p>
        <p>The Southm Confcnrrace title is on the line. It boils down to East Candna and Richmond, with William and Mary and Furman having outsi(k chances.</p>
        <p>Yesterday, the Pirates s|dit a doubleheader with the Indians, bowing in the first game, 6-3, then winning the second, 5-3. The split boosted the Pirate record to 10-5 for the seasmi. They have one game left, a road trip to Davidson on Saturday.</p>
        <p>Richmond, now 7-3, plays a doubldieado* today at VMI, then hosts William and Mary on Thursday in a doutdeheader. They close on Friday with another pair at Williamsburg. Should the Spiders lose two of</p>
        <p>those games, they would be tied with the Bucs.</p>
        <p>Furman more or less let Itself out the race with a 3-2 loss to The atadel last night. The Paladins won the other half of the doiiUeheader, 3-2 also. They are now M, and have a doutdeheader with Davidson to make up, but have set no date fm* it. All games are to be played by Saturday according to league rules.</p>
        <p>William and Marys chances hinge on their taking all four games from Ridunond.</p>
        <p>By Friday night, the results will be known except for the Pirates single game Saturday with Davidson. But the Bucs will know then whether they have a shot at the title or not.</p>
        <p>The Bucs lost out on a good scorirtg opportunity ri^t at the start of the game. Mike Brad</p>
        <p>shaw opened things up with a triple, but when the Bucs tried the squeeze, it failed and Bradshaw was cut down.</p>
        <p>^ WUEUam and Mary then came w^ three runs in the botUnn of the first to take the lead. Mike Gratton led off with a single to right, and Himter Robinson got a hit to center. Jeff Steckroth followed with a basehit, scming Gratton for the first Indian run. Greg Bosiack singled to score Robinson, and Stedtroth came over on a sacrice fly by Crarky Bishop, making it 3-0.</p>
        <p>The Bucs lost a chance in the second on a double [day, and the Indians gd a threat on a two-base aTm-, but neither paid df.</p>
        <p>In the third, howevo-, the Pirates scored three to tie it up. Don Oxidine singled and with one down, Jimmy Paige got a hit. Ralph Lamm singled in</p>
        <p>AU Fails To Knock</p>
        <p>Out Chuvalo But Wins</p>
        <p>By JACK STEVENSON Associated Press Sports Writer</p>
        <p>VANCOUVER, B.C. (AP) -After battling Muhammad Ali the full distance for the second time, Canadian George Chuvalo predicted heavyweight king Joe Frazier will beat the ex-champion again.</p>
        <p>The speedy Ali punched out a unanimous decision victory Monday night at the Pacific Coliseum over the 12-round route but couldnt achieve his goal of putting the tough Toronto fighter down.  #</p>
        <p>Following the bout, somewhat similar to their meeting in 1966 when Ali won in 15, he was asked when hed fight Frazier.</p>
        <p>I dont think he is quite ready for a rematch, Ali answered. Im going to be in even better shape when I fight Frazier than I was for Chuvalo.</p>
        <p>And if I had been in this good shape for Frazier the first time, I would have laid him out.</p>
        <p>Joe won the title fight, March 8, 1971, by decision.</p>
        <p>Against Chuvalo, Ali danced and jabbed and put over some solid hooks and right hand shots.</p>
        <p>Still, the 34-year-old Canadian declared, I never was wobbly.</p>
        <p>Ali, now from Cherry Hill, N.J., weighed 217V4 while Chuvalo came in at 221. For Ali, the weight showed the result of hard training since his April 1 bout when he weighed 226 be</p>
        <p>fore beating Mac* Foster in Tokyo.</p>
        <p>A lot of people say that Chuvalo is washed up, but thats a lie, Ali declared in the post fight interview. Anyone who can take my best shots is going to be around for a long, long time.</p>
        <p>Chuvalos best rounds were the fifth and ninth. In the sixth, when Ali came oiit fast, the Canadian suffered a one-inch gash on his forehead just over the right eye. The cut bled much of the rest of the fight but didnt appear to bother George.</p>
        <p>A crowd estimated at 8,800 watched in person with closed circuit television and some home television beamed internationally. 'The gate was expected to approach $200,000, the</p>
        <p>amount guaranteed Ali. Chuvalo gets $65,000.</p>
        <p>After this rematch, George declared, Ali was in better shape than I thought he would be in, better shape than in our last fight.</p>
        <p>Pressed for his choice between Ali and Frazier, he replied, Ive got to go with Joe.</p>
        <p>Frazier stopped Chuvalo on facial injuries in the fourth round when they met, but George never has been knocked down in a career dating to 1966.</p>
        <p>Under the 5-point-must system, referee Dave Brown scored the bout 59-51. Judge Tom Keys saw it 58-51 and judge Tommy Paenessa, 60-46. The Associated Press had 58-52 for Ali.</p>
        <p>OxkUn, and a triple by Ron Staggs brought in Paige and Lamm, tieing it tq&amp;gt;, 3-3.</p>
        <p>The Indians threatened again in the fourth with a single ud a sacrifice, but didnt get anything. They did in the sixth, however, puling over three more to gain the 6-3 lead that won it.</p>
        <p>Bosiack singled and BsIkh? jeached on a bunt single, charles Bish douUed, scoring Bosiack and Bishop, and he moved to third on an error on the play. Ferris Alien then singled to score Bish with the sixth Indian run.</p>
        <p>The Bucs got off threats in the fifth when Lamm doubled and in the sixth, when Staggs singled and moved up on a sacrifice, but neither paid off for them.</p>
        <p>Then, in the fourth, they moved into the lead with a run. Bishop singled to left and came around when Allen got a double.</p>
        <p>Then, in the flfth, the Indians came up with two more. Gratton and Robinson both singled and a hit by ^eckroth brought in Gratton. Bosiack followed with another hit, scoring Robinson for a 3-0 lead.</p>
        <p>Elast Carolina had a chance to score in the second erased by a double play. Larry Walters had singled, moved up on an error and gained third on a wild pitch. But he was cut down in the twin killing erasing the threat.</p>
        <p>In the third, Bradi^w double, but died at second, and in the fourth, Staggs reached on an error and moved up on a passed ball, but got no further.</p>
        <p>The fifth saw one more chance go by the boards. Bradshaw singled, Paige got a hit and Lamm walked to load the bases with two away, but again William and Mary got out without damage.</p>
        <p>Finally, in the sixth, the</p>
        <p>Pirates could be contained no longer, exploding for iU five of their runs. Staggs led off with a singled and Matt Walker got a hit. Both came around to score when Greg Fulghum doubled. Leggett singled, and a sacrifice fly by Lin ^&amp;gt;ears brought in Fiilghum, tieing it up.</p>
        <p>Bradshaw, who had already singled, doubled and tripled during the afternoon, capped off his day with a two-run homer. His second in the past three days, and that was all the Bucs needed fcH* the 5-3 win.</p>
        <p>But now, all eyes focus on Ridunond. The outcd|ne of their</p>
        <p>next six games determine East Carolinas final chance on Saturday.</p>
        <p>SmmWOm* tt CaraUM</p>
        <p>k r a rM</p>
        <p>radiaaw.M 4 t | i</p>
        <p>WilUam S Mwy</p>
        <p>Ftrtiaaiii* M CarMM</p>
        <p>kr a r Sradihaw.M } 0 )</p>
        <p>WilMkMi S Mary</p>
        <p>akr arki</p>
        <p>City League</p>
        <p>eaiga.cf Lammjb Waitara.rf $ta9gt,ib Walkar.lf McMahon, c LOBOktt-Ib Tomt.p OKidtan.p Tatatt</p>
        <p>3 1 1 3 1 1 3 0 0 3 0 3 3 0 0 1 0 0 3 0 0 0 0 0 3 1 1 U 3 0</p>
        <p>Granon,c4 RobMaon.3b Siackroih.if BMack.tb ihop.rf Biih.u Aiian.3b Ol/Marf(.c 0 Setsaeaw.p 0 Kramar.Tb</p>
        <p>0 Oaary.p</p>
        <p>1 Tatait</p>
        <p> 1 0 1 1 0</p>
        <p>3 111</p>
        <p>4 13 1 3 111 3 13 1 3 0 11 3 0 0 0 3 0 0 0 0 0 0 0' 0 0 0 0</p>
        <p>3T 4 f S</p>
        <p>eaia,cf</p>
        <p>Camfn4b</p>
        <p>Waltarvrf</p>
        <p>Sta9.ib</p>
        <p>Waikar.H</p>
        <p>AAcMakon.c</p>
        <p>Fuiohom.c</p>
        <p>Lwn.7b</p>
        <p>Forbafcp</p>
        <p>Eaion.ph</p>
        <p>Fmi.p</p>
        <p>LaRwMon.p</p>
        <p>Spaart,ph</p>
        <p>Godwin.p</p>
        <p>Tatalt</p>
        <p>3 0 3 0</p>
        <p>3 0 0 0</p>
        <p>4 0 10</p>
        <p>3 14 0</p>
        <p>4 110 3 0 0 0 3 113 3 110 10 0 0 10 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0</p>
        <p>39 I 10 S</p>
        <p>Gratton,cf Robinion.3b Stackroth.lf So04ack,lb ihop.n Sith.ot Ailan.3b Harr(*.p Mllaaon.p Whitian.p Oaary.p Talalt</p>
        <p>r a rki</p>
        <p>3 13 0</p>
        <p>4 110 4 0 11 4 0 11 4 13 0 4 0 0 0 3 0 11 3 0 0 0 3 0 0 0 10 0 0 0 0 0 0</p>
        <p>33 3 II 3</p>
        <p>Opens Season</p>
        <p>Babe Ruth</p>
        <p>Rodriguez Is Opening Set</p>
        <p>The Babe Ruth League</p>
        <p>Greenvilles new City Softball League opened play last night, with Parkdrs Barbecue, Four Seasons, Greenville Utilities, Fieldcrest Mills and Hueys Restaurant daiming first victories.</p>
        <p>Four Seasons best Shirleys Barbershop, 8-6; Parkers downed Hardees 6-0; Hueys beat Harbins, 16-1; GUCo beat Jaycees, 9-3; and Fieldcrest took Burger King, 5-1.</p>
        <p>Fieldcrest grabbed the lead in its game in the second inning, getting ali it needed. Junior Whitdiurst singled and Larry Greene reached on a fielders choice. Willard Jackson singled and James Ross got a hit. Graham House reached on a fielders choice and Mike Strother on an error to account for the three runs. They added two more in the seventh on a homer by Ray Parnell.</p>
        <p>The lone Burger King run came in the fifth inning. ^</p>
        <p>In the other game at Guy Smith, GUCo fell behind in the first as the Jaycees scored a run, but two runs in the third put them ahead. The Jaycees regained it with two in the top of the fourth, &amp;lt;hi a homer by Ratcliff, but GUCo came up with three in the bottom of the inning to take the lead for good.</p>
        <p>In that game, Bynum and Harris both singled and J. Suggs hit a three run homer for a 5-3 lead. GUCo added four more in</p>
        <p>the sijcth for the final total of nine runs.</p>
        <p>Hueys got all they ^.eeded in the flrst inning scoring four runs. Woodard reached on an error and Draffin doubled him in. He scored on Rhodes sacrifice, and Saylors reached on an error. Hicks singled and Helms got a hit, scoring Saylors. Hungard singled to score Hicks for a 4-0 lead. Hueys then added two in the third, two in ^e fourth and two in the seventh on a homer by Helms.</p>
        <p>The lone Harbins run came in the third.</p>
        <p>Parkers needed only one run, and i| got that in the first inning. William Nichols reached on a fielders choice and scored on John Caraways double. Parkers went on to picked up three in the third with Wayne Avery homering. They added two more in the fourth.</p>
        <p>Shirleys gained the lead in its game with Four Seasons in the second scoring five times. Four Seasons then came up with four in the third to tie it as Charles Vincent homered. They got what proved to be the winning run in the fourth.</p>
        <p>That frame saw two come in. Ray Carawan singled and scored on Ron Vincents double. Vincent came around on an error on the play to make it 7-5. Four Seasons added another in the fifth, while Shirleys got one more in the sixth.</p>
        <p>SattCkrobM  9*3    k3</p>
        <p>William A Manr  W*</p>
        <p>E  Siapga. Paiga. OP  SoiMaau Roblnaon Sotiack, Slh Allan Spaiack. POA  Eal Carolina U 3. William A Akary 31 11. LOB - Eat Carolina 5. ^William A Mary 4, 3B  Lamm, Biah. S  Waikar. Allan; SF  Biahop PitcliinB</p>
        <p>Ton,,  0  4  3 3 0  0</p>
        <p>OKlOina(L)  22S</p>
        <p>Boiaaaao  t  5  M   2</p>
        <p>Oaary  1  0  0 0 3  0</p>
        <p>Baat Carolina  900  aas 9</p>
        <p>William A Mary  999  139 93</p>
        <p>E  Laooait, Boaiack, Harna. OP  Mama Robmaon, poA  Eatt Carolina 31 7. William A Mary 3M0. LOB  Eatt Carolina 7, William A Mary 9. 3B -BraOanaw. Fuignum, Allan; HR  Brao maw, SF  Spaara</p>
        <p>Goldsboro</p>
        <p>Ptickint</p>
        <p>F or baa Post</p>
        <p>LaRwaaa (W)</p>
        <p>Godwin Milaion (L) wniitan</p>
        <p>Oaary WP  Milaaon. PB</p>
        <p>ip n r ar bk M</p>
        <p>4  4  1113</p>
        <p>0 3  3  3  3 0  0.</p>
        <p>07 10001 3  30001</p>
        <p>5 3  10  5  5 3  3</p>
        <p>0.7  0 0  0 0  0</p>
        <p>1 00010 Harria</p>
        <p>Ladies</p>
        <p>Rips Rose Winners</p>
        <p>GOLDSBORO - Rose High School was downed by Goldsboros Cougars yesterday, 9-0, in tennis.</p>
        <p>The Ratopants were shutout from even winning a game during the first three matches. They managed to capture only one set during the afternoon as Jim Proctor won that.</p>
        <p>Summary;</p>
        <p>Steve Carroll (G) defeated A1 Winn, 6-0, 6-0.</p>
        <p>Neil Baddour (G) defeated Steve Reel, 6-0, 6-0.</p>
        <p>Rex. Markham (G) defeated Mike Stephenson, 6-0, 6-0.</p>
        <p>Steve Richards (G) defeated John Charles Thompson, 6-2,6-1.</p>
        <p>Joe Surratt (G) defeated Dave Walton, 6-3, 6-1.</p>
        <p>Robin Vincent (G) defeated Jim Proctor, 6-8, 6-2, 6-1.</p>
        <p>CarroU-Baddour (G) defeated Steve Rogers-Thompson, 8-0.</p>
        <p>Surratt-Markham (G) defeated Winn-Sterfienson, 8-4.</p>
        <p>John Goubing-Doug Getsinger (G) defeated Reel-Walton, 8-3.</p>
        <p>The Brook Valley ladies took top honors in the Pitt County Ladies Golf Association Finals held Sunday at Brook Valley Country Oub.</p>
        <p>Jane Sauve took low gross honors in the championship fight</p>
        <p>In the first flight, Mary Meade Powell won low gross, while Joann Proctor took low net. Low putU went to Ruth Billica.</p>
        <p>In the second flight, Aileen Hamblen won low gross, while Miriam Martin took low net.</p>
        <p>Happiness is...</p>
        <p>Playoff Winner</p>
        <p>Immahuel</p>
        <p>Is Winner</p>
        <p>Immanuel Baptist qpened the 1972 Church Softball League season last night with a 19-9 victory over Maranatha.</p>
        <p>The victory game Immanuel early possession of first place in the league. The rest of the National League teams, along with the American l^gue, open later this week.</p>
        <p>Maranatha scored once in the first, but ImmanueLcahie back with two in their half of the frame. Maranatha tied it up with a run in the second, then scored five in the third for a 7-2 lead.</p>
        <p>Immanuel came back with three runs in their half of the third, including homers by Williard Dean and Charlie Camp. Maranatha' then added two more in^the fourth to lead 9-'5.  ,</p>
        <p>Immanuel came up with eight runs in the fourth, however, moving into a 13-9 lead, and they never lost if. Phil Joyner singled and Dean tripled. Dick Evans doubled and Sid "Carraway reached on an error. Camp douUedand Jim Harris gota hit. L. G. Cattin singled and Jimmy Mullin singled. Jim Smith singled to bring in the final run.</p>
        <p>Immanuel thra added two in the flfth and four in the sixth to wrap it up.</p>
        <p>By DENNE H. FREEMAN Associated Press Sports Writer</p>
        <p>DALLAS (AP) - Chi Chi Rodriguez had a dream and, corny as it may seem, captured a sudden-death playoff from Billy Casper and lived happily ever after.</p>
        <p>A story a fiction writer wouldnt touch turned into real life drama Monday as the downtrodden Rodriguez, who hadnt won a tournament in four years, dreamed he would beat Casper in a sudden-death playoff for the $2S,(W0 first prize in the Byron Nelson (3olf classic and did it.</p>
        <p>I cant believe I dreamed the whole thing, said Rodrguez, the former clown prince of the PGA tour, who has turned serious so he can concentrate.</p>
        <p>The 36-year-old Rodriguez rammed home a five-foot putt on the 15th hole for a birdie to beat Casper, who has been in a slump for a year but showed signs of being the portly par-buster of old. Both fini^ed with seven-under-par 273 ovct the long Preston Trail</p>
        <p>(Hub course.</p>
        <p>I dreamed last night that I would have a playoff with Billy today, Rodriguez said. I told him that before we started today, too.</p>
        <p>Casper confirmed that Rodriguez told him about the dream but added; He said he dreamed he knocked it stiff on the 13th hole and made birdie.  But he was confused. The 13th is a par three. He meant he knocked his stiff on the 15th. Rodriguez chimed in I hit a nine-iron on the I5th but in the dream it was an 8-iron. For me, it was a dream come true.</p>
        <p>Semi-Pro In</p>
        <p>FoHeit Win</p>
        <p>CHreenvilles entry in the Pitt-Martin Semi-Pro Baseball League opened play Sunday, gaining a victory over Farm-ville.</p>
        <p>The victory came by forefeit.</p>
        <p>Greenvilles next game is Sunday when they entertain Jamesville in a doubldieadn'.</p>
        <p>The Babe Ruth League begins its  1972  season</p>
        <p>Wednesday night with a single game. Carolina Dairy will be meeting Pepsi-Cola.</p>
        <p>Game time for the opener is 6:15 p.m.</p>
        <p>Friday, two more games will be played. Home Builders will take on North Carolina National Bank, and Collie View will meet Planters Bank. Again, the opening game begins at 6:15 p.m., with the second starting at the end of the first.</p>
        <p>Saturday night, three games are scheduled. Carolina Dairy meets NCT^, Pepsi-Cola takes on Planters and (College View meets Home Builders. Saturdays games are set at 2, 4 and 6 p.m.</p>
        <p>Play will continue with one game Wednesday, two Friday and three Saturday ttvogh June 2. After that, Monday and Wednesday and Friday will see doubleheaders each evening thnnigh the aid of the season, now set June 23.</p>
        <p>All games will be played at Guy Smith Stadium.</p>
        <p>Aycock Track Team In Win</p>
        <p>NbUHAfJCL</p>
        <p>Hinr- Aq tu y If</p>
        <p>KING EDWARD</p>
        <p>IMPERIALS</p>
        <p>WILSON - E. B. Aycock Junior High School squeeked to a 44-42 victory ovct Wilson Junior High in a track meet yesterday.</p>
        <p>Klose of Aycock was the only double winner in the meet, winning the 886-yard run and the mile run.</p>
        <p>Wilson won four of the events, while Aycock took just four but it was enough to win for the Phantoms. They swept the shot and discus.</p>
        <p>Summary;</p>
        <p>Shot: Hagans (A)  42-6;</p>
        <p>7Mi.</p>
        <p>Long jump; Edwards (W) 17-11; Allen (A) 17-9; Newton (A) 17-2.</p>
        <p>Duscus; Randolph (A) 108-10; Goodall (A) 102-3; Perkins (A) 97-11.</p>
        <p>High jump: Watson (W) 5-7;</p>
        <p>Randol[^ (A) 5-3; Wiggins (W)</p>
        <p>5-1.</p>
        <p>100; James (W)  ;11.2;</p>
        <p>Edwards (W) :11.8; Allen (A) .11.4.</p>
        <p>220: Wiggins (W)  ;25.8;</p>
        <p>Walston (A) :26.2; (tooper (W) :26.3.</p>
        <p>440: Watson (W) :55.6, Allen (A) :58.2; Harris (A) 1:00.8.</p>
        <p>440 relay; Wilson :48.8.</p>
        <p>880; Klose (A) 2:24.6; Raper (W) 2:27.6; Boudreau (A) 2:28.3</p>
        <p>880 relay: Wilson 1:42.9.</p>
        <p>Mile: Klose (A) 5:09; Goforth</p>
        <p>THE TAMS</p>
        <p>SHOW AND DANCE</p>
        <p>THURSDAY, MAY 4th</p>
        <p>Continuou* .Music 8 tc' 12 Shows At 9 p m &amp;amp; M p m</p>
        <p>"Beich Mum, At</p>
        <p>THE BUCCANEER</p>
        <p>4th and Cotancho St.</p>
        <p>WEDNESDAY</p>
        <p>THURSDAY</p>
        <p>FRIDAY</p>
        <p>SATURDAY</p>
        <p>at</p>
        <p>HUEYS</p>
        <p>Charles St. ExtenskHi Adiacent to Minges Coliseum Phone 756-4806</p>
        <p>M. C. Stocks, Ownor</p>
        <p>BRAKE</p>
        <p>THE BEST KYET TOCOME DFYOU HAVENT^ USED CHARTERIO</p>
        <p>ADJUSTMENT</p>
        <p>Value Priced Safety Service I</p>
        <p>99</p>
        <p>Our specialists ad|ust brake shoes to fbll contact . . . thoroughly inspect drums, cyHndort, end linings ... odd top quelHY hydraulic fluid if needed.</p>
        <p>Phona For An Appointmont ... olTPrivm In ... TODAY I</p>
        <p>"We need to evaluate amf separate prit-onets as they come bito the system so that we</p>
        <p>cr^ihal=^ that our prisons are not schoob for crime.''</p>
        <p> N. PAT TAYLOR. JR.</p>
        <p>PAID POP BY TAYLOP POP aoVEONOR COMMITTBC</p>
        <p>CHARGE IT NOW</p>
        <p>easy payment'^ w th approved cre&amp;gt;.</p>
        <p>SUTTONS</p>
        <p>SERVICE CENTER</p>
        <p>ll864HCKIiaONAyE. 7524121</p>
        <p>SUnON'S GENERAL TIRE</p>
        <p>284By-PASS</p>
        <p>TJELEPHONE 756-2320</p>
        <p>f</p>
        <p>I I</p>
        <pb facs="00091594_0008" />
        <p>&amp;gt;-'**feiir la*ler, OneaTlIlc, N.C.May 1, Itn</p>
        <p>Scoreboorcf</p>
        <p>Wynns Slam</p>
        <p>New York Wins, 146*136, Evens Series; Final Game Set Thursday</p>
        <p>Tedbyt Basehen</p>
        <p>By THE ASSOaATED PRESS American Leagne Eaat UrialM</p>
        <p>W. L. Pet. G.B. Detroit \  7  4  .636 </p>
        <p>Baltimore  7  6  .538  1</p>
        <p>Cleveland &amp;gt; 6  $  .500</p>
        <p>Boiton  4  7  .364  3</p>
        <p>New York  4  8  .333  3^^</p>
        <p>Milwaukee  3  7  .300  3^</p>
        <p>West INvision Minnesoti^  8 3  .727 </p>
        <p>Oakland   7  4  .636  l</p>
        <p>Chicago  8  5  .615  1</p>
        <p>Texas  7  6  .538  2</p>
        <p>Kansas City  6  8  .429  3V^</p>
        <p>California  5  8  .385  4</p>
        <p>Mondays Results No games scheduled Tuesdays Games Oakland (Holtzman 2-1) at Boston (Culp 1-2), (N) Califmiiia (Gark 2-1 or May 0-0) at New York (Stottlemyre 0-3), (N) "</p>
        <p>Chicago (Bahnsen 2-2) at Bal-timcM'e (McNally 2-1), (N) Minnesota (Blyleven 3-0) at Milwaukee (Parsons 1-2), (N) Geveland (Perry 2-2) at Texas (Bosman 1-2), (N)</p>
        <p>Kansas City (Dal Canton 1-1) at Detroit (Timmerman 1-1), (N)</p>
        <p>Wednesdays Games</p>
        <p>Qeveland at Texas, (N) Kansas City at Detroit, (N) Chicago at Baltimore, (N) Minnesota at Milwaukee, (N) California at New York Oakland at Boston, (N) National League Eastern Division</p>
        <p>Montreal New York Philadelphia St. Louis Pittsburgh Chicago</p>
        <p>W. L.</p>
        <p>9 4</p>
        <p>9 4</p>
        <p>10 5 5 8 5 6 4 10</p>
        <p>Pet. G.B. .692 -</p>
        <p>.a -</p>
        <p>.6f7 -.3 4</p>
        <p>35^</p>
        <p>.286 5^</p>
        <p>West Divishm ,</p>
        <p>Houston 11 4 .733 ~ Los Angeles 11 5 .61</p>
        <p>Atlanta , Cincinnati San Francisco San Diego</p>
        <p>.688 M .467 4</p>
        <p>.385 5 .353 6 .313 6^</p>
        <p>7 8</p>
        <p>5 8</p>
        <p>6 11 5 11</p>
        <p>Mondays Results New York 7, San Francisco 4 H(Histon 9, Pittsburgh 8 Philadelphia 2, Los Angeles l Only games scheduled Tuesdays Games Atlanta (Reed 1-2) at Chicago (Hands 0-0)</p>
        <p>Houston (Reuss 2-0) at Pittsburgh (Briles 1-0), night Cincinnati (Gullett 0-2) at St. Louis (Wise 1-2), night Philadelphia (Fryman 1-0) at Los Angeles (Downing 1-2), night</p>
        <p>New York (Gentry 1-1) at San Francisco (Carrithers 1-1), night</p>
        <p>Montreal (Renko 1-1 or Me Anally 0-0) at San Diego (Norman 0-2), night</p>
        <p>Wednesdays Games Philadelphia at Los Angeles, night</p>
        <p>Montreal at San Diego New York at San Francisco Houston at Pittsburgh, night Atlanta at Chicago Cincinnati at St. Louis, night</p>
        <p>By KEN RAPPOPORT Associated Press Sports Writer</p>
        <p>The Houston Astros traded for a Mg gun during the qff-aea son after their Toy Cannon lost some fifspower.</p>
        <p>Getting Lee May has really helped. Its made a better hitter out of little Jimmy Wynn.</p>
        <p>The 54, ITOiMxmd outftelder is more than pulUng his weight with five home runs this season, including a grand slam blast that helped the Astros beat the Pittsburgh Pirates 9-8 Monday ni^t.</p>
        <p>Im smiling now, said Wynn after a big nifdit that also included a double and single and two runs scored.</p>
        <p>He should be hai^er than last seascm, when he hit only seven home runs all year and plunged to a career4ow .206 batting average uiiile sitting in Manager Harry Walkers dog house.</p>
        <p>Now batting in front of the power-hitting May, who had 39 homers last season fdr Cincinnati, Wynn is hitting at a .379 clip with 16 RBI and 15 runs scored.</p>
        <p>IiLthe (Hily other games Monday, the New York Mets turned back the San Francisco Giants 7-4 and the niiladelphia Phillies beat the Los Angeles Dodgers 2-1 in National Ll,0 ACTION.</p>
        <p>Igoderaon. Uttle Bud Harrcl-aoQ, ooe of die most unlikely long bidl hitters in the New 5 York lineup, also drove one out.</p>
        <p>DIdt Selma, a former rdief pitcher, qwn a three4iitter and WiUie Montanas hit a two-run hmncr for Philadelphia.</p>
        <p>UNIONDAlf. N.Y. (AP)  Now it comes down to one game,* dedared Virginia Ooaefa A1 Bianchi, trying to put Mondhy nights 146*126 New Yorii Nets victory over the Squires out of his niind and looldng ahead to Thursday nights finale at Norfolk, Va.</p>
        <p>Celtics Won't Leave Boston</p>
        <p>Haddock Busy Man At Tourney</p>
        <p>The Astros victory moved them into a tie with Los Angeles for first place in the National Leagues West race and shoved the defending World CTiampion Pirates 4^ games off the pace in the East.</p>
        <p>BOSTON (AP) - The new owners of the Boston Celtics are residents of the West Coast, but they insist the National Basketball Association club will remain in Boston.</p>
        <p>T dont know how that got started, Irving H. Levin said Monday in striking a report that the Celtics were' moving to San Diego.</p>
        <p>Levin, president 1)1 National General Corporation, a Los Angeles film boddng firm, said he and Harold A. LipUm, general counsel of the corporation, bought the Celtics because they love the sport."</p>
        <p>This deal has no relationship with National General," Levin said. Mr. Lipton and I are in this on our own."</p>
        <p>Levin said he and Liptmi met with Red Auerbach, the Celtics</p>
        <p>president and general manager, in California last week, and Red told us that his and the Celtics hasketball home is in Boston and we agreed wholeheartedly.</p>
        <p>We t^ Red of our love for basketball and bow great an opportunity we had in becoming owners of the Celtics because, he, 4x&amp;gt; in our &amp;lt;^rinion is Mr. Basketball, is the general nuinager," Levin said.</p>
        <p>We also told Red we would bring stability to the ownership of t^ Critics, ,thus enatriing him to do what he has done so well in the past, namely build a champion," he added.</p>
        <p>Ownership of the Celtics has changed several times since the death of Walter Brown, then (x^ident of Boston Garden, about 10 years ago.</p>
        <p>-The best sf 7 Ammiean Baslret baO Assoriaflon Easteni Divi-s i 0 n championship playoff series is now tied at 84.</p>
        <p>/R win be our home court and wwU have the home crowd in fovor of us, declared Bianchi, who mi^ have added that the Nets have not won a playoff game in \firginia in six tries spanning two years.</p>
        <p>But the Nets will go into the finale Coming off their most explosive performance of Uie playo^.</p>
        <p>Ride Barry poured in 43 prints, John Rodie Mlded 37 and KOy Paultz hit a career-hifdi 83 to pace New Yoiks explosive offense. Barry hit 17 of 23 firid-goal attempts, Roche 12 of 19induding three of five three-print triesend Paultz 13 of 15.</p>
        <p>As a team, the Nets hit a torrid .611 percentage, sinking 56 of 90 fidd goal attempts.</p>
        <p>Barry put it in simple terms.</p>
        <p>We beat them at their own game-running, he declared. We worked the ball well and took good shots. We just out-iriayed them."</p>
        <p>' - - - -  --   </p>
        <p>rur me squires rooaie juiiua</p>
        <p>Erviag bad 84 pohits aad Ber-nie WQUaass had 88. But Ray^ Scott, the weerve center who apnlBsd Virgiaias fifth-game victory with 26 points, was limited to six.</p>
        <p>A key to the game, bowevor, was under the boards. New York outreboundsd Virginia 48-38, the first time hi the series that the Nets have beaten the Squires off the boards. Paultz grabbed 14 rebounds for the Nets while Erving, who hauled in 32 Saturday, was limited to</p>
        <p>Indiana won the ABA Wbet-em Division champicueiiip series by beating Utah 117-lU at Ihe Salt Palace. Roger Brown had 27 points, Fteddie Lewis 23 and Md Danieis48 for the Pacers.</p>
        <p>AUTOMATIC TRANSMISSION SERVICE</p>
        <p>AN AiMTlCM IWakM a NMUt</p>
        <p>ROY SPEIGHT'S SERVICE CENTER</p>
        <p>iM M. SfWM SI. ea. msm</p>
        <p>There^sa very good reason</p>
        <p>for our name.</p>
        <p>Soad's Shoe Shop</p>
        <p>Ail Work Guarantasd Located in Cellagl% View Cleaners Main Plant</p>
        <p>We dont add unneeded water. Virgin Bourbon has a true, honest flavor that comes straight from the aging barrel.</p>
        <p>So the flavor wont melt away-evemifraTiighbatr:  ^</p>
        <p>Try it. Taste what we mean.</p>
        <p>$3.50 PINT</p>
        <p>$5.45</p>
        <p>FIFTH</p>
        <p>kMM kr HM OH IMM DwHHri C .</p>
        <p>107 fiml $ ymn m Ottmt mt</p>
        <p>By KEN ALYTA Associated Press Writer</p>
        <p>PINEHURST, N.C. (AP) -Jesse Haddock hasnt hit a shot in the North and South amateur golf tournament which moved into its second-round of match play today, but hes one of the busiest men around the Pine-hurst Country Gub.</p>
        <p>The coach of the Wake Forest University team entered a 12-man ccHitingent, headed by the defending champion, sophomore Ekklie Pearce of Temple Terrace, Fla. Pearce and six teammates were still around as 64 survivors of Mondays initial round began play today.</p>
        <p>The 32 winnow face two rounds We^esday over the 7,-000-yard, par-72 No. 2 course.</p>
        <p>Haddock wore a path from the scoreboard in back of the 18th green through the woods to the 13th green to check on the progress of his Deacons Monday.</p>
        <p>Wake Forest has furnished the winner in three of the last four North and South tournaments. Th? current team, recent winna* of the schools sixth straight Atlantic G&amp;gt;ast Ckxiference title, is aiming for the elusive national title in the NCAA tournament next month at Cape Coral, Fla.</p>
        <p>Haddock is watching his chargvi under ttwtmamgiit pressure this week as he ponders the makeup of the squad for the national test.</p>
        <p>Texas, Houston, Florida and Georgia are among several teams that could win," he says, but our team has the depth and balance, and I think through the top five men oUr</p>
        <p>chances are as good as anybodys.</p>
        <p>The two aces of the team are Pearce, National Amateur run-ner-up last summer, and senior Jim Simons of Butler, Pa. Simons was British Amateur runner-up and the 54-hole leader in the U.S. Open last summer.</p>
        <p>Each won Monday as did teammates Loge Jackson, Tom Pace, Pete Holm, Slate Tuttle and SamKitchin.</p>
        <p>It was Kitchin, from Kanna-. polis, N.C., who scored one of Mondays major surprises, beating Pensacola, Fla., veteran Downing Gray on the 20th hole. Kitchin lost a four-hole lead when Gray swept four of five holes, starting at No. 13 to get even.</p>
        <p>Right-hander Tom Seaver struck out 12 batters in 6 and 2-3 innings and got relief help from Tug McGraw to post his fourth victdry without a loss this season.</p>
        <p>Leading 4-3, the Mets broke open the game with three runs in the seventh on singles by Bud Harrelson, Tommie Agee, Rusty Staub, Geon Jones and Jim FYegosi.</p>
        <p>Despite Seavers high strikeout total, he was pulled after giving up home runs to Dave Rader, Chris ^ier and Km</p>
        <p>But Kitchin stopped his skid to win on the second extra hole with a par.</p>
        <p>Two of the old guard also figured in overtime matches. Four-time champion Bill Campbell of Huntington, W.Va., bo-gied the 18th bole when he missed the green, then lost on the IjRh to a birdie by Dave Ojala of Houston, Tex., the, 1966 National Public Links runner-UP-  - </p>
        <p>Dr. Ed Updegraff of Tucson, Ariz., lost a three-hole back nine lead,, then beat Bill Good-</p>
        <p>tte of Camdm,</p>
        <p>ing in from 40 feet for a IM-hole birdie.</p>
        <p>sso</p>
        <p>ValueCenters</p>
        <p>Check these May values</p>
        <p> Lift Insurance ^  Rsnsion Plans  Estate Analysis</p>
        <p>Wm. R. Bill" Stroud, CL Coffman Building Telephone 7S8-3522</p>
        <p>Sodety of Ibc UnMed SMes HomeOmoeiN.Y.,N.Y.</p>
        <p>Wednesdays Sports Baseball</p>
        <p>Conley at Greene Central North Pitt at Eastern Wayne Babe Ruth Carolina Dairy vs. Pepsi-Cola GoU </p>
        <p>Southern G&amp;gt;nference Meet at, Sanford</p>
        <p>Track</p>
        <p>Southern Nash, Nash Central at E B. Aycock  a.</p>
        <p>Softball Gty League Four Seasons vs. Jaycees Parkers vs. Fieldcrest Harbins vs Hardees Hueys vs Siirleys Church League St. James vs Christian</p>
        <p>Toe</p>
        <p>Shoes</p>
        <p>Plain toe, glove leather upper, foam cushion lining in toe, cushioned insole with arch. Brown Neoprene Sole. Sizes 7 to 13.</p>
        <p>11.95</p>
        <p>at Esso ValueCenters.</p>
        <p>Spiilg RaifatBr Service.</p>
        <p> Drain radiator.</p>
        <p> Put in up to 2 galions of Atias Perma-Guard year-round cooiant.</p>
        <p> Visuaiiy inspect radiator, cooiing system hoses and aii belts.</p>
        <p> Pressure-test cooiing system.</p>
        <p>AUasMfeMc</p>
        <p> An economy tire with four full plies of sturdy nylon cord.</p>
        <p> A good "second car"</p>
        <p>tire for around-town driving.</p>
        <p>with trada-fn, plua $2.12 Fad. Ex. Tax for 775-14 tubalasa whitewall.</p>
        <p>Wheel BabiidR&amp;amp;</p>
        <p>Awhttltfor</p>
        <p>%|97</p>
        <p>2 wheels for $2.97</p>
        <p>Includes weights.</p>
        <p>Helps correct a common cause of vibration and tire wear.</p>
        <p>Its a good idea to make sure your battery is still delivering full power after rough winter driving. Well be glad to give your battery a free spring check-up. It only takes a minute and it couid save you some problems later on.</p>
        <p>AUasPlycron</p>
        <p>Our best-selling tire. Four-ply rayon cord. Wrap-around tread.</p>
        <p>with trada-ln,</p>
        <p>--plua  $2.00</p>
        <p>Fad. Ex. Tax for B7S-14 tubalaaa whitawalt.</p>
        <p>CREEL</p>
        <p> for----</p>
        <p>Pi."</p>
        <p>uhimissmmer of ubm</p>
        <p>30 YEARS EXPERIENCE  IN DEPARTMENT OF US "</p>
        <p>Your vote and support will be appreciated DEMOCRATIC PRIMARY MAY 8</p>
        <p>r  e A  e e  A # Tb * * A e e  *  e   A A * # *If  2*2  *  *5*252  A  *    #  *  ^  ^</p>
        <p>Atlas2plus2BeHBd</p>
        <p>taw-M. </p>
        <p>ffvnieMiaii</p>
        <p> Two plies of Vieron polyester cord plus two built-in betto of fiberglass cord.</p>
        <p> Low and wide for the sleek, modern look</p>
        <p>wilh 1rada-in,</p>
        <p> __ plua $2.10</p>
        <p>Fad. Ex. Tax for C7S-14 tubalaaa dual whitawalt.</p>
        <p>Tiak,..</p>
        <p>ana</p>
        <p>waaiaeaa</p>
        <p>ma NANV;</p>
        <p>wwrawau</p>
        <p>FaHhMa^l</p>
        <p>k8</p>
        <p>So-ti</p>
        <p>AlNGfiCGN MoSOfSlBGfS.</p>
        <p>siw</p>
        <p>ika.i3</p>
        <p>C4M4H. Fe,(. FatcoM.</p>
        <p>27.98</p>
        <p>1.</p>
        <p>Pk-14</p>
        <p>a4ft.i4</p>
        <p>Own ti'4. cN|mhm. aa4ci&amp;gt;H. VHHHH. noMtaes</p>
        <p>.ao</p>
        <p>EUma</p>
        <p>aw-14</p>
        <p>i.a</p>
        <p>RmT</p>
        <p>Pfa-14</p>
        <p>73*-14</p>
        <p>7T*-14</p>
        <p>Chawa. C(iar ii'a. CamaH.</p>
        <p>28.88</p>
        <p>tJ4</p>
        <p>t."</p>
        <p>t))a.</p>
        <p>aaa-15</p>
        <p>Fatnanaa. XlraalfUa.</p>
        <p>I.W</p>
        <p>D4.is</p>
        <p>m-15</p>
        <p>*.A</p>
        <p>mw</p>
        <p>fTin</p>
        <p>ipactaia</p>
        <p>na-u</p>
        <p>aapn"</p>
        <p>DoJaaa. X-a&amp;gt;'a. FarUt.</p>
        <p>34.88</p>
        <p>tM</p>
        <p>Ha-11</p>
        <p>ai-i</p>
        <p>i.</p>
        <p>ML</p>
        <p>MAieCaiiters are Esso statkms vvhere you see IMe rigns.</p>
        <p>The abore pdcee on thee and aeivioee am avrihble nebonelly at sMions opaled by Humbfo 01A Rafining Compwiy lcalad in nwny fnriropolHai^iraas and conVnunities. Prices Id offom mayvwyatpertidpetinginclependsnt&amp;amp;iodoriem</p>
        <p>'Al*^Wtron^VicrOB  Mil..roliV|&amp;gt;w.jp&amp;lt;iord'  U:S OH . AiIm  TMA&amp;gt;(a.]WvCompw,.</p>
        <p>ThaMuaOaw liAnaaw isaiuia TNawfatanL^ opamrfbyHuwaiaOSS MiparMliiEw&amp;gt;daaaia FWWng Company.</p>
        <p>Chaigs it and take</p>
        <p>aaanaafli n -</p>
        <p>nwnoisr^</p>
        <p>tOw</p>
        <pb facs="00091594_0009" />
        <p>Th Worry Clink</p>
        <p>The Politician Statesman</p>
        <p>Alan la like hundreds of other loyal teadiers edio wish to preserve this Republic. For we have too few statesmen In Congress! Ifooes was a prophet bia Aaron was a pendan. SUtesmen are propheU; not legislative chameleoos!</p>
        <p>By GEORGE W. CRANE Ph J).. M.D.</p>
        <p>Case T-seS: Alan G.. aged 28, is a dynamic Qvics Teacher in high schooK Dr. Crane, he began, *T have used almost 200 copies of your newspaper booklet on the 10 Common Fallacies in Logic</p>
        <p>and Political TVicks/</p>
        <p>For some of my seniors will be old enod^ to vote at our next election.</p>
        <p>^Antf most of these young people can think very logical^ if they are exposed to the facu on both sides k issues. ^ But I am glad you aK^ explained the cmnmon tricks that pditicians oi both major parties often employ to hoodwink voters.</p>
        <p>And I wish youd clarify in your column the.j^ifffrence between a politician vs. a statesman.</p>
        <p>Meses Vs. Aarae  When  my oldest son, Dr. Philip</p>
        <p>Tlwre Is an old adage that says M. dat, fo^er American a itateaman is thlnkii^ of the History professor, was elected to next generation, while a Congress S yoars ago, he was politician is concerned oidy with warned by his callMgiies: the next election!  "The  major concern of every</p>
        <p>^ Congressman should be his own reelectioo!</p>
        <p>RewasnH ur^ to consider</p>
        <p>DEEDS</p>
        <p>GOREN ON BRIDGE</p>
        <p>BY CHARLES H. GOREN</p>
        <p>I e Iflit Sy TM CMcNt TritaMl</p>
        <p>East-West vulnerable. South deals.</p>
        <p>NORTH A Jf832 ^ Void 0 Its 8 3 AA988</p>
        <p>WEST  EAST</p>
        <p> Void  *84</p>
        <p>V? A J It 7 5  K Q S 8 0AQ6I  0 7 54</p>
        <p>^ * 10 73  *KS5r</p>
        <p>SOUTH * A K Q 10 7 5 'T 843</p>
        <p>North 4 *</p>
        <p>Pass</p>
        <p>East</p>
        <p>5 ^ Pass</p>
        <p>(y;</p>
        <p>0 K J * J2</p>
        <p>The bidding:</p>
        <p>South West 1 *  2 ^</p>
        <p>5 *  Dble.</p>
        <p>Pass</p>
        <p>Opening lead: Ace of</p>
        <p>Altho East and Wests five heart contract could have been defeated by one trick, defensive prospects did not appear favorable to South after his partner jumped to four spades. South persisted to five spades and with the assistance of some well calculated sleight of hand, managed to make his bid stand up for a profit on the deal.</p>
        <p>West opened the ace of hearts which was ruffed in dummy with the deuce of spades. Prospects appeared reasonably favorable to declarer, for if either the king of clubs or the queen of diamonds were favorably located, he could expect to hold his losses to two tricks in the minor suits. The only threat to his contract would arise if the club finesse lost to East and when the latter shifted to a diamondWest turned up with both the ace and queen.</p>
        <p>Inasmuch as he had no objection to losing a club trick to West, since the latter cannot launch a profitable attack against Souths diamond holding, the ace of clubs was cashed at trick two. East played the five. South the deuce and West the three. A small club was continued and if appeared to East that declarer was about to embark on a crossruff in hearts</p>
        <p>The (ireoteiit Concert of the Decade!</p>
        <p>\(m YOi: CAN SEE IT AND HEAR IT...</p>
        <p>.\S IF YOU WERE THERE! in sftrwwphonk sound</p>
        <p>PITT</p>
        <p>MSCVAMtTMn</p>
        <p>Returns!</p>
        <p>lor o</p>
        <p>SPECIAL UMITED ENCACEMENT!</p>
        <p>I</p>
        <p>UlXwriMM</p>
        <p>GCOWCC</p>
        <p>SCOTT</p>
        <p>farmrroir</p>
        <p>PITT</p>
        <p>and clubs. He therefore followed with the four, however to his surprise. South did not trump but produced the jack instead, which won the trick.</p>
        <p>Declarer ruffed his two remaining hearts in dummy and eventually led a diamond toward the king-jack. West turned up with both missing honors., but those were the only two tricks won by the. defense and South chalked up his doubled contract. Observe that had West turned up with the king of clubs. Norths queen becomes established  for an</p>
        <p>eventual diamond  discard</p>
        <p>and declarers contract is still safe.</p>
        <p>East was admittedly placed in an uncomfortable situation at trick three, but there are defensive signals available to help  partner</p>
        <p>count the distribution of a suit led by the decider. With an odd number of cards, a player follows with his lowest card. With an even number, it is proper to echo in the suit.</p>
        <p>Observe that when the ace of clubs was led, East played the five. He followed to the next club with the four to give his partner a count. Had he payed equal regard to Wests play in clubs. Souths subterfuge could have been exposed. In other words, if the deuce of clurs is a singleton, then West began with the J-10-7-3  and when the ace is cashed, the proper play front this holding is the seven. 'Hiis is the beginning of an echo to show an even number in the suit.</p>
        <p>When West followed suit to the ace of clubs by playing the three, he was showing an odd number, which in the present case could only be three. It is proper therefore to put up the king of clubs inasmuch as declarer must have another club, which may be the lack. When the king of clubs wins the trick, the diamond shift becomes marked and Souths., cleverness goes for naught as the defense cashes out three tricks.</p>
        <p>Admin, of Veterans Affairs to Tarhed Homes * Realty, Inc. 10.00</p>
        <p>Ltxxie WUliams Adams to Roy Beacham, al 10.00 M.. O. Blount Sons, Inc. to Jesse B. Bullock, al 10.00 M. K. Branch, al to Tarheel Hom^ A Realty. Inc. 10.00 Jeake B. Bulkok, al to F. L. Blount, Jr. 10.00 Elva F. Hikklock to Joseph A. Tallmon, al 10.00 S. Reynolds May, al to Margaret M. Dyer 10.00</p>
        <p>D. G. Nichols, al to John Robert Hazlett 10.00</p>
        <p>Ben F. Walston, al to E. Glenn Midyette, al 10.00 Jennes Floyd Coggins, Jr., al to Clemmie Flake Tyson 10.00 Anthony M. Futrell, al to Nelson W. Oldman, al 10.00 Robert Hill C&amp;lt;mstruction, Co. to Willie Ray Moye, al 10.00 Myrtle G. Pierce, al to J. J. Perkins 10.00 Joseph Andrew Valerio, al to Margherite V. Manoly 10.00 Arco, Inc. to John L. Causey, al 10.00</p>
        <p>Richard E. Grimes, al to Joseph D. Briley, al 10.00 H. Glenn Hardee, al to S. D. Trevin, al 10.00 Eunice P. House to Andrew Grover Peadin 10.00 R. E. Manning, al to J. Overtmi, al 10.00 S. Reynolds May, al Greenco Investors 10.00</p>
        <p>E. W. McGowan, Jr., al John R. Rouse, Jr., al 10.00</p>
        <p>J. W. Tyson, al to Jewell H. Vandiford 10.00 L. W. Andrews, al to Connie E. King, al 10.00 Cena Garris Branch to Charlie S. Smith 10.00 Robert H. Coggins, Jr., al to Robert H. Coggins III, al 10.00 Martha Irma Fleming to Redevelopment Comm, of GreOTvil|e 10.00 R. Guy Mayo, Jr., al to Elliott Marston Carrow 10.00 W. S. Moye, Jr., al to James T.</p>
        <p>Cheatham, Al 10.00</p>
        <p>Mary 'Thorne Williamson to Lyman Earl Tyson 10.00 William G. Blount, al to Frederick C. Lewis, al 10.00</p>
        <p>R. E. Deans Oil &amp;amp; L. C. Gas, Inc. to Harry J. Byers, Inc. 10.00 John B. Eason, Jr., al lo</p>
        <p>the future safety of our famous ReptmUc.</p>
        <p>Nor of the bM interests of the</p>
        <p>Gerald W. TugweU, al lO.OO James H. Hiring, al to Edward B. Bright, al 10.00 Robert Hill Construction Co., Inc. to Bobby G. Hedgepeth, al 10.00</p>
        <p>Home Builders Sui^y Co. to Jimmy B. Whittington 10.00 S. Reynolds May, al to Neal Williams, al 10.00 S. Reynolds May, al to David Lee Williams, al 10.00</p>
        <p>R. Guy Mayo, Jr., al to Louis H. Elks, al 10.00 Oakdale Development Co. to Stanley Eugene Morgan, al 10.00</p>
        <p>TV Log</p>
        <p>WNCT </p>
        <p>TUSSOAV "</p>
        <p>7 00 truth</p>
        <p>Ch. 9</p>
        <p>t;M Tim*lv 1:30 World</p>
        <p>Tip*</p>
        <p>Turn*</p>
        <p>w.</p>
        <p>7:30 Glen Cmpt&amp;gt;tl 2 00 Spttndortd</p>
        <p> 30 Ttrry Sanford 2.30 GuidinO Lipht</p>
        <p> 30  Cannon  3  OO  Secret Storm</p>
        <p>10 30  Primaries  3  30  Edge of Night</p>
        <p>11 00  Final Report  4  00  Guide To Love</p>
        <p>11.30 Movie  4 30 Sanana Split*</p>
        <p>WIONSSDAY ___5.00 Hogan *</p>
        <p>4 30 Carolina  Heroe*</p>
        <p> 15  Lucille River*  S  X  Green Acre*</p>
        <p> 25  Meditations  5  55  Paul Harvey</p>
        <p> 30  New*  4  00  New*</p>
        <p>9 00  Capt Kangaroo  4  W  New*</p>
        <p>10:00 Lucy Show 7.00 Truth 10 30 My 3 Son* 7:30 Golddigger* 11:00 Family ANair  00 Carol Burnett 11:30 Love Of Life  00 Med Center</p>
        <p>12:00 Noon New* 12:30 Search 1 00 The Heart</p>
        <p>10 00 MsnniK</p>
        <p>11 30 Movie</p>
        <p>to</p>
        <p>to</p>
        <p>wiTm </p>
        <p>TUESDAY</p>
        <p>Ch. 7</p>
        <p>7 00 Jeannie 7:30 Movie</p>
        <p>9 30 Nichols</p>
        <p>10 30 Sportsman 11:00 News</p>
        <p>11:30 Tonight Show 1 00 New* WEDNESDAY 4:00 Agriculture 4:30 Get Snoart 7:00 Today Show 7:25 Down to Earth 7.30 Today Show 9:00 Virg Graham 10:00 Dinah's Place 10 30 Concentration</p>
        <p>11 00 Sale of Cent W New* 11 30 Hollywood Sq I 5</p>
        <p>1.00 New*</p>
        <p>WCTI</p>
        <p>12</p>
        <p>TUESDAY</p>
        <p>7:00 Gilligan 7 :30 Mod Squad  30 Movie 10:00 Marco* Welby 1:00 News 11: M Dick Cavett</p>
        <p>WEDNESDAY</p>
        <p> 00 Romper Room</p>
        <p> 30 New Zoo</p>
        <p>9:00 Rainbow Ridqe</p>
        <p>9:30 Montage 10:30 Movie Game 11:00 Love Amer Style</p>
        <p>11:30 Bewitched 12:00 Password 12:30 Solit Second</p>
        <p>imiiiHiiiHHniHiHnmHV</p>
        <p> 8 HhWAY 264 S</p>
        <p> 8 PLAYHOUSE S SS THEATRE S</p>
        <p>iEtlMmHIIBA</p>
        <p>SHOW TIMES DAILY MON.-SAT. SUNDAY 6:04  2:00</p>
        <p>7:40  3:40</p>
        <p>*:10  5:10</p>
        <p>6:40 0:10</p>
        <p>NOW SHOWING TAROUK UNIVERSITY</p>
        <p>Iki</p>
        <p>ive Tonight!</p>
        <p>'Ask Terry Sanford</p>
        <p>Bple Rmtnts</p>
        <p>GEORGE HARRISON</p>
        <p>oh^friaiidi in</p>
        <p>THE</p>
        <p>CONCERT FOR BANGLADESH</p>
        <p>Now Thru Tut /All Stats $1.75 N9 Passts 2:30 4:30</p>
        <p>iJiSi</p>
        <p>Talk direct by phone with PRESIDENTIAL CANDIDATE Terry Sanford. Ask Terry about the issues that you care aboutthe issues that face North Carolina and the nation.</p>
        <p>Call COLLECT (7M) 332-1271</p>
        <p>between 8:30 and 9:30 tonight. Ask Terry Sanford. Hear his answers on statewide television.</p>
        <p>Live at S-IORM.</p>
        <p>CHANNEL9-WNCT CHANNEL 2-WFMY CHANNELII-WTVD CHANNELB-VfBCT CHANNEL 3-WBTV  CHANNEL 7-WSRA</p>
        <p>:ftW for lay tot of Psopio for Torry Sanford.</p>
        <p>whole, vs. its diverte votng parts.</p>
        <p>Nor of the rednctiop in oar h^theovy federal debt.</p>
        <p>Nor of the threat to our luxuriotti free enterprisa. system of the sooining milliom who now ere on the ba^ the hard worfch^ ta^wyers.</p>
        <p>AUtt, at preeent every woricer must not only try to stqipiMl his own family.</p>
        <p>advoeatea measures that are not immedbdely popular or quick votegettcrs Moaee thus brought down the tables of itaiie with Gcds Ten Commandments inscribed thereon. _</p>
        <p>But the people meanwhile murmured against him while he was communing with God and finally turned to Aaron, saying:</p>
        <p>But then every 6 employed persons are also forced to siqiport a noowwker and the tatter's entire family on welfare!</p>
        <p>So we need a few more true statesmen in our legislatures!</p>
        <p>Moses and his brother Aaron typify the Terence between a statesman vs. a selfish poUtician.-For a statesman is a legislative prophet!</p>
        <p>He kxdcs far ahead and often</p>
        <p>Up, make uf -^)ds, which sh^ go before u8; for as for this Mcms, the man they brought us up out the iaiKl of Egypt, we wot not what has become of him.</p>
        <p>Moses was the George</p>
        <p>Ike Dally RcAecfor, GrecaviOe Washington who had freed thoae same Israelites from abject bondage!</p>
        <p>Aaron, as the brotlier of Maeea. was suppoeedly tw Chief Priest of Jehovah.</p>
        <p>But Aaron was more interested in keeping his job that in4nje religion.</p>
        <p>As long as be could be the tip priest, he didnt care if he served Ood or an idol, so he ordered tlw peo|rfe to bring all their gold ornaments, which be melted down to f&amp;lt;nm the Golden Calf.</p>
        <p>Selfish politicians will likewise kill the gooee that lays the golden eggs just to win in the</p>
        <p>N.C.Ikesday. May 2. 1872 neid election.</p>
        <p>Statesmen oppose unwisa vrelfare! They try to save our free enterprise system!</p>
        <p>Send for my booklet Qsmmon Falladet in Logic and Pditical Tricks, enclositig a long stampad, return envetope, (dus 25 cenU.</p>
        <p>(Always write to Dr. Crane in care of this newspapo*, eh-doemg'll long stamped addressed envelope and 25 cents to cover typing and printing coata when you send for one of his booklets.) Copyright 1872.</p>
        <p>CINEMA</p>
        <p>. MEAoowmgw</p>
        <p>END* TONIOHT</p>
        <p>Union Mooting Bogins Friday</p>
        <p>AYDEN ^ District Three Union meeting of NE B Diviskm Conference will meet in a joint union at Little Creek Free Will Baptist Church beginning Friday ni^t.</p>
        <p>Services will continue through Sunday. Districts Three and Four will be in charge of Sunday food.' -</p>
        <p>Elder J. E. Phillips is president, Thepublic is invited to attend.</p>
        <p>HflTtfl tittWILLI NOW SHOWtNO</p>
        <p>THE THINGS THAT TEEN-AQC QIRLS LEARN IN SCHOOL.. THAT ARENT IN BOOKSI</p>
        <p>YOU CAN T</p>
        <p>PREACH PEACE ,WHENA</p>
        <p>S</p>
        <p>STKKIN' A BLADE IN</p>
        <p>YOUR GUT'</p>
        <p>7f5f&amp;gt;-OOH8</p>
        <p>SHOCKING! TRUE!</p>
        <p>SHOWS DAILY 1-3-5-7.f DOORS OPEN 12:30</p>
        <p>12 00 Jeopardy 12 30 Who, What 12:55 NBC New*</p>
        <p>1:00 Evary Wornanrt</p>
        <p>1 30 on a Match</p>
        <p>2 00 Our Live*</p>
        <p>2 30 The Doctor*</p>
        <p>3 00 Another World</p>
        <p>3 30 Peyton Place</p>
        <p>4 00 Somer*et</p>
        <p>4 30 I Love Lucy 5.00 Big Valley 4:00 New*</p>
        <p>4:30 NRC New*</p>
        <p>7:00 Virginian  :30 Hall of Fame 10:00 Night Gallery</p>
        <p>I learned that if hw DON'T kJATCH WHERE VOU'RE 601N6, MW CAN 6ET KNOCKED DOWN IN THE HALL...</p>
        <p>AND I AL$0 learned THAT TNE DRINKIN6 FOUNTAIN 15 our OF ORDER!</p>
        <p>/ C '</p>
        <p>fzi_____S3</p>
        <p>f </p>
        <p>? li ^ !i</p>
        <p>IT'$ NOT often that MOO CAN LEARN two NEuI ThiN6$ IN ONE RAM!</p>
        <p>B. C.</p>
        <p>HBKes f^AFPUCATICN P0R W (JfHBAPOYMENT CH6CK.</p>
        <p>T</p>
        <p>1 00 My Children</p>
        <p>1 30 Make A Deal</p>
        <p>2 00 Newlywed Game</p>
        <p>2 30 Dating Game 3:00 Gen Ho*p</p>
        <p>3 30 One Lite</p>
        <p>4 00 Theatre 5:55 A*k Will C 4:00 New* 12</p>
        <p>4 30 ABC New*</p>
        <p>7 00 Gilligan</p>
        <p>7:30 La*sic</p>
        <p> 00 Eddie'* Father</p>
        <p> 30 AAovie 10 30 Election 11:00 Ncvr*</p>
        <p>11:30 Dick Cavett</p>
        <p>.. WHAT KlisP OP WC7RK</p>
        <p>ir</p>
        <p>4'</p>
        <p>youfze lccxN&amp;gt; at IT</p>
        <p>r</p>
        <p>43</p>
        <p>( i-iERB bought T TOOTSIE A NEW COAT AND I WAMT y YOU Tt) GET ME ,</p>
        <p>ME MUSTVE MEA5D J ABOUT Tt-lE COAT j</p>
        <p>Y W</p>
        <p>BEE</p>
        <p>T L E B A</p>
        <p>T SAR6g. the umbrella</p>
        <p>ioLOANED TO</p>
        <p>the chaplain-</p>
        <p>THE PHANTO M</p>
        <p>IMAGME IF THAT FIRE BOMB HAP HIT S-TOHS OF OIL</p>
        <p>HAP HP</p>
        <p>THIS BREEP OF PIRATES GOT 42 MILLION CASH MOT TO FIRE-BOMB THE OIL TANKER</p>
        <p>ON ^</p>
        <p>JULIET i O N E S</p>
        <p>HE'5 W8TEP UP SO BAPLV-SAVING OtlR HECKS ANP THAT feK^R*OF lORS- THAT HEU HEVER PLAY FOOT- .OALL AOAW/'</p>
        <p>}</p>
        <pb facs="00091594_0010" />
        <p>Mr Iltaciw. GreenvUie. N.C.-Taesd*y. May 2. 1*72 fOUECAST FOR WEDNESDAY. MAY 3,1972</p>
        <p>[lyMlWLl. ItKIHtBlt'S</p>
        <p>from the Carroll Righter Inttitiite</p>
        <p>GENERAL  TENDENCIES; Do nothing  today</p>
        <p>or tonight  that  is unconventional or  make</p>
        <p>siiddeh changes or take any risks By going along with those in high* office and lowing your ability to follow proven methods you will be  able to accomplish a  great deal today</p>
        <p>ARIES  (Mar. 21 to Apr  19)  Contact persons in high  places</p>
        <p>and gain the backing you desire at this time Avoid associates who like, to argue. Put your best, courteous manner to use and accomplish a great deal.</p>
        <p>TAURUS (Apr 20 to May 20) Study new ideas that may mean a change is in the offing, but dont put in operation now. Use your ingenuity to obtain the data that you need. Show that you are a capable person</p>
        <p>GEMINI (May 21 to June 21) Take care of your responsibilities instead of going off on a tangent Find the right garments that wiir enhance your appearance. Show</p>
        <p>CROSSWORD PUZZLE</p>
        <p>ACROSS</p>
        <p>I. Coffee houses 6. Too bad 1C. Mute 11. Glove leather IS.Sonret 14. Tyrannical Id Bargain</p>
        <p>18 Protein food</p>
        <p>19 Six</p>
        <p>20 Russian union 22 Myself</p>
        <p>23. Espoused 24 Convex molding 26 Red planet</p>
        <p>27 Frenry 29. Pungent vegetable</p>
        <p>31 Some</p>
        <p>32 Silver symbol</p>
        <p>33 Withered 36 Palm lily 97 Exchange</p>
        <p>premium 59 Russian river 40. Infinitesimal 43. Color</p>
        <p>44 Smooth</p>
        <p>45 Masonic doorkeepers</p>
        <p>47 large dog</p>
        <p>48 Shabby</p>
        <p>Qsina QQOCdQ QSBS QSBD OS SaBQQOilQ DBS</p>
        <p>QBQ BBCS QBBIS BBSS QBQ BBS QDQB mm BQ BQBBDBQB BQ] QQQB BBBB BQBBaa QBBB SQBBca QBtaa</p>
        <p>SOLUTION OF YESTERDAY'S PUZZLE</p>
        <p>DOWN</p>
        <p>1 Apple drink</p>
        <p>2 Unpredictable</p>
        <p>r-</p>
        <p>r~</p>
        <p>M</p>
        <p>6</p>
        <p>T</p>
        <p>8</p>
        <p>9</p>
        <p>i6</p>
        <p>71</p>
        <p>12</p>
        <p>li</p>
        <p>S</p>
        <p>15</p>
        <p>u</p>
        <p>fir</p>
        <p>!5</p>
        <p>P</p>
        <p>i9</p>
        <p>ir</p>
        <p>IT</p>
        <p>!T</p>
        <p>Ib</p>
        <p>Sr</p>
        <p>If</p>
        <p>W</p>
        <p>1</p>
        <p>w</p>
        <p>JM</p>
        <p>55 .</p>
        <p>BY'</p>
        <p>J</p>
        <p>mu</p>
        <p>. . i J</p>
        <p>W</p>
        <p>ir</p>
        <p>Hi</p>
        <p>It'"1</p>
        <p>a*</p>
        <p>3|-</p>
        <p>** Hmmttmrntvf**</p>
        <p>5 2</p>
        <p>3. Iron symbol</p>
        <p>4 Finale</p>
        <p>5 Stalk</p>
        <p>6. Plent]^</p>
        <p>7 Glance</p>
        <p>8 Take steps</p>
        <p>9 Shudder 10. Soft drink 12. Corrosive</p>
        <p>agents 15 Tanner of Joppa 17. Tax 21. Behold 23. Roamed</p>
        <p>25. Reason</p>
        <p>26. Lament</p>
        <p>27. Deadly 28 One 30 Maybe 32; Sprightly 24 Each</p>
        <p>.5 Papas .37, So be it 38. Horse food 41, Eggs ^42. Falsehood 46 French article</p>
        <p>devotion to mate tonight. Take health treatments.</p>
        <p>MOON CHILDREN (June 22 to July 21) Try and pursuade associates to approve a fine plan you have. Taking unnecessary risks can put you in a bad situation, so doublecheck before taking action. Relax at home tonight.</p>
        <p>LEO (July 22 to Aug. 21) Proi^ed you-exerciae care'in motion of all kinds, you can get mucb accomplished today and tonight. A health treatment may be expensive but well worth if and will bring out the real you.</p>
        <p>VIRGO (Aug. 22 to Sept. 22) You can engage in amusement you etyoy provided you are not extravagant. You have been in a rut for so long you need a change right now. Use utmost care in travel in (he evening.</p>
        <p>LIBRA (Sept. 23 to Oct 22) You have fine talents you can commercialize on, but be tactful in dealing with others. Listen with care to what higher-ups have to say. Await a better time before making any changes.</p>
        <p>SCORPIO (Oct. 23 to Nov. 21) A good day to prove to associates that you want to continue the relationships far into the future. Forget worrying about the motives of others. Carry through with your own SAGITTARIUS (Nov 22 to Dec 21) Convince your associates that you want to continue the relationships far into the future. Dont take any risks and avoid trouble. Follow the advice of business experts.  '  .</p>
        <p>CAPRICORN (Dec. 22 to Jan 20) Follow your own intuition before you go to a bigwig for a favor you have in mind. Your judgment is good now so follow it. Make sure you behave in an orthodox fashion.</p>
        <p>AQUARIUS (Jan 21 to Feb 19) You need to be better prepared before you engage in a new activity that appeals to you. Study all available data. You have fine new ideas, but first get the advice of a specialist-</p>
        <p>PISCES (Feb to Mar. 20) Rather than fuss and fume over some responsibility, go out and visit with a good friend or an older person of wisdom. You can gain personal aims earlier than you had thought possible</p>
        <p>IF YOUR CHILD IS BORN TODAY . . he or she wUl be one of those wise persons who understands the importance of using accepted procedures but will from time to time go off on a tangent. This can be avoided by more strict application, listening to the words of higher-ups and following their guidance. Ethics and religion should be taught early in life. Sports should not be too strenuous, since your progeny is somewhat delicate Music and art are fine here.</p>
        <p>The Stars.impel, they do not compel  What you make of your life is largely up^to YOU!</p>
        <p>Carroll Righters Individual Forecast for your sign for May is now ready. For yovr copy send your birthdate and $1 to Carroll Righter Forecast (name of newspaper). Box 629, Hollywood, Calif. 90028</p>
        <p>((c) 1972, McNaught Syndicate, Inc )</p>
        <p>Playhouse Plans Drama</p>
        <p>A classic drama of the roodom South, Tennessee Williams* **The Glass Menagerie is next on stage for the East Carolina University Playhouse at McGinnis Auditorium.</p>
        <p>Playhouse manager Mike Hardy, in announcing the next IMt&amp;gt;duction, reveals that the play will open on May 10 and continue through May 13 with a special matinee on May 11.</p>
        <p>0&amp;gt;nsideijed by many critics to be the finest play by one of Americas greatest limg playwrights, The Glass Menagerie has consistently appealed to playgoers throughout the U.S. Each season brings new productions of this poignant drama of a family caught up in the web of human conflicts between a mother, her son and her daughter.</p>
        <p>Tickets are $2.00 for the general public, with a special price of $1.00 per person in groups of 20 or more. Curtain time for evening peHbrmances is 8; 15 p.m. and for the Thursday matinee, 2:15 p.m.</p>
        <p>Classified Ads</p>
        <p>OFFICIAL VISIT MIAMI, Fla. (AP)  Prime Minister Fidel Castro will make a friendly, official visit to the Reiniblic of Guinea in early May, according to Radio Havana.</p>
        <p>When J3he5 bought a new 'sooper</p>
        <p>gMlTM HAD PLENTV TQ GAV -</p>
        <p>/ VOU'lL be SORRVr VOUU&amp;gt;</p>
        <p>' GO BROldE PEEDING IT waitll'fOU TRV TO PARI&amp;lt;</p>
        <p>IT.'A dented PENDER WILL wou A FORTUNE!</p>
        <p>R#| U $ F| Oft All ngNli rtM'VSd</p>
        <p>C 1972 by  Fmiu'#  ln&amp;lt;</p>
        <p>TAOIOCK INSURANCE AGENCY</p>
        <p>i</p>
        <p>322 Evans Streat Grtanville. N.C. 27834 758-1165</p>
        <p>INSURANCE FOR</p>
        <p>HOME</p>
        <p>BUSINESS " AUTO</p>
        <p>T</p>
        <p>&amp;gt;</p>
        <p>Q.</p>
        <p>(/)</p>
        <p>_ e</p>
        <p>Q</p>
        <p>&amp;lt;'</p>
        <p>(D</p>
        <p>Until smith dqove up in MIS NEW^kJMB. NOW listen-</p>
        <p>NOTHING LINE ITON THE ROAD'</p>
        <p>sjHE BiGGEsr.' THE Bcsr.* SMMAMSieST.*</p>
        <p>irOH^iOH'S AW:</p>
        <p>' A FOUV OW cOWE A PePEOlNG ON GARAGE IT'S kEPT IN "</p>
        <p>^(Say'Grand")  M</p>
        <p>Grande Canadian.</p>
        <p>From the last North American frontieE.</p>
        <p>Brady To Direct Bowles' Drive</p>
        <p>Don Brady, recently elected president of the Greenville Jaycees, has been appointed Pitt County precinct chairman ftrt* Hargrove Skipper Bowles Democratic candidate for governor.</p>
        <p>According to Mac MacKenzie, Pitt campaign chairman, Brady will supervise over 50 volunteer precinct workers in the county on May 6.</p>
        <p>Brady served as Jaycee state vice president during 1971-72 and has been recognized in the top ten Jaycees on a state level for Spark Plug competition during each of the past three years. ^Al38rplduatr^1rcrS!ate Universky with a B.S. degree in engineering, the precinct chairman is an independent building contractor in Greenville. He is a member of Oak-mont Baptist CTiurch.</p>
        <p>Bowles Director For Farmville</p>
        <p>FARMVILLE  Marvin Speight Jr. has been named director of the Bowles for Governor campaign in the Farmville community.</p>
        <p>Bowles announced Speights appointment to the post last week.</p>
        <p>Speight is chairman of the titt County Planning Board and serves on the Farmville planning board and the Mid-East Economic^ Development Commission.</p>
        <p>The Farmville businessman  an oil dealer and owper of an automobile parts store  has extensive interests in the Emerald mle area and has swved several terms on the Emerald Isle town board and is currently mayor pro tern of that coastal community.</p>
        <p>iifiHTY Pioof 6^ cmm wpont co^mmK i. y.</p>
        <p>Many Traffic Deaths HAIFA, Israel (UPI) -The top cause of violent deaths among Israelis in the past five years.,-a period, iaciiiding the 1967 Middle Elast War, has not been Egyptian gun shellfire or Arab guerrilla attacks.</p>
        <p>Officials statistics show that while 1,^1 died in combat nr were kiUed by enemy fir&amp;lt;^ in the half ^ade ended Jan. 1, almost twice as many 2,419  were killed on the highways,</p>
        <p>, half of thn pedestrians. |</p>
        <p>O</p>
        <p>c</p>
        <p>Win ofl. m  May; if</p>
        <p>13:00 o'clock noon^ot tho door of the Pitt County eOurthouM, Groinvillc. North Cirolina offer for Mie fo^ttie highest bidder for cash all that certain lot or parcel of land more particuiariy described as foltows, to wit;</p>
        <p>Lying and being situate in the City of Greenville, Pitt County, North Carolina, and located on the east side of Nash Street between Ward Street and Fifth Street and beginning at point on Nash Street 90 feet from the south edge of Ward Stretf, the south west corner of Lot No. t in B|ock"P of the Rivcrdale Subdivision and running thence eastwardly with the southern line of Lot No. 1,100 feet thence southwardly with the western line of L&amp;lt;h No. 10, 45 feet; thence westwardly with the northern line of Lot NO. A, 100 feet to Nash Street thence northwardly and parallel with Nash Street 45 feet to the point of beginning and being all of Lot No Block "P" of the Riverdate Sub division, as shown upon plat of record in AAap Book No. 2, at Page 251, in the ptficeof the Register of Deeds of Pitt County and further being the iden tfcal lot described in and conveyed by that certain Deed of Record in Book F 30, Page 507, in the .office of the Register of Deeds of Pitt County to which Deed reference is hereby directed tor a more complete and accurate description.</p>
        <p>This sale will be subject to Pitt County and City of Greenville 1972 Ad Valorem Taxes. The highest bidder at this sale shall be required to deposit ten per cent (TO percent) of his bid as evidence of good faith.</p>
        <p>This sale is subject to confirmation by the court.</p>
        <p>This the 21 day of April, 1972. s Richard Powell COMMISSIONER s M. E. Cavendish COMMISSIONER April 25; May 2, 9, and 16,</p>
        <p>NOTICE OF FORECLOSURE</p>
        <p>Under and by virtue of the power of sale contained in a certain deed of trust executed by Reuben Edwards and wife, Dorothy Edwards, dated the 6th day of July, 196A, and recorded in Book V 37, page 109, in the office of the Register of Deeds of Pitt County, North Carolina, default having been made in the payment of the indebtedness thereby secured and said deed of trust being by the terms thereof subject to foreclosure, the undersigned Trustee will offer for sale at public auction to the highest bidder for cash at the Courthouse door in Greenville, North Carolina, at 12.00 o'clock noon on the 31st day of May, 1972, the property conveyed in said deed of trust; the same lying and being in the town of Bethel, Bethel Township, State of North Carolina, and more particularly described as follows:</p>
        <p>A lot being in and lying in the Town of Bethel,. North Carolina, Pitt County, and bounded as follows: BEGINNING at corner of J. G. Thomas and wife, and Railroad Street running noftherly with said Thomas line 210 feet to R. D. Whitehurst line, thence with said R. D. Whitehurst line, running westerly 90 feet to corner of S. L. Johnson and wife, lot, thence with the said Johnson line southerly 210 feet to corner of said Johnson lot and Railroad Street; thence with said Railroad Street 90 feet to the beginning, containing 18,900 square feet, and being commonly known as the Paul E. Whitehurst residence and lot.</p>
        <p>But this sale will be made subject to all outstanding and unpaid taxes and assessments.</p>
        <p>The successful bidder will be required to make a ten (10 ) percent deposit to show good faith pending tt^e confirmation of the sale by the Court.</p>
        <p>This the 28th day of April, 1972.</p>
        <p>C. W. Everett, Trustee EVERETT &amp;amp; CHEATHAM Attorneys at Law Bethel, North Carolina May 2, 9, 16, 23</p>
        <p>AUTOMOTIVE</p>
        <p>_Autos  For  Sale</p>
        <p>CAMARO 327, 1968 Automatic, air, power steering, stereo, tape, very good condition. Call 758 2105 after 3</p>
        <p>p.m.</p>
        <p>CHEVELLE 1968 MALIBU, 2 door, hardtop, 307 automatic, with air. $1475. 1965 Chevelle, 4 door Sedan, 6 cylinder, automatic, $475. 1964 Fairlane, 2 door, hardtop, 8 cylinder, automatic, $475. Call 752-2572 day, 752 5245 night.</p>
        <p>AUTOMOTIVE</p>
        <p>AulnEMSul</p>
        <p>VOLKSWAOBN t9M mN*. Ex cellent shape. Newt tirat and clutdi. 4-M150. Call 79MM.</p>
        <p>TOYOTA CORINA, 1971 one owntr,  track tape. Call 75A251S, 75A-2SA4 after A p.m.</p>
        <p>the BIGGEST SELLING SMALL CAR IN EUROPE</p>
        <p>BROiyN-WOOD</p>
        <p>PnfiAC-CBBIlRc-Fit Olckinson Avo  7-7111</p>
        <p>VOLKSWAGEN 19AS DELUXE</p>
        <p>stafionwAgon, (microbus), less 50,000 actual miles, good buy. Call Kinston, 523 1358.</p>
        <p>VOLKSWAOEN I9A4, NEW engine, new transmission. SAOO. 752-3003 after 5 p.m.</p>
        <p>Trucks for Sate</p>
        <p>I9AI FORD PICKUP, long wide body, 8 cylindpr, straight drive. $1500. Call 752-3572 day, 753 5245 night.</p>
        <p>OMC I9A3, truck, long body, excellent condition, SSOO. 752 S30S.</p>
        <p>TWO FORD 19A9 heavy duty pickup and one 19A8 Chevrolet heavy duty pickup. Call 752-71AI.</p>
        <p>Cyctesfor Sate</p>
        <p>Th.  Pov.&amp;lt;</p>
        <p>TRY ! T.</p>
        <p>YOU LL LIK F IT</p>
        <p>STANS SPORT CENTER</p>
        <p>1025 EVANS ST. GREENVILLE, NC</p>
        <p>HONDA, MINi-tRAIL, ideal for ages</p>
        <p>  11,  price  $175.  Call  75A-4324.</p>
        <p>HONDA, AA SUPER HAWK, oartiallv Chopped. Just over 10,000 8Ctul miles. Good condition. $300.00, *752 5836.</p>
        <p>HONDA TRAIL 70, body only motor needs rebuilt, price $45. Call 746 3788 Ayden.</p>
        <p>1969 YAMAHA 250 Scrambler, ex cellent condition, just tuned, 3300 miles. Contact Johnny, Lot 31 Riverview Estates (behind Hastings Ford)</p>
        <p>1971 HONDA, 350 CL.</p>
        <p>after 5 p.m.</p>
        <p>Call 758-3768</p>
        <p>Public Notices</p>
        <p>FOR SALE:  1971 Fleetwood</p>
        <p>Cadillac Brougham, fully loaded; over $10,000 new. Approximately 11,000 miles. Contact 919 946-6521, Washington, North Carolina.</p>
        <p>EXECUTRIX'S NOTICE North Carolina Pitt County</p>
        <p>The undersigned, having qualified  e*mttffxwttw  or ^</p>
        <p>T. Baker, late of Pitt County, North Carolina, this is to notify all persons having claims against said estate to present them to the undersigned on or before the 26th day of October, 1972, or this notice will be pleaded in bar of their recovery. All persons indebted to said estate will please mak^ im mediate payment to the undersigned This the 2nd day of May, 1972.</p>
        <p>Ina B. Whichard,</p>
        <p>Executrix Route 6, Box 13 Greenville, N.C.</p>
        <p>May 3, 9, 16 and 23, 1972</p>
        <p>NOTICE TOCREDITORS North Carolina Pitt County</p>
        <p>The undersigned, having qualified as Executor of the Eestate of Alfred Edward Hardy, deceased, late of Pitt County, North Carolina, this is to notify all persons having claims against said Estate to present them to the undersigned on or before the 3rd day of November? 1972, or this notice will be pleaded in bar of their recovery. All persons indebted to said Estate will please make immediate payment to the undersigned.</p>
        <p>This the 28th day of April, 1972. Sam B. Underwood, Jr.,</p>
        <p>Executor P.O. Box 527 ll6 Courthouse Lane Greenville, North Carolina 27834</p>
        <p>Sam B. Underwood, Jr.</p>
        <p>Attorney at Law 116 Courthouse Lane Greenville, North Carolina 27834 May 2, 9, 16 and 23, 1972</p>
        <p>ADMINISTRATOR'S NOTICE North Carolina Pitt County</p>
        <p>The undersigned, having qualified as Administrator, of the Estate of Pattie Grimes, late of Plft County, North Carolina, this is to notify all persons having claims against said estate to present them to the undersigned on or before the 11th day of October,' 1972, or this notice will be pleaded in bar of their recovery. All persons indebted to said estate will please make Immediate paymenr. This the 7th day of April, 1972.</p>
        <p>D. D. Garrett Administrator 606 Albemarle Ave.</p>
        <p>Greenville, NX.</p>
        <p>April n, 18, 25, May 2</p>
        <p>NOTICE North Carolina Pitt County Under and by virtue of an Order 6f the Superior Court of Pitt County, 8de  4^</p>
        <p>eritifled "William Robert Wilkins, Petitioner, vs. Sally Marie Reeves Ebron and husband, Charlie Ray Ebron, and W. W. Speight, Substitute Trustee, and Home Savings &amp;amp; Loah Associatjon of Greenville, Respon dents", the same being pile No. 73 SP 12, the undersigned Commissioners</p>
        <p>CHEVELLE 1968, 4 door station wagon, V 8, automatic transmission, power steering, 14,000 miles, clean, $1250. By Owner. 756-3913.</p>
        <p>CHEVROLET 19M WAGON, Bel Air, automatic transmission, new tires. By Owner. 756 0811.</p>
        <p>HASTINGS FORD has daily rentals at reasonable prices. Call 758-P114.</p>
        <p>CHEVY II 1971 Nova. 4 door, Sedan, radio, heater, automatic, 6 cylinder, white wall large wheel covers, blue,</p>
        <p>Chevrolet, 756-2150.</p>
        <p>COUGAR 1967, 2 door hardtop, air condition, extra clean. $1395. Holt-Oldsmobile, 756 3115.</p>
        <p>FORD, 1971 LTD, 2 door, hardtop, radio, heater, auto, powersteering, factory air, blue vinyt top, blue interior. $3495, Phelps Chevrolet, 7S&amp;amp; 2150.</p>
        <p>SCOUT 1962 JEEP, runs fine, new paint, $400. Call 758 3375.</p>
        <p>FORD 19*7, NEED dependable second car, in good condition? Must see to appreciate. $150 firm. Call 756 5898 after 5 p.m.</p>
        <p>KINGSWOOD 1969 STATION wagon, V 8, auto, power steering, air. Oowtowne Motors, Ayden, 746-6892.</p>
        <p>CAR APPEARANCE reconditioning: Interior cleaned, waxed and washed, engine steanied, cleaned and painted. Auto Salon Inc 758-7*11.</p>
        <p>72 DATSUN</p>
        <p> I."- [T-oi Doluxo</p>
        <p> 1 .';U' r -tbil : k C (ii&amp;gt; f)f</p>
        <p> i   I Do-.i' St d.t fi</p>
        <p>A U t i; III .!  j  I  t '1</p>
        <p>- tri I' I (iIi A r ri *; I r</p>
        <p>C end'ti'WiH-v; /\ V J11,1b!e</p>
        <p>S IM i A I V AL U F ^</p>
        <p>All Mi; - v'. I I k; a T</p>
        <p>HOLT OLDS DATSUN</p>
        <p>VVht - .  .  I-  f  .  .</p>
        <p>Tit .t</p>
        <p>I b  H d o k ('; R cl.</p>
        <p>/56 i IS</p>
        <p>1971 HONDA CB 175, like new, only 1200 miles. $500 firm. $40 helmet included. See at 410 Kirkland Dr., Greenville.</p>
        <p>MEET THE XL-250 HONDA</p>
        <p>GOOD LOOKING FAST AND SINGLE</p>
        <p>Now At</p>
        <p>STAN S SPORTS CENTER</p>
        <p>in9&amp;lt;; fvans ST.</p>
        <p>OPEN 8:00 AM TIL 6:00 PM</p>
        <p>MON. THRU SAT.</p>
        <p>BGATS A EQUIPMENT</p>
        <p>1969 15 FT. Silver Liner boat, 65 h.p.. Mercury motor, Cox trailer, ex cellent condition. Phelps Chevrolet, 756 2150.</p>
        <p>1971 WELLCRAFT. 15", Cox trailer, 50 h.p. Mercury motor. Call 752 5199 between 7-10 p.m.</p>
        <p>16V,'GRADY WHITE fiberglass, Cox traUer, 75 h.p. Johnson 758 2658 after</p>
        <p>6 p.m.</p>
        <p>GOGSB PETS</p>
        <p>MAVERICK, 1970 2 door, cruise^o-matic, 6 cylinder, air condition, white tires, and radio. F and D MotOrs, Bethel, 825^4450.</p>
        <p>MONTE CARLO, 1970 one owner, factory tape and air, low mileage. Call 752 3300 or 756^2564 after  p.m.</p>
        <p>OLOSMOBILE 98, 19 one owner, fully equipped. Call 752-3300 or. 756 25*4 after * p.m.</p>
        <p>FOR SALE, COLLIE puppies. Call 752-3311.</p>
        <p>PET KINGDOM WESTEND Shop ping Center. Tropical fish and pets of 911 kinds, AKC puppies and exotic birds and animals.</p>
        <p>TWO FEMALE BLACK AKC</p>
        <p>registered poodles. Call Joe, 752 *797.</p>
        <p>CHIHUAHUA, for sale. Call 752 7096, P C. Haddock.</p>
        <p>EMPLOYMENT</p>
        <p>Ftmate Hip Wanted</p>
        <p>EXPERIENCE LADY FOR</p>
        <p>general office work, 5 day work week, 8:30 5:30 p.m. Write "Office Worker", P.O. Box 1967, Greenville, stating qualifications.</p>
        <p>AVON</p>
        <p>/</p>
        <p>A BUSINESS OF YOUR OWN  One you can trt in yovr spar* timtT Jf* pessiMc  aatar. than you mink, whan you're</p>
        <p>.  ^* &amp;lt;44, Mr*. Willa M.</p>
        <p>Weeten, Box Jis Leon Or., Oreenville, NC.</p>
        <p>KCGISTEREO OR PRACTICAL</p>
        <p>nurse for full time and a retired nurse *'"^'*'ork. Pinehaven Nuraing Center, Farmville, N.C., 753</p>
        <p>ADMINISTRATIVE SECRETARY.</p>
        <p>L  work,</p>
        <p>X1iTte#t deadirnes. Write, P.O. Box 6028, Greenville, Attention Mr. Richard vn.</p>
        <p>IMMEDIATE EMPLOYMENT In</p>
        <p>chairside assistant. Experience necOTMry. Must be 21 years old Call tor interview: 752-6751.</p>
        <pb facs="00091594_0011" />
        <p>EMPLOYMENT</p>
        <p>Malt HMp Wiiitai</p>
        <p>CAREER MIMOED lALEt Train</p>
        <p>for GrccnvHle and vicinity. Lifa In-suranca talas, coilaga graduata, vataran prafarrad. Call B. I.. Hwnt, CLU, Northwastam Mutual Lifa, 752-4000.</p>
        <p>NEED TjMfO MEN, ona for truck driver and ona for warattousaman. High school education and military obligation satisfied, minimum age 21. Apply in parson to Heiiag Mayart, Oraanvilla,</p>
        <p>NEXT TIME YOU HAVE SOMETHING TO SELL do it the easy way! To place your Want Ad dial 752 6160.</p>
        <p>MECHANIC 3-5 Years Experieice</p>
        <p>Major multi-plant company. Excellent benefits with promising future. Contact personnel manager.</p>
        <p>Stow MawtetiriiK Coapwy Greenville, S.C.</p>
        <p>WANTED. MANAGER FOR service station, experience and references necessary. Call Carawan Oil Co., 756-4470 for appointment.</p>
        <p>NIGHT AUDITOR NEEDED for</p>
        <p>motel, four nights each week, 11 p.m. 7 a.m. Must have clerical aptitude. Mail brief resume to P. 0. Box 2515, Greenville.</p>
        <p>SHEET ROCK HANGER and</p>
        <p>finishers wanted, experienced. Call 756-0053 after 6 p.m.</p>
        <p>CONSTRUCTION</p>
        <p>COORDINATOR</p>
        <p>Large real estate developer needs een-strwctiofi ceerdinater te take charge of the censtrvctien of a dovolopmont. Must havo experlenco in dams, roads A general construction. Ability to negotiate contract, with sub-oontractors, in work with local A state agencios a must. Must bo capable of making decisions, working long hours, (7 days a week if necessary), and be able to start May 1, 1V73.</p>
        <p>If you can handle this position, you will have the opportunity to join one ef the fastest growing, and most exciting companies in the field today.</p>
        <p>You wilt also have the opportunity to oam a very substantial income. Please send resume, present earnings, and telephone number to;</p>
        <p>GfMt NortlMrn Devglopmtnt Co.</p>
        <p>P. O. Box n Now Born, NC 28560</p>
        <p>WANTED; EXPERIENCED body man. Contact Lester Williams at Bob Parish Motor Company in Washington, N.C. 946^5600 or 946-6981 after 6 p.m.</p>
        <p>APPAREL</p>
        <p>Manufacfuring</p>
        <p>Manager</p>
        <p>Engineer</p>
        <p>Three (3) plant operation ig</p>
        <p>of a mafor apparel</p>
        <p>representing one Division</p>
        <p>pel</p>
        <p>Dii</p>
        <p>manufacturer, located in Columbia, SC. Position requires IE degree or equivalent experience. Will assume the responsibility for all industrial engineering and manufacturing function. Reply in confidence.</p>
        <p>Stow MawfactHring</p>
        <p>P.O. BOX 3725 PARK PLACE</p>
        <p>RElATIi GREENVILLE, S.C.</p>
        <p>MalB-Ftinalt Htip</p>
        <p>DUN HILL ThtJotoFinddrs 751-2107.</p>
        <p>NURSES, REGISTERED. To work at Red Cross Bloodmobile, visits in and around Greenville. Part time salary will be discussed. All travel expenses when working reimbursed. If interested contact Mrs. Ruth Taylor Pitt County Chapter American Red Cross for application and further"details call 752-4222.</p>
        <p>A 5 MINUTE telephone call is all it will take to see if you meet our qualifications. 4 REASONS why it will be worth your timel</p>
        <p>1. $715 MONTHLY INCOME to start. Commission and bonuses.</p>
        <p>2. EXTENSIVE Program.</p>
        <p>Lead</p>
        <p>3 . N O N -CONTRIBUTORY Retirement Fund.</p>
        <p>4. COMPLETE Training Program includin Px t e n sJ V e Fiel Training.</p>
        <p>8</p>
        <p>CALL MR. WEAVER 8:a0 AM-5:00 PM 763-4621 OR WRITE P.O. Box 1849 Wilmington, N.C.</p>
        <p>28401</p>
        <p>-&amp;gt;V^UTUAL OF OMAHA IN-SUSANCE COMPANY UFE INSURANCE AFFILIATE: UNITED OF OMAHA</p>
        <p>An Equal Opportunity Employer</p>
        <p>MeMNMpWbRNi</p>
        <p>ixpsRiaNceo carpintbrs</p>
        <p>wuntedL Apply m peraon, J. H. Hudaen, inc. 7 a.m. Monday-Fridey.</p>
        <p> XPBRlBNCeO PLUMGBRS, MUST have own hand mms. Ex-cellent working condition. The hours are from 7;30 a.m.-5 p.m.. Monday  Thursday. 7:30 a.m.-11:3PvP m. Friday. Pay In lint wifh ability. Gall 752 7662, night 751 2SB4.</p>
        <p>ROUTB SALBSMAN OR</p>
        <p>Dalivaryman wantad. Applicant diouw be 21 or older, should be of good reputation and physically fit, experience not necessary, astablishad route with good pay, paid vajcetida tick pay end other com pohy bonefits. Apply in poraon to Royal Crown Bottling Co., 211 Airport Rd., Greonvilie</p>
        <p>MECHANIC AND MECHANIC helper, experience not neceseary. Profit sharing retirtmant plan, hospitalization paid by tmpioytr. Contact Sarvice AAanager, SAM Equipment, N. Memorial Dr., Greenville, 752-3105.</p>
        <p>NEEDED:  Log  truck  driver,</p>
        <p>chauffeur license required, sawyer for smell Lane Sew Mill. Apply to E. C. Lewis. Rt. 6 Greonvilie, or cell 75B-1134.</p>
        <p>SALESMAN WANTED. Excellent career opportunity to work out of Greenville office, covering several counties selling product with very little competition, ideal working conditions, home every night. Top salary and expenses plus commission with fringe benefits. Write Box 469, Greenville giving pdst experience.</p>
        <p>SALES AND SALES Manegement</p>
        <p>opportunities now in Eastern North Carolina with Northwestern Mutual Life. Our 115 year record of quality life insurance at low net coet is creating unprecedented demand for our services. Send resume to NML, P.O. Box 71 Chepei Hill, N.C. 27514.</p>
        <p>Wdrk WantBd</p>
        <p>YOUNG MAN WILL do yard work, oainting end heavy cleaning at 'easoneble rate. Cell 75I-0B90.</p>
        <p>HOUSE HEED PAINTINGT Two</p>
        <p>experienced painters now working in and around Greenville. Desire new business. Call 751-2411 for free estimate.</p>
        <p>WHITE LADY WANTS work in home for nursing the sick or aged, will work day or night, good experience. Call 7524357.</p>
        <p>FARMS</p>
        <p>Farms For Sal</p>
        <p>FARM LISTINGS WANTED. Any size, we have customers. Contact O.G. Nichols, 752 4012 or 758 2370.</p>
        <p>FARM EQUIPMENT</p>
        <p>CASE TOBACCO HARVESTER self</p>
        <p>propelled, bood condition. S600. 746-6306 after 5:30 p.m.</p>
        <p>FOR SALE</p>
        <p>MiscallBiwovs for Salo</p>
        <p>WESTfNGHOUSE, FOUR UNIT</p>
        <p>stainleM chrOme platform, remote control panel with 100' heat selection. Lift up units. Regular $99.95 While they last $50. Smith Electric Co., Greenville.</p>
        <p>WORLD BOOK ENCYCLOPEDIA</p>
        <p>and Childcraft, good condition, S75. Gas range $50 Call 752-5M3 after 5 pm. '</p>
        <p>COX CAMPER</p>
        <p>Model 100/ fits in back of l&amp;gt;kk-up truck. Retail $598.50/ on sale for</p>
        <p>STAN'S SPORTS CENTER 758-3613</p>
        <p>USED ELECTRIC STOVE white good condition, S25. Call any time 746-3788 Ayden.</p>
        <p>WE NOW HAVE unfinished bookcases. Thompson's Discount, 802 Clark St., Greenville.</p>
        <p>GUARANTEED tnglntS/ transmisBion/ body parts. Frtt</p>
        <p>CRISP AUTO SALVAGE</p>
        <p>Phona 7S2-2S72 N. Oraan St)</p>
        <p>Back of Rtsposs Barbacot</p>
        <p>UPH(</p>
        <p>cover all ty^ of furniture Ilka new. Ceil 752-6643.</p>
        <p>SPECIAL</p>
        <p>Executive Desks</p>
        <p>60 X 30^' baautiful ^  walnut finish.</p>
        <p>. Idoal for homo or offict.</p>
        <p>Rag. Prict  Special  Frict</p>
        <p>*143.30 *99.50</p>
        <p>TAFFOFFICE EQUIPMENT S. Evans St.  752-2175</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>Tb Daily Rdlo^or. CkecRille,N.C.~'nnB4ay. SUy *. IfTIU^</p>
        <p>Find the dependoble firm to put your cr into vocotiorvsofe condition in today's Doily Reflector Classified Ads</p>
        <p>CANNON'S T.V. SERVlCl. late model used color T.V.'s, Zenith and RCA. Coll 7S6.2SSS f O.m.-IO p.m.</p>
        <p>NOOGES BASS CONTEST, April 17. Mey IS, wookloy and monthly prizos. Go by H. L. Hodgos for-oompkrle mrormotlon or call 7.4iu</p>
        <p>COMPLETE LINE OF Kolvinoter</p>
        <p>oppllonccs. Terms to fit your conveniences See us foday.^ Home Furniture. Coll 7S2-2t79.</p>
        <p>1*72 GOLDEN TOUCH B Sew with large desk cMtinet. Ceil 756-7491.</p>
        <p>CAE PET SPECIAL. Repeat of a sale</p>
        <p>out, new colors, S3.99, 5 years guarantee. Fisher's Appiience B Furniture, inc.</p>
        <p>RAW peanuts. Shelled or un ihclled. Keel Peanut Co., AAemorial Dr., Greenville.</p>
        <p>ARC WELDER  Brand new, 110 volt  Complete with helmet and rods. $11.95, money back guarantee. Free details. Write:  National</p>
        <p>Electric, Box 544,1 .A.B., Miami, Fie. 33148.</p>
        <p>WOULD YOU LET your lawyer do your dental work? What about your carpet work? At Larry's Carpetland we specialize in carpet and rugs. Larry's Carpetland, 3010 E. 10th Greenville.</p>
        <p>WE UPHOLSTER ANYTHING, thousand of yards of fabric and foam cushioning. Jackson's Tire  Upholsterey, Dickinson Ave., 758-3276 day or 758-1505 nights.</p>
        <p>SHEET ALUMINUM. 23" x 36" size, .009 th inch thick. Used but not damaged. Excellent for outside sheeting of peck houses, barns, etc. 20c ach or S15 per hundred, or as is 13c each, or S13 per S100. Contact Lynwood Owens, the Daily Reflector, 209 Cotanche St., Greenville, N.C.</p>
        <p>This Weeks Special</p>
        <p>We Have A Complete Line Of Boating Accessories</p>
        <p>LAWINJ-BOY</p>
        <p>CIvk S CoEpaiy</p>
        <p>30M S. Mpmorial Drive 754-2557</p>
        <p>TIRES. JUST RECEIVED 300 new</p>
        <p>tires, full warranty, prices starting at S16. Wholesale price to everyone. United Freight, 2904 E. 10th St., Greenville.</p>
        <p>1969 MINI TRAIL honda, 50, ex cellent condition, $125. 1969 air sweep Gibson air conditioner, 19,000 BTU, excellent condition. Call 825 7241 after 5 p.m.</p>
        <p>ALL WOOL CAPE Charles braided rug, 10 X 13, burnt orange, green and brown colors, like new. Will trade for hide away bed in excellent condition, 756^3432.</p>
        <p>LAWN BOY</p>
        <p>1 jur wmmtt</p>
        <p>LAWN MOWER PARTS and REPAIRS I.F. Mdawkan t Sms 752-3286</p>
        <p>RECEIVED SHIPMENT OF roll a way beds and mattresses. Compare and see savings. Thompson's Discount, 802 Clark, St., Greenville.</p>
        <p>ART TALENT FOR those people who need large signs, small signs, all sorts of displays painted, trucks, cars, bikes etc. Lettered, any type drawings or paintings done, any type of logo or design made, any campaign posters painted. Call 752-6789 or come by 442 W. 3rd St. if I'n) not home leave name, telephone number and address. Ask for Charles "Ar-</p>
        <p>LIVESTOCK</p>
        <p>THRE 6AITED PLEASURE mare, good family horse. Call 752-3865.</p>
        <p>BLACK GELDING very good horse for beginners and children, unusually gentle. $200. 758 3270.</p>
        <p>LOST* FOUND</p>
        <p>FOUND: BROWN AND white young male dog. Call 756 4657.</p>
        <p>MAKE WANT ADS YOUR WHOLE LIFE CATALOG! Look there for all the things you need each day!</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>Little University</p>
        <p>^Kindo^arten &amp;amp; Nursery Complete child Care Open from 6:30 to 6:30 Cali 752-7148 315 E. IBth Str Greenville. NC</p>
        <p>105 Trade St. Greenville/ N.C. 27834</p>
        <p>We Hang Drapes Install Hardware</p>
        <p>A-l VALUES DRAPERY SHOP</p>
        <p>Custom Drapes - Bedspreads Cornices - Table Cloths</p>
        <p>HOURS: Mon. - Set. 9:30 a.m. to 5:30 p.m.</p>
        <p>Phone Number 756-6611</p>
        <p>SUPPORT</p>
        <p>J. Russell Wsbten</p>
        <p>For</p>
        <p>District Court -Judge .</p>
        <p>Help him make it harder for drunk drivers to endanger the lives of our families.</p>
        <p>MOtlLE NOMES</p>
        <p>THRBE BEDEOOM NIOEtLE homa, kxalad LawMn's Traiiar Park. Call 756-3517.</p>
        <p>A HOME IS A LOT OP THINGS and fhart ara lots for sola in todayH Clasamad Adsi</p>
        <p>12 WIDE, t BEDEOOMS. fumishtd or unfumishad, air condition. 752 7076 or 756 4997.</p>
        <p>TWO BEDROOM mobila homos for rant. Call 756 1341.</p>
        <p>TNREB BEDROOM mobila homa, control hoot, air conditionod, good location. Call 752 3216 or 825 5391.</p>
        <p>AAOBILE HOMES for rent, air conditiontd with wator fumlshad. Call 752 5362.</p>
        <p>FOR RENT, MOBILE horn* lots. Sac Bruce McLowhorn, six miles east of Greenville on 264</p>
        <p>THREE BEDROOM TRAILER with washer and air conditioner on private lot at Roundtree. Call 746-3460.</p>
        <p>12 WIDE, two bedroom trailer on private lot. 756^4340.</p>
        <p>CLEAN 12 WIDE, AIR, Shady Knoll. Rufus Keel 752-7626 or 758-3931.</p>
        <p>TWO BEDROOM air conditioned mobile home. S85 per month. Meedowbrook Trailer Park. 758 3566, 756 1307</p>
        <p>FOR RENT at Pineview Court, 12 x tSO, two bedrooms $97.50. 10 x 50 two bedrooms, $80,10 x 45 two bedrooms. $75. Call 75B3644.</p>
        <p>Mobila Homt$ for Solo</p>
        <p>RITZCRAFT, 12 x 60 central air. Call 756-5211 between 8 a.m. 2 p.m.</p>
        <p>1971, 65 X 12 Champion, 3 bedroom bath, front kitchen, air condition, will arrange finance, $5200. Bill William Real Estate, 752 2615 or Mike Joyner 756-1062.</p>
        <p>1959, RICHARDSON, 18 X 38, one bedroom, extra bed in living room that folds in wall, 8 x 10 aluminum porch canopy, 50 gallon oil and rack. 7564257.</p>
        <p>OPPORTUNITY</p>
        <p>FOR RENT. ESSO service station at 10th and Evans. Financing available 756 4470 Carawan Oil Co., Greenville.</p>
        <p>PROFESSIONAL</p>
        <p>"TO PRINT OR NOT TO PRINT"</p>
        <p>Let Creech and Jones Business Machines help you make the decision on your next Victor Calculator. "Factory Authorized Service", 103 Trade St., f56 3175.</p>
        <p>WILL MOW LAWNS for summer. Call 7567441.</p>
        <p>REPAIR SERVICES: Frigidaire Appliances, T.V.'s air conditioners, etc. Call 7464459 Gift Gallery Ayden,</p>
        <p>N.C.</p>
        <p>REAL ESTATE</p>
        <p>VALUABLE COMMERICAL PROPERTY for sale in dovmtown area. Building 110 and 112 East 5th St. Write: Mr. R. F. Strand, P. O. Box 5174, Fayetteville, N.C.</p>
        <p>for better buys</p>
        <p>in</p>
        <p>real estate</p>
        <p>CALL OR SEE</p>
        <p>E. H. Williford</p>
        <p>Lift Your Property With Us 313Cotanche PL 63911. Night PL 3 4409</p>
        <p>Houses For Sale</p>
        <p>205 E. 12th St. Nice Size living room, two bedrooms, kitchen and one bath, payments less than rent. Call M B. Massey Jr. or E.L. (Snag) Clark, day 752 3900 or night 7561265, 756 2385.</p>
        <p>507 PINE ST. Living room, den Kitchen combination, three bedrooms, IV2 baths, loan assump tion, $135 monthly payments, ac ceptionally nice. Call M.B. Massey Jr. of E.L. (Snag) Clark, day 752 3900 or night 756 1265, 756 2385.</p>
        <p>RENT OR SALE. Three bedroom brick house, living, dinette, kitchen, bath, closed in garage, nice location, near elementary school in Ayden. Available now. 793-5408 Plymouth.</p>
        <p>AMF Electric Start/ 8 horse power 38'' mower. $629.95 plus tax</p>
        <p>HQIDIIX-MmHU CO.</p>
        <p>AABfflorlBl Drivt</p>
        <p>Mtutt tBf Salt</p>
        <p>116 S. NARDING. Three bedropmL two bqffts. formal living, iamiiy room or 4fh btdroom downstairs, also work shop. $18^500. Bill Williams Rol sfate. 7S2 2615 or Mike Joyner, 756 1062. </p>
        <p>SIS MUMPORO RD.Iwo bedrooms, work shop, fenced-in back yard, loan assumption, small aqulty. 752-5213.</p>
        <p>PARMVILLE AREA, 2,000 haatsd araa. appraised value $30,000. Will sacrifice for S22,600, one year old. Call 7563425</p>
        <p>NEW LISTING BELOW COST!</p>
        <p>JusI IB mtiiuitt from downtown. Noarly 2,B0B sq. ft., 3 bodrooms/ 2 full bofi/ livine room, dinine room, Utchon, vory largo utility room, don with firtplaco, control Bir, comor lot, foncod back yard. Call BOWEN REALTY 7S2-71B4, tvonings and wookands, Trish Byrum, Rtaltor, 75B-S017.</p>
        <p>RENTALS</p>
        <p>SPRINKLED STORAGE ano</p>
        <p>Commercial space, any amount to fit your individual nteds, excellent access. Contact Phil Carroll, 752-5S77.</p>
        <p>PASTURE FOR RENT. Call Lonnie Staton, 758 1816.</p>
        <p>STORAGE SPACE, sprinkleB building, solid brick construction, concrete floor, heated building. Contact ABC Moving 6 Storage.</p>
        <p>Apartmant For Rant</p>
        <p>apartment hunters Look!</p>
        <p>Grier Rental Agency has a listing of fha best in Greenville. Check with us First. 752 5700.</p>
        <p>OAKMONT Square Apartments 1212 Redbank Road Telephone 7564151</p>
        <p>APARTMENT RENTALS:</p>
        <p>University Townhouses, 2 bedrooms, furnished or unfurnished. Contact Bob Reynolds, Mgr. 7464310.</p>
        <p>REDWOOD APARTMENTS, one</p>
        <p>bedroom furnished, heat, air con dition and water furnished. Call day 752 6137 or night 756 3465.</p>
        <p>CHALET APARTMENTS, Win</p>
        <p>tervilla, N.C., 3 bedrooms, fully carpeted, stove and Tefrigerator furnished. Call 746-4310.</p>
        <p>OAKMONT SQUARE Apartments</p>
        <p># 2-bqdroom,</p>
        <p>0 akctric haat,</p>
        <p>0 i-closats, fully carpqttd, disposBl, dishwashar</p>
        <p># club housa- swimming pool, 0 laundry facilitios.</p>
        <p>Naar Shopping Canters, schools, churches A university.</p>
        <p>1212 Redbenks Rd. Tel.: 756-4151</p>
        <p>IQUIMIO WITH</p>
        <p>II o tijixoTjriJb</p>
        <p>MAJOR AFFUANCfS</p>
        <p>TAR river ESTATES APTS.</p>
        <p>1, 2 &amp;amp; 3 Bedrooms Available Washer Dryer Hook Ups Hotpoint Equipped  752  4225</p>
        <p>ELM VILLA. 208 S. Elm. Beautiful completely furnished one and two bedroom apartments, utilities furnished. Call 752 3376.</p>
        <p>TWO BEDROOM DUPLEX apart ment, wall-to-wall carpet. 507 W. 3rd St., Ayden. Call 527-0711 Kinston,</p>
        <p>CARRIAGE HOUSE APARTMENTS. New Bern Hwy., just south of Pitt Plaza, two, 2 bedroom apart ments, c,n 7563450ftr 5 p.m.</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>JOBBERS</p>
        <p>Add a service product to your line/ you establish</p>
        <p>commission)/ we provide the weekly service.</p>
        <p>Call Mr. Able 756-7273</p>
        <p>72 DATSUN</p>
        <p>AMERICA'S # 1 SELLING ECONOMY PICK-UP TRUCK!</p>
        <p>Apartmant Far Rant</p>
        <p>CEDAR LAHR APARTMENTS, one</p>
        <p>bedroom furnished or unfurhTshed. 752 7065 or 7563936</p>
        <p>THREE BEDROOM DUPLEX apartment, 112 A North Meade St.. range, refrigerator, central air conditioning and heat. AvkilabtcMay 10. Call 756 3373.</p>
        <p>APARTAAENTS 1A 2 bedroom furnished A unfurnished. Contact M.E. Sutton or C. L. Thigpen/ Jr. Call 752-6121</p>
        <p>TWO BEDROOM DUPLEX apart</p>
        <p>ment. quiet couple preferred, no pets. Call 7963079.</p>
        <p>ONE BEDROOM APARTMENT.</p>
        <p>furnished or unfurnished. Call 758 5864</p>
        <p>PLUSH COUNTRY CLUB apart</p>
        <p>ments. Two bedrooms, wall-to-wall carpet, draperies, kitchen applianca and water. Rent furtished. ar un furnished. Call 756 5234.</p>
        <p>Stratford Arms Apts., 1900 S. .Charlas St. An axclusivt community dtsignadfo prvida tha ultimata in gracidi^ living. Modarn 1, 2 and 3 badroom gardan apartmants and 2 badroom Townhousas. Fur-nisbad or unfumishad. 7S6-4BOO.</p>
        <p>Housas for Ront</p>
        <p>FARM HOUSE FOR rent, needs minor repairs, 4 miles north east of Greenville. Call 752-5567 after 7 p.m</p>
        <p>THREE BEDROOM FURNISHED</p>
        <p>house, Pactoius Hwy. Call 756 2861</p>
        <p>OLD BUT CLEAN, two bedrooms, living room, kitchen and bath. Il miles from city limits. $45 per month, desirable people. 752 2025.</p>
        <p>Office Spaca For Ront</p>
        <p>687 SO. FT., including private office and storage room, 219 Cotanche St. Parking spaces available. Contact Max Joyner or Jim Lanier at 752-5505</p>
        <p>OFFICE SPACE, AVAILABLE June Approximately 1200 sq. ft., East Tenth St., with parking. Call 758 4257 between 9 a.m. 5 p.m., Monday Friday.</p>
        <p>Rooms for Ront</p>
        <p>ROOMS WITH private bath and central air and heat for college or working boy. Call 756 0513.</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>ROOFING</p>
        <p>C. L. LUPTON CO,</p>
        <p>Texaco</p>
        <p>Service Station For Lease</p>
        <p>in Ayden, N.C. For information Call:</p>
        <p>Days</p>
        <p>Nights</p>
        <p>758-1277/</p>
        <p>756-4614.</p>
        <p>Roowit for Ront</p>
        <p>ROOMS lN PmyATIhoma Jor to men and voman. Call 758-0569 after</p>
        <p>6 p.m.</p>
        <p>FOR A FRESH NEW LOOK add fr^ new flooring. Chock today's Want Ada tor lemt graat vaiuaai</p>
        <p>RESORTS</p>
        <p>FOUR ESOROOM HOUSE, with two baths on Pamlico River at Bay View N.C. waterfront property, wifh three lofS|,fenced in back yard,garage. Can 752 7161 day, or night 9463030</p>
        <p>WANTED</p>
        <p>WANTED; Chairs to Cane. Eastern Carolina Sheiterad Workshop arxj Vocational Rehabilitation Center has an employee who does canirtg for any type chair. Call 758 4188.</p>
        <p>WANTED; MOBILE LOT on Emerald Isle on ocean side. Call 752 3054 or 756 5107</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>GOAL</p>
        <p>. . . Orionttfl and success conscious group, willing to give top return for addition growth capital</p>
        <p>P.O. Box 5085 Groonvillo, N.C.</p>
        <p>Wantta Tb Buy</p>
        <p>J</p>
        <p>JMLLXEO EHIMtrANVA id Toy  Terrier or mixed Chihuahua and Rat Terrier. Call 758 5151 4-1 p.m</p>
        <p>GOWI apartment</p>
        <p>JM'IH Chock the elegant naw Tieht I rentals</p>
        <p>USED 18 ar 12 WIDE trailer, bast cash price. Write "Trailer" P O. Box 1967, Greenville.</p>
        <p>WintBdTB Rant</p>
        <p>MARRIED COUPLE WANTS home in country with bathroom. Will make repairs. Ptoasa write Janm W Oaniels,/Rt. 1. Box 38. Robersonville.</p>
        <p>CLASSIFIED DISPLAY</p>
        <p>Are you paying rant? Are yeu a Veteran? if sa yeu can own your own Mobile Homa with no down payment.</p>
        <p>Downtown* Motors</p>
        <p>Lm St. Aydm 74-ifl</p>
        <p>756-6424</p>
        <p>TERMINIX</p>
        <p>SUPPORT</p>
        <p>J. Russell Wooteu</p>
        <p>For</p>
        <p>District Court Judg</p>
        <p>Help him get the courts beck in the hands of the people.</p>
        <p>HIGH SCHOOL SENIORS</p>
        <p>You don't have to leave Eastern North Carolina for a good job opportunity. See BLACK &amp;amp; DECKER in TarborOr on highway 64 west. Make an appointment to talk to our personnel department about your future in power tool manufacturing. AAany employment opportunities will be occuring over the Spring and Summer for which you may qualify.</p>
        <p>THE BLACK &amp;amp; DECKER MANUFACTURING CO.</p>
        <p>TARBORO, N.C.</p>
        <p>An Equal Opportunity Employer, MF.</p>
        <p>Real Estate</p>
        <p>Jeannatta's</p>
        <p>Bulletin Baord</p>
        <p>t</p>
        <p>752-7807</p>
        <p>Lawyers Building</p>
        <p>JEANNETTE COX AGENCY REALTOR</p>
        <p>COXLINE Q  u/h.,</p>
        <p>wposifed in escrow eepos*f#d in hrname</p>
        <p>sit</p>
        <p>lobaT</p>
        <p>a..</p>
        <p>Or</p>
        <p>oor</p>
        <p>Ik'</p>
        <p>A</p>
        <p> High style It's really cute</p>
        <p> The Detsyn Pick-Up is rugged - built to last</p>
        <p> Low initial cost</p>
        <p> Low maintenanco and oporating cost 4-Ratod as Vt ton Will haul 2000 lbs,</p>
        <p> Up To 30 milos par eallon-  -  -</p>
        <p> Backed by samo factory warranty carried on Datsun cars.</p>
        <p> First class service available when needed at Holt Okfs-Datsun</p>
        <p>-  an  '</p>
        <p>I  1T  10   1</p>
        <p>'"Sri Thk'^ ii4n w ortCw</p>
        <p>YDU WILL LOVE the atmosphere turrounds this attractiv# II brick hom# m Colltge Court. This 3 bedrooms, 2 bath home has spacious rooms in all.</p>
        <p>I</p>
        <p>WE . ARRANGE FINANCING</p>
        <p>flOLTsOLDS-DATSUN</p>
        <p>VA Loans FHA Loons</p>
        <p>'Where Service Comes First"</p>
        <p>101 Hooker Rd.</p>
        <p>756-31T5</p>
        <p>A LOT OF HOME FOR THE MONEY</p>
        <p>What would you expect to pay for a 2250 sq. foot, centrally air conditioned, brzTnd new, ilitor y? 56me el its features include carpeting throughout living and dining room, sunken den, a vfcll arranged kitchen with self-cleaning ovan, few" fMdrooms, I*- baths, and  double garagel Price in SJO's  .</p>
        <p>AVOID CITY TAXES Have you always wanted to live in a country atmosphere? Well here is your chance. 3 Bedrooms, 2 baths, acre lot and many extras go wfh home. We have had hundjf-eds of calls from people looking for</p>
        <p>* ***' CALL TODAY. WE HAVE IT!</p>
        <p>CONVENIENT TO THE UNIVERSITY is this three bedrooms i both -homo. This twme his ovor 1 AM sq. ft. of living spaco, plus 1,800 sq. ft. of basomont. Coll ws lor an appointmont to sot this charming homo. Fricad in mid 28's</p>
        <p>' CBllusBnytlimi</p>
        <p>OHiCB 7S2.7S07 CBr7sa-lJ47</p>
        <p>7S4.2S21</p>
        <p>' *n.</p>
        <pb facs="00091594_0012" />
        <p>f</p>
        <p>Leadership Session Held For Officers</p>
        <p>Mii bra&amp;lt;i  Ills  ^irith iroiMot HtMn-</p>
        <p>SYNIOY. Aurtralia (UPI)- tioo 11 GenMine Grwr and Or 1^ Hmi. Qet Jurtiee</p>
        <p>oiN0wSoutbiWk,mkirm^^ loDowen, ha*d pid them the RoUry (%ibrMd if he hat ^ behind bras.</p>
        <p>VOTE</p>
        <p>FOR</p>
        <p>I. Btki Kioice</p>
        <p>CONDUCT COURSE  Nandor Kozma and BUI Stanley.</p>
        <p>Incoming officers of 18 lodges east of Raleigh were in Greenville Sunday for the</p>
        <p>Leadership Training School conducted by the Moose fraternity.</p>
        <p>Thb five-hour workshop</p>
        <p>N. C. House Of Representatives Pitt and Greene Counties</p>
        <p>Corpet Stains Can Be'^Erased</p>
        <p>AERIAL PHOTOGRAPH ... This photograph shows</p>
        <p>how the Soil Conservation Service now develops plans</p>
        <p>for water management systems. Aerial photographs save both time and money. (SCS Photo)</p>
        <p>Soil Conservation Service Uses</p>
        <p>Aerial Mapping in Field Surveys</p>
        <p>A new method of plotting field survey information is now being used by the Soil Conservation Service.</p>
        <p>According to George R. Murrell, civil engineer with the SCS, the method saves the SCS time and the taxpayer money.</p>
        <p>Under Public Law 566, the SCS is authorized to furnish legal local organizations technical assistance in preparing total conservation and development jrfans for watersheds, Murrell explained. As a part of this assistance the SCS helps develop construction plans, for water &amp;gt;</p>
        <p>management systems including channel improvement.</p>
        <p>Channel improvement usually consists of enlarging or cleaning out channels for drainage and flood prevention.</p>
        <p>In the past, the method of running field surveys required a considerable amount of time, Murrell said. A survey crew followed along a streams entire length using a transit and tape. The transit was used to indicate</p>
        <p>visible on the aerial photographs, Murrell said.</p>
        <p>Ex-Senator Is</p>
        <p>LA Welcomes</p>
        <p>the rpjgi^etic bearing of the channel.</p>
        <p>Married Again</p>
        <p>'Tonight' Show</p>
        <p>SavingsBond Sales Noted</p>
        <p>Sales of U.S. Series E and H Savings Bonds in Pitt County for March totaled some $42,737, according to R. W. Howard, Pitt Volunteer chairman.</p>
        <p>Howard reported that January through March sales amounted to $144,828, or some 50.1 per cent of the countys sales goal of $288,951.</p>
        <p>March sales in North Carolina were over $7 million for the third consecutive month, if was reported. March figures were the highest monthly sales totals</p>
        <p>HOLLYWOOD (AP) - Johnny Carson and the Tonight show have been welcomed to their I new home on the West Coast with ceremonies in the chambers of the Los Angeles City Council.</p>
        <p>The NBC program moved from New York to Hollywood with the Monday night show.</p>
        <p>The city council passed a resolution welcoming Carson and the cast and staff of the Tonight show and declared Monday as Johnny Carson Day.</p>
        <p>Carson has been host of the program since 1%2 and before that was host of several television shows originating here.</p>
        <p>His guests on the opening show from the NBC Burbank studios, taped Sunday night, were Nancy Reagan, wife of Gov. Ronald Reagan; Shelley Winters; Don Rickies; Bob Newhart and Carol Wayne.</p>
        <p>The tape was used to measure the distances between each change in direction of the channel, he added.</p>
        <p>The SCS is now using a method which virtually eliminates most of the transit and tape surveys. Using the new method, the location of the channels are being show on aerial photographs.</p>
        <p>Although the new method is saving time, the old transit method must still be used when the streams arent clearly</p>
        <p>OAKLAND, Calif. (AP) -Former U.S. Sen. William F. Knowland and Ann Dickson of Las Vegas, Nev., have been married in ceremonies at the bridegrooms home here.</p>
        <p>The services for Knowland, 63, publisher of the Oakland Tribune, and Mrs. Dickson, 38, were performed Saturday with only family and close friends attending. It was the second marriage forboth.</p>
        <p>The couple plans to honeymoon in Europe and live in Oakland.</p>
        <p>NEW YORK (UPI)-Paint, heavy oil and even heavy grease stains that often show up on indoor-outdoor carpeting as a result of spring house cleaning neednt be a cause for despair, says one carpet manufacturer.</p>
        <p>These seemingly difficult stains can usually be cleaned away in minutes by acting fast and following simple procedures outlined by General Felt Industries, Inc. First, scrape up the excess. Then aw&amp;gt;ly a household solvent sparin^y and blot up, using an absorbent cotton cloth or towel. Follow with a detergent and water solution, if necessary. The same procedure can be used to remove chewing gum, shoe polish and asphalt from indoor-outdoor needlepunch.</p>
        <p>conducted here by Deputy Supreme Secretary Bill Stanley and N.C. Director Nandor Kozma was one of 40 such |n*ograms conducted across the nation this year.</p>
        <p>Greenville lodge Governor James Harris reports 72 were in attendance, with four coming from Rock HUl, S.C.</p>
        <p>The course familiarizes newly-elected officers with the how-to, the whys and why-nots of lodge administration.</p>
        <p>Democratic Primary, May 6tii</p>
        <p>it A Resident of Greenville Since 1930  Tobacconist</p>
        <p> Former Chairman Pitt County Election Board</p>
        <p>it Church and Civic Worker</p>
        <p>RipnsaitatiM Fv All Tkt Puyli</p>
        <p>YOUR VOTE FOR</p>
        <p>ROBERT D. STOKES</p>
        <p>ON</p>
        <p>MAY 6th</p>
        <p>FOR PITT COUNTY BOARD OF EDUCATION</p>
        <p>WILL BE APPRECIATED</p>
        <p>Republicans</p>
        <p>ELECT</p>
        <p>JIM HUNT</p>
        <p>LIEUTENANT GOVERNOR</p>
        <p>PAID FOR BY PITT CO. COMMITTBI POR JIM HUNT</p>
        <p>since January of 1947.</p>
        <p>Sales of Series E and H bonds for the first quarter were $22,088,650 in the state, an increase of 18.6 per cent over sales for the same period last year. The sales represented another 27-year record.</p>
        <p>Howard said that nationally, total March sales were over one-</p>
        <p>Send them a Message!</p>
        <p>half billion dollars, a 13,3 per cent increase over 1971 sales. -Total .cash sales of E and H bonds for the first quarter of 1972 amounted to $1,640 million, some 19.8 per cent above a year earlier.</p>
        <p>HFAR THE REAL ISSUES OF THE PEOPLE</p>
        <p>Damage Suit</p>
        <p>RALEIGH (AP)  Burroughs Wellcome Co., an international pharmaceutical firm, is seeking $1.5 million damages for what it contends is faulty and defective construction work in its Research lYiangle Park building.</p>
        <p>Ilie suit was filed in U.S. Eastern District Court against two construction companies, a building materials firm and New York architect Paul Rudolph, who designed the building.</p>
        <p>Hie company contends that a fnish used on the outside of the $10 million structure is damaging the exterior.</p>
        <p>Others named in the suit were Daniel Construction Co. Inc. of Greenville, S.C., the general contractor; William A. Duiguid Co. of Ariington Heifdits. 111., sv^ontractor for the exiierior walls, and M. and 0 Enterprises Inc. of Springfield. Mo., which supplied the exterior finish.</p>
        <p>l K I</p>
        <p>\|l/&amp;gt;</p>
        <p>Music By Nashvittes Top Ariisfs!</p>
        <p>A WINNING TEAAfI IN NOVEMBER IS JIM JOHNSON AND DICK NIXON</p>
        <p>N.</p>
        <p>DICK NIXON IttEDS A 3. SENATOR FROM NORTH CAROLINA WITH</p>
        <p>LEGISLATIVE EXPERIENCE - JIM JOHNSON IS THE ONLY CANDIDATE WITH THAT EXPERIENCE</p>
        <p>DICK NIXON NEEDS A Ui. SATOR FROM NORTH CAROLINA WHO HAS BHN</p>
        <p>A LOYAL PARTY SUPPORTER r JIM JOHNSON IS THE ONLY CANDIDAn THAT QAUFIES.  '  --</p>
        <p>FRIDAY</p>
        <p>3:30 P.M. Pitt-Grenvllle Airport</p>
        <p>WCK NIXON NEEDS A  CANOIDATEWHOIIAS WON A5 A^IEPUR-</p>
        <p>LICAN - JIM JOHNSON IS THE ON^ECANDIDATE WHO HAS RUN AS A REPUB IICAN AND WON AS A REPUBlfflST</p>
        <p>Dan T. Crisp, Ruprusuntativa</p>
        <p>It would fake about 200 years to produce a pound of'Califor-niuiQ-.2i2, an. isotope of a rare nfhn-made element heavier than piutdnium.</p>
        <p>/ /.S TIMI TO 7 ///\A OT ! III. P!OnH</p>
        <p>DICK NIXON needs JIM JOHNSON IN THE U.S. SENATE - WE NEED JIM JOHN-^OWW-THE-tU; SENATE</p>
        <p>Paid Political Adv.</p>
        <p>GoaoJolmston</p>
        <p>FiiMRCfC(iainiioii</p>
        <p>i</p>
      </div>
    </body>
  </text>
</TEI>