Dragon, Patricia The East Carolinian, February 16, 1993 East Carolina's student-run campus newspaper was first published in 1923 as the East Carolina Teachers College News (1923-1925). It has been re-named as The Teco Echo (1925, 1926-1952), East Carolinian (1952-1969), Fountainhead (1969-1979), and The East Carolinian (1969, 1979-present). It includes local, state, national, and international stories with a focus on campus events. UA50.05.06.02.923 58367 1832 19930216 eng text newspapers East Carolina University Students East Carolina University Newspapers United States North Carolina Pitt County (N.C.) Greenville (N.C.) East Carolina University contributor http://rightsstatements.org/vocab/InC-EDU/1.0/ This item has been made available for use in research, teaching, and private study. Researchers are responsible for using these materials in accordance with Title 17 of the United States Code and any other applicable statutes. If you are the creator or copyright holder of this item and would like it removed, please contact us at als_digitalcollections@ecu.edu. Student Newspaper Collection newspaper The East Carolinian tecaro UA50-05 University Archives The East Carolinian, February 16, 1993 East Carolina's student-run campus newspaper was first published in 1923 as the East Carolina Teachers College News (1923-1925). It has been re-named as The Teco Echo (1925, 1926-1952), East Carolinian (1952-1969), Fountainhead (1969-1979), and The East Carolinian (1969, 1979-present). It includes local, state, national, and international stories with a focus on campus events. East Carolina University--Students East Carolina University 19930216 Text newspapers J. Y. Joyner Library, East Carolina University eng 58367 This item has been made available for use in research, teaching, and private study. Researchers are responsible for using these materials in accordance with Title 17 of the United States Code and any other applicable statutes. If you are the creator or copyright holder of this item and would like it removed, please contact us at als_digitalcollections@ecu.edu. East Carolina University--Newspapers United States--North Carolina--Pitt County (N.C.)--Greenville (N.C.)
Sports Batter up i The Pirate baseball team won one and lost two in their first series of the season. See story page 11. Lifestyle 'Sniper9 misses Tom Berenger's latest film, 'Sniper' is a war drama that is off-target. See story page 7. The East Carolinian m. 68 No. n Circulation 12.000 Greenville, North Carolina Tuesday , February' 16, 1993 Media Board enacts alcohol policy for WZMB 16 Pages By Joe Horst Staff Writer The Media Board recently closed a year-long issue with the enactment of an alcohol policy governing actions be- tween WZMB and local clubs. In February of 1992, the Media Board issued a memo- rand urn halting any future ben- efits that might be held at local clubs. On advice from the uni- versity attorneys' office, the Board concluded that any such event would hold the univer- sity open to civil liability law- suits. Through various memo- , randums and discussions, the ( Board came to the conclusion mat a policy would have to be enacted to use as a guideline fok any future events. Media Board chairperson Terri Avery met with the university attor- neys and together, they came up with a new policy that was accepted at the Feb. 11 meet- ing. The policy stated that staff members of WZMB may con- duct live-remotes from local businesses that serve alcohol. It limits thisabilityby placing vari- ous restrictions on the time, manner and frequency these live-remotes may be held. For example, before the policy was enacted, local busi- nesses could hold benefits for WZMB. This constituted one of the major problems when con- cocting the new policy. When previous benefits were held, the station would recieve money that would go directly back to improving the qualitv of the sta- tion. Now, tne policy specih- cally states that benefits for WZMB will only be allowed "in locations where alcohol is not being served Kevin Brelsford, program director of WZMB, was pleased with the results of the policy, with the exception of the benefit stipulation. "Overall, I'm happy that the matter was finally resolved Brelsford said. "I'm pleased with the results. "I wish the policy didn't restrict the clubs from holding benefits for WZMB, though. These benefits helped the sta- tion in the past, they raised a lot of money for the station General manager Tim Johnson agreed with Brelsford on the single bone of conten- tion. "The school is still torn over who is responsible when a tavern hold s a benefit Johnson said. "So, they still won't let clubs hold benefits for WZMB because they think WZMB might De name. Other points of contention that the policy made dealt with the manner with which adver- tisements would be done, mon- etary gains from the events and members' affiliation with WZMB as a radio station. The policy stated that ad- vertisements would be limited See WZMB page 4 Fil� photo According to a new Media Board policy, local businesses will no longer be able to host any benefits for WZMB if the establishment sells alcohol. Men at work Knoio oy am Hanson Construction has begun on the new Todd Dining Hall to be located on College Hill on the old Tvler Beach area. COST calls for student action, involvement By Jason Williams Staff Writer In the second meeting of the Com- mittee On Student Tuition (COST), the group's organizer, Bill Gheen, reiter- ated his fears concerning an increase in tuition. Explaining to new members the purpose of COST, Gheen said, "We're reacting to a report from the Govern- ment Performance Audit Committee that suggested the state legislature should raise tuition across the state to raise revenue "We think that the legislature will raise tuition anyway, but our goal is to minimize that tuition increase. We want to make it hard for them to raise it in the future Gheen said. Gheen repeated his message be- fore the Inter-Fraternity Council on Tuesday and again before the Panhellenic Council on Thursday. The 44 IFC appeared to be receptive to the COST plan and offered to fill a leader- ship position within the group. Mike Had ley, representing the SGA, and Cheen hold the other two chairmanship posi- tions in COST. Though Gheen wishes to get his group organized as quickly as possible in order to coordi- nate its activities, the legislature is not prepared to act on a tuition raising bill at the moment. "No one has set a calender date yet for any legislative action an assis- tant to the director of the Government Performance Audit said. "The state Sen- We think that the legislature will raise tuition anyway, but our goal is to mini- mize that tuition increase. " Bill Gheen, group organizer ate will form a Select Committee to review all government audits, and the House will run any such bill through its Appropriations Com- mittee Gheen stressed the importance of be- ing prepared to react quickly to any legisla- tive action and possi- bly prevent a bill from ever coming to a vote. "We want stu- dents to write to their state legislator, write to their local newspa- per, and tell their friends and family to do the same in order to let the legisla- tors know how they feel about a tuition hike See COST page 4 AMA Marketing Week lab eled a' success' By Jason Williams Staff Writer The ECU chapter of the American Marketing Association's Marketing Week is considered "a success" by Brian Kerns, president of the AMA. "Many students gained valuable experience by partici- pating in our experiments. It's been a really good success Kerns said. The week culminated with a visit from a Vice President of Carolina Telephone, Bruce Branyan. With 23 years experi- ence in the industry, Branyan is responsible for the marketing strategies for the company. Speaking at ECU for the third time, Branyan opened his presenta tion wi th a joke and pro- ceeded to tell the audience about his career in the marketing pro- fession. "I began my career in engi- neering at Ohio Bell, a division of AT&T, but moved to market- ing when the company began facing increased competition Branyan said. "During the breakup of AT&T I moved to government affairs. Lobbying is essentially marketing, though In 1989, AT&T offered Branyan a position in New Jer- When you leave ECU, that is not the end of your education. Always take the con- tinuous education approach to your job. sey. "I declined, and landed at Carolina Telephone Branyan said. "They were not set up to deal with competition either, so they brought in outsiders like me to help Branyan then asked the au- dience of marketing students for their assistance with a problem. "1 have a marketing problem or as my boss would say, 'a market- ing opportunity He then explained that Carolina Telephone is a subsid- iary of United Telecommunica- tions, which also owns Sprint. The company is about to merge with Centel and is searching for a new name. Many students offered sug- gestions, and Branyan expressed his appreciation for their partici- pation. "Drawing from his experi- ence, Branyan imparted some words of wisdom to his audi- ence. "When you leave ECU, that is not the end of your education. Always take thecontinuousedu- cation approach to your job. "Find yourself a mentor Bruce Branyan, vice presi- dent of CarolinaTelephone . within the company and always stay close to your customers. Re- member, the customer is the rea- son you're in business Branyan said. The meeting adjourned with the presentation of a certifi- cate to Branyan, and the award- ing of door prizes. Gift certificates from Chico's, Boli's, Professor O'Cooles, The Final Score, and AMF Bowl were given to win- ners. Subway also contributed three party subs to the event. In another Marketing Week activity, the AMA conducted a survey for the ECU student pub- lications. The information gath- ered from the survey will be used by the media for editorial and advertising feedback. "We will put the data in next week and should have the results in about a month Kerns said. "The survey was a great success and we gained real- world experience by participat- ing Education Career Day to benefit students seeking jobs By Sharon Anderson Staff Writer The Career Services Of- fice and the School of Educa- tion is sponsoring an Educa- tion Career Day for all edu- cation majors and those who are exploring education as a career. The event will be held in the Great Room of Mendenhall Student Center on February 16th from 9 a.m. to 12p.m. Over 70 representatives from North Carolina, South Carolina andVirginia schools will be holding one-on-one meetings with prospective em- ployees. All East Carolina Uni- versityseniorsareasked tobring copies of their resumes. "A majority of graduates said MargieSwartout, Assistant Director of Career Services, "make contacts for future possible employment She also said that one of the best things about career day is the cost efficiency for both the students and the schools be- cause they have everything finished in one day. The students are not See CAREER page 4 Top students are candidates for Golden Key By Karen Hassell Assistant News Editor The Golden Key National Honor Society is currently con- ducting a membership drive. Students that have been in- vited to join must have their reg- istration fee submitted bv March 5. A reception will be held on March 19 foral I members and their families. "Thiscl ub gives students an opportunity outside of college to give something back to the com- munity said Layne Kalbfleisch, a member on the leadership coun- cil. "And, it looks good on a resume Golden Key is a national nonprofit organization with 180 collegiate chapters at major uni- versities across thecountry. Lead- er in higher education, business and public service are members of Golden Key and support the society. Scholarships are a wared an- nually at each chapter to the out- standing junior and senior ini- tiates. Awards are also given on the graduate level. Students qualify on the ba- sis of objective academic criteria. No more than the top 15 percent of the juniors and seniors enrolled may be eligible. Peter G. Hartigan of Duke University has been chosen to serve as national student repre- sentative for the 1992-93 academic year. He was elected at this year's national convention in Scottsdale, Arizona. '� 2 The East Carolinian FEBRUARY 16, 1993 aSft&�&i-iifi& v ij; ground Other 'Mies, StateNews Officials warn against scholarship search services Tired of history 101? Try porn 150. Constance Penley admits she had twinges of embarrass- ment when her film class first met in January. Her students at the University of California-Santa Barbara probably felt the same way, she said. But then again, those on both sides of the podium had every right to be squeamish about the class subject: The fou r- credit course is a study of pornography as a film genre. That's right, the kind of films Mom and Dad told you never towatchare being shown in "Film Studies 150, FG Special Topics in Film Genre: Pornographic Film. Deep Throat and Suburban Dykes aren't exactly The Sound of Music, but that's the point. "We're trying to define it (pom) as a genre. Our film program tries to give a comprehensive survey in American film, and this is one of the largest that has gone unaddressed Penley said. Talk show woos students He may not be a David Letterman, but Dr. Shin Lin of Johns Hopkins University and his hot, new talk show are attracting students in droves. Lin, the associate dean of the School of Arts and Sciences at the university, is teaching the wonders of bio- medical research to his students in a talk show format every Monday night. Lin, who plays host, finds "celebrity" doctorsand scientists to chat about different topics every week ranging from "Biomechanics of Living Tissues to "Chartinga National Course for Research on Cardiovascular Diseases "The point of this course is toallow undergraduateswith no background in science to come and be educated in an entertaining way Lin said. "There will be a minimum of graphs and charts. It's not all fun and games, though. There will be serious science. While students have to pass an exam at the end of the course, there are no textbooks and no exams. New stamp honors black scientist A new 29-cent postage stamp honoring black scientist Percy Julian was introduced at a ceremony at Roosevelt Univer- sity in Chicago. The stamp, the 16th in the U.S. Postal Service's Black Heritage Series, was released in honor of February's Black History Month. Julian, who was the grandson of a slave, rose to become a preeminent American scientist who held over 100 patents and published more than 2a) scientific articles. Accord- ing to the U.S. Postal Service, "Percy Lavon Julian (1899-1975) was a distinguished scientist and chemical researcher. His syn- thesis of cortisone for arthritis, a drug for glaucoma and synthe- sis of progesterone won acclaim. In 1990, Julian was inducted into the prestigious National Investors Hall of Fame Compiled by Karen Hassell. Taken from CPS and other campus newspapers. CHARLOTTE, N.C.(AP)� High school students who pay $40 to $90 to companies for help in finding scholarships may be throwing away their money, North Carolina college officials say. "If you work closely with your financial aid office and use resources in the library, you can get the same information for free said Gordon Peck, Davidson College's associate dean for financial aid. "We continually ask stu- dents to let us know if they get a good match, and no one ever has said Eleanor Morris, direc- tor of the scholarship and finan- cial aid office at the University of North Carolina at Chapel Hill. "That leads me to believe they leave something to be desired It's not known how many search franchises operate in North Carolina. But since mid- 1990, one company, Educational Services of America in Northbrook, III has signed up 270 licensees in North Carolina. Two national companies couldn't provide names of any North Carolina students who have won money through their services, The Charlotte Observer reported Sunday. Howard Maroz, president of California-based Money For College, said it's up to the company's licensees to provide their own testimonials. But own- ers of three Mecklenburg County scholarship search franchises, all of whom are now out of busi- ness, couldn't give any suc- cess stories either. Maroz said the busi- nesses provide a convenient service at a time when pay- ing for college is growing in- creasingly difficult. "What we do is a step- by-step strategy to help them build their own financial plan he said. Typically, national compa- nies sell licenses to anyone who will pay their fee, usually less than $500.Thelocal licensee then recruits customers � students and their parents. A student provides aca- demic history and personal in- formation, such as hobbies. The local service sends a student's application to the par- ent company, which uses its computer to match the student with schol From there, it's up to the student to apply for the awards. For Lee Pettit, a Virginia Tech freshman from Collinsville, Va the list netted cash. Pettit won an $800 National Elks Club Foundation scholarship through Educational Servicesof America. The company, which provided Perth's name to The Observer, couldn't cite a single Caroiinas customer who had won a schol- arship. But Paola Bernacchi, a UNC freshman from Jamestown in Guilford County who spent $40 for a list of sources from Educa- tional Services of America, found the effort "a waste of "If you work closely with your financial aid office and use re- sources in the library, you can get the same information for free' Gordon Peck, Davidson College's associate dean. money She sent in her application in October of her senior year of high school bu t d id n't receive the list until January. By then, many of the awards' application deadlines had passed. Ms. Bernacchi mailed off more than 20 requests for appli- cations, some to addresses that turned out to be erroneous. Ms. Bernacchi ended up winning six scholarships, includ- ing a National Hispanic Scholars Award, but gave little credit to the service. Company owners maintain their search services do yield re- sults, if students conscientiously apply to the leads they provide. Yes, students can do their own research, using library books, but they won't, Mark Cohen said. Cohen founded the now-defunct Academic Guidance Services in Mount Laurel, N.J then sold it in 1988. "Using that same theory, would you do your own taxes? Why would they not say, 'Don't go to H&R Block Why would they not say, 'Don't go to a bar- ber. You can cut your own hair Many colleges offer free scholarship database searches. For three years, Furman University in Greenville, S.C has offered applicants free use of two databases, but they've generated few scholarships, said Benny Walker, a Furman vice president. Lenoir-Rhyne College in Hickory bought a database from the same company that sells li- censes through Educational Ser- vices of America. The college has done about 1,500 searches, charging stu- dents $5 per search. Ed Clark, dean of enroll- ment management at Lenoir- Rhyne, said he doesn't know of any students who've won money through the searches. But many Lenoir-Rhyne stu- dents get scholarships, and he's confident some of those leads came from the database.UNC also recently purchased a new database sold by the College Board,a nonprofitorganization that provides the Scholastic Aptitude Test and other educa- tional services. UNC's database soon will be available for UNC students and applicants. The East Carolinian is now accepting applications for Staff Writers, APPLY NO W! S54 UTO AMERICA 10 OFF ALL PARTS & LABOR DAYS TUESDAYS & WEDNESDAYS OPEN 7 DAYS A WEEK OPEN SUNDAY 1-5 WE HAVE ALL YOUR AUTOMOTIVE NEEDS Get Tfie Classics CDs onfsate'now for omy $&9S Visit "Mt. Rock-More" at Jimi Hendrix � Grateful Dead � Phil Collins � Genisis � Robert Plant � Led Zeppelin � Doors � Van Halen � ACDC � Cars � Fleerwood Mac � James Taylor � INXS � Pixies � Eagles 7CQ joci Bad Company � Van Morison � B-52's and more Q9 Charles St American Spirit LXR I Ultra 775 Radial 60,000 MILE RWL 1 65,000 MILE 30" P19S80RI3 P17S80R13 P1MWR13 P16V7SR1 PTM7SR14 PK&75RH P21V75H14 P20575R1S PJIV75R15 P22V75R15 P22575R15 P16V80R13 P17V80R13 P18V80RT3 P18V75R14 P10V7SR14 P20&75R14 PS157SRU P20V75RI5 P21S75R15 P22V75R1S PZlVWIli 30 99 40 98 41 96 44 99 45 99 46 99 47 99 49 99 50 99 51 99 52 00 LOWEST PRICE GUARANTEED OIL CHANGE As Low As. Computer Wheel Alignment Most roar wtteel dnve Mo�t front wheel drive 24" 34" We measure and adjust the alignment angles of �ac.h wt�el to meet manufacturer's specifications Every vehicle re- quires different adjustments only the proper alignment wtl be performed for your vehicle Parts and labor for rear shims extra Ught trucks and vans extra 15 99 Most 4 cylinder U S cars Price may vary with automobile SEARS I AM.IUCAM "J Front Disc or Rear Drum Brake Service We use Quality Raybestos Brake Parts. �Most U.S. Cars -With Road Tost As Low As We'll replace rltec tirake pad or rear shoe Resurface drums and rotors Inspect atpers or c4nders Repack front rh bearing. Replace grease (non-drive Semt-metalwc pads and hardwan- extra �� axle) 'nspect master cylinder Semt-metaH AUTO AMERICA 119 Red Banks Rd Greenville, NC 355-3466 Store Hours: MON-FRI 8-9. SAT 8-8. SUN 1-6 We Are An Authorized N.C. Inspection Station WEDNESDAY COLLEGE NIGHT $1.00 ADMISSION Ftjtwii lit ga U (SHAt CUppU IZ4l 51.00 House Hiballs s1.00 Tall Boys (Dollar LIQUOR-datio , Sale 75 Kamakaztes X $2.00 Pitchers 50 Jello Shots s2.50 P.J.s i iM�J!UL . I .& FEBRUARY 16. 1993 The East Carolinian 3 National News Men joining fight against violence aimed at women The Bush's private life: low profile and take out barbecue HOUSTON(AP)�Lifeasa private citizen has given George Bush a chance to get out of the limelight and do something else impossible while living in the White House � pick up his own takeout lunch. "He didn't give us a warn- ing said Fannie Coleman, who works at Otto's Barbecue. "We'd been looking for him to come by soon. We're always glad to see him when he comes When Bush showed up ear- lier this month to pick up a "half order of links, half beef, beans and a Diet Coke he came with only two other men, Ms. Coleman said. Bush has followed his plan to keep a low profile, granting no interviews and just one photo op- portunity since coming to Texas after President Clinton's inaugu- ration Jan. 20. Tourists cruise through his new neighborhood eager for a glimpse of the home he and wife, Barbara, are renting while their new house is built on an adjacent lot. "They're super people said Robert Koster, a plumbing Contractor working on their new home. "I was so impressed by diem, I couldn't even tell you what they said. I was kind of in awe of talking to them. But they were very nice Bush was seen at a recent Houston Rockets-Chicago Bulls basketball game with his son, Neil. His staff arranged for pictures to bfctaken during a visit by Turkish resident Turgut Ozal. i "I'mnotgivinginterviews E&ish reminded reporters who showed up for the photo session. His spokesman, Andrew Maner, fends off calls from the media and others seeking the ex- president'sattention, saying Bush wants his privacy. "He has basically been just going over the mounds of mail mat we've received Maner said. "We've just received so many speaking requests, appearances at promotional things, charity things�I think more than any of usexpected�hundredsand hun- dreds Bush also has been spend- ing time planning his presiden- tial library to be built at Texas A&M University in College Sta- tion, about 100 miles northwest of Houston. He normally is at his office by 8 a.m. and stays until 6 p.m Maner said. He declines to comment on the Clinton administration or other political matters. Secret Service agents accom- pany Bush in his silver Cadillac the two blocks from home to his officeattheParkLaureate,a nine- story build ing where he occupies the penthouse. Because of street construc- tion and the influx of tourists, police have had to help direct traffic in Bush's new neighbor- hood. "It's been a little busier than it used to be, but things have slowed down since they put a stop sign up down the street said a neighbor who lives a few doors away from the Bushes. Emily Young, 11, and her friends recognized the sudden traffic crunch as a business op- portunity and set up a lemonade stand. Most potential customers, however, were looking for the Bushes home, not a cold drink. "They just asked directions and they'd pay us for that she said. BOSTON (AP) � Ask Craig Norberg-Bohm why he joined the expanding ranks of men working actively to end violence against women, and he'll say it was just the right thing to do. Press him a little, and he'll recount the day his former girlfriend was raped. His experience isn't uncom- mon. More and more, the fathers, brothers, husbands and male friends of rape or assault victims are taking their cue from women's groups and venting their rage pro- ductively � by organizing. Across the country, men are setting up counseling groups and seminars to try to halt a growing number of rapes, wife beatings and domestic homicides. Their goal: to help men un- derstand the roots of their violence so they will stop. Their method: man-to-man talk that gets down to basics. "I can say, 'Listen guys let's be honest sa id Jackson Katz, who in 1988 formed an anti-violence group in Boston called Real Men. "That's something women can't do Norberg-Bohm,a41-year-old software engineering consultant, was in college when his girlfriend was raped by another man. The attack left her unable to be inti- mate, and the couple's year-old re- lationship was shattered. "When somebody is raped, all these trusts go away he re- called. About 15yearsago, he helped start a counseling center for male barterers in St. Louis called Rape and Violence End Now, or RAVEN. The clinic helps men understand how society conditions them to be violent, buttheemphasisison hold- ing them accountable for their ac- tions. "The man who comes in usually puts the responsibility on others said Norberg-Bohm, who now lives in Boston. "He says, 'She put me in here We want to change that Often, men must first be per- suaded there is a problem. Katz, who speaks at schools and colleges about violence, begins by drawing a white line down the middle of a blackboard.On one side of the line he asks male students to list things they do each day to avoid being sexually assaulted. "There'sgiggling, i f not blank stares Katz said. "Then someone says 'Nothing and I say, 'Thank you" On the other side of the line he asks female students to list the same thing, "and the list goes on and on"�everything from having a man's voice on the answering machine to not using parking garagesTheblackboard gets filled up with things they do everyday to be safe Katz said. "Seeing it up there so starkly, it makes them see how unfair it is In Ca 1 ifornia, members of the Oakland Men's Project have hold- inganti-violenceworkshopsevery- where from prisons to workplaces since 1979. Along the way, they've learned what works with men, and what doesn't. "The touchy-feely stuff doesn't go over well said Allan Shore, the executive director. "Companies don't like women tell- ing mem about this. The old boys' network wants men to tell them about this Not everyone is interested. Katz endures plenty of name-call- ing from men when he hands out leaflets on Super Bowl Sunday or at concertsof comedian Andrew Dice Clay, whose brand of humor has offended women and minorities. Michael David Gordon, of the group New York Men AgainstSex- ism, received a death threat on his answering machine when he orga- nized an anti-violence workshop at Columbia University. Also, it's not clear men talking to other men will effectively reduce violence. The few studies on such methodsare incon- clusive. VOZM W6LL6KS, BE OH THE LOOKOUT f OR YOUR LETTER IMTHE MAIL TELLING YOU ABOUT OUR RENTALS FOR THE NEXT SCHOOL YEAR 1993 199. KINGSTON WaW place CALL 758-5393 COMPARE PRICES TMT Witt COMPETE WIT THE IfORMSl EasLCacplina 1992993 Playhouse mm Seasc lay ;ason William Gibson's spellbinding sequel to "The Miracle Worker MMftfM "The story of Helen Keller and Annie Sullivan continues February 11, 12, 13, 15 and 16 at 8:00 p.m. February 14 at 2:00 p.m. ECU Students: $4.50 Call � 757-6829 Solutions from your Apple Campus Reseller: the perfect Macintosh system to fit your budget. Tvvo inexpensive rombinafions that will helpyou survive eaithe most fueling semester. Pepperoni and Mushroom. The affordable, rmeple StyleWriter U and Apple Macintosh Color Classic. Introducing the most aordable color Macintosh" sys- tem ever. The new Macintosh Color Classic computer gives you a sharp, bright Sony Trinitron display built-in audio, file sharing, networking and more. And the new, compact Apple StyleWritef II printer delivers stunning, laser-quality output while still fitting within your budget. See this new system today at your Apple Campus Reseller. Where you'll get spe- cial student pricing, as well as service dining college! And discover the power of Macintosh. The power more - - college students choose. The power to be your best. ijfn Student Stores STORE HOURS: Monday-Thursday 8am - 8pm Friday 8 am - 5 pm Saturday 11 am - 5 pm PHONE: 757-6731 vnri-aiwLtbU ouh fn.m Apftit-4mpw fowflrn uhihurr ifpir uthtn:tJ-mKrPrrmJen &Wf ifplt�Qmifiuh hh til rtfty rrmd W V' U-i�h-t vWntrrnui tumrUibvumt fq�lf�falM4 Wli nuhv (M Qmm 0t&mfim,hmkmMmmm4toJ&kGtMfmm hh Mtlr I VflffUmtflliMrt$ (fegMMfeM 4 The East Carolinian FEBRUARY 16. 1993 I StateNews for welfare, tax CHAPEL HILL, N.C. (AP) � Tax laws unfairly benefit rich people and welfare breaks up families and keeps poor people perpetually poor, said leading scholars at a national conference. Karen Hill, director of a hous- ing program in Yonkers, N.Y said rich people get what amounts to a government subsidy when they de- duct mortgage interest off their in- come taxes. Meanwhile, 70 percent of poor people in the United States don't get any kind of subsidy to pay their rents. And welfare policies prevent poor people from saving money to buy a house, she said. Ms. Hill was one of the econo- mists, civil-rights activists, lawyers and social scientists from across the country who met at the University of North Carolina at Chapel Hill over the weekend to discuss how racism and poverty continue to cripple in- ner cities, The Winston-Salem Jour- nal reported. The conference marks the 25th anniversary of the Kemer Commis- sion report, which warned that America was disintegratinginto two unequal nations of black and white people. The Kemer Commission was appointed by President Lyndon Johnson to study racial violence in the wake of the Watts riots in Los Angeles in 1965. Speakers called for changes in welfare and tax policies. "The public welfare system in the United States has three character- istics � it doesn't work, it doesn't work, it doesn't work said David Stoesz, a lecturer at San Diego State University. Peter Leonard, an analyst with COST New member Mitchell Bowen, from Pitt Community College, presented his argument against raising tuition in our state. "A tuition hike of 20 will price many lower and middle income people out of college. "With fewer people going to college, North Carolina would have a less-educated population. A less-educated population nee- CAREER essarily leads to a less-educated workforce Bowen said. If indeed the General As- sembly enacts the recommenda- tions of the Audit Committee, then the legislators will have to change their current interpreta- tion of the state Constitution. One provision states, "higher education, as far as practicable, be extended to the people of the scheduled for formal interviews, but are allowed to ask any ques- tions they feel are important. In return, each representative will ask interview-like questions to become more familiar with a per- spective employee. The purpose of this program is for students and recruiters to share information about their school systems and the projected hiring needs. Each senior interested in education as a career should reg- ister with career services. These students will be sent a newslet- ter and attend an orientation pro- gram. the Center on Budget and Policy Pri- orities, a nonprofit think tank in Washington, said there should be an income cap on that tax deduction. "Rich people who buy man- sions are always going to buy man- sions he said. Leonard also advocates rais- ing the minimum wage and increas- ingtheeamed-income taxcreditthat poor families can now claim on their taxes. Several scholars recommended thatuniversities,privatefoundations and corporations help solve theprob- lems surrounding poverty. Peter Dreier, a professor at Occidental College in Los Angeles, said polls show most Americans are willing to pay more in taxes to help fight poverty, butonly if they feel the programs work. 'Teople are willing to spend money and cut the defense budget if they think the money will be well- spent he said. Asked what budget changes they would suggest to President Clinton, the scholars recommended: � Establishing universal- health care coverage. About 22 per- cent of black Americans can't get private or government insurance, said Sidney Watson, a professor at Mercer University Law School. � Increasing the amount of money earmarked for Head Start, a preschool program. � Setting aside money to for- give the educational loans taken out by doctors and nurses who practice in public clinics. � Increasing welfare money for job training or schooling. � Starring a Peace-Corps-like program for U.S. students. Continued from page 1 State free of expense The Committee further rec- ommends, the General Assem- bly should "establish UNC un- dergraduate resident tuition at 16 to 19 percent of cost of educa- tion Another recommendation states, "Increase undergraduates nonresident tuition to as much as 100 percent of cost of educa- tion The Audit Committee re- ports that undergraduate resi- dent students currently pay 10.9 percent of the cost of education. The cost of education is esti- mated to be $7502. COST will hold its next meeting Thursday at 4 p.m. in Mendenhali. For more informa- tion contact Steve Benzkofer at 830-9239. Continued from page 1 Any student who needs help with their resumes and inter- viewing skills may attend one of the workshops conducted by the Career Services staff. The schools that will be present on Education Career Day are invited by East Carolina Uni- versity to attend. Request to ap- pear are usually recognized. "The reason most of the schools are regional" Swartout said, "is most likely because the economy is down Three schools that have been scheduledcannot attend on Tues- day, but have sched uled appear- ances in the spring. WZMB Continued from page 1 to "on-air announcements of time, location and an explana- tion of event coverage The policy went on to ensure that sponsorship would not be de- noted to the radio station, whether itbeobviousor implied, by eliminating the use of the station's call letters in any shape or form. The policy also stipulated that WZMB staff members should in no way "receive any monetary gains from a function, i.e. live-remote These gains in- cluded door proceeds, payment or gifts from the owner and free admission into the club. The only exception to the free admission policy was when WZMB staff members are covering the event as members of the media and that the free admission be for that event only. Brelsford commented on the importance of this policy, saying that WZMB's public im- age is crucial to the sta tion's suc- cess. "Being able to represent WZMB in public is a great pro- motion for the station Brelsford said. "Being at these events and being associated with them is good promotion not only for the station, but for the university as well m HUNGRY PIRATE THE BIGGEST BURRITO YOU'VE EVER SEEN! Stuffed with beef, rice, lettuce, beans, tomato bits, sour cream, and covered with enchilada sauce Gup-anteed to fill you up! $3.45 521 Cotanche St. � 757-1666 Served 2-5 Weekdays 11-5 Weekends m PHPa HOTTEST SPOT IN iTOVNll! COME EARLY - DOORS OPEN AT 9:00 pm '1.00 NIGH1 fEDNESDA NO COVER FOR LADIES 3 LIVE BANDl 'OME EARL V.00 PM m:m LADIES NIGHT WEDNESDAY' LADIES GET IN FREEH OPEN UNDAYi 8:00 PM $1.00 IIGHTH NI6HTCLUI EVERY WEDNESDAY lUSiC STE LIVE BAND SPONSORED BY McFADYEN MUSIC $1.00 MIXED DRINK SPECIALS T$1 .00 BOTTLE DOMESTICS & DRAFT $1.00 Wl OPEN UNDAYl $1.00 DRINKS $1.00 OVEI 2 DANCE 'LOOR, THURSDAY. FEB 18 COOL-AID BARi featuring plutopia (Reggae) WELCOME PHI KAPPA PSI BENEFIT FRIDAY. FEB 19 MK. POTATO KEAp ALL A.B.C 'ERMITl iATURDAY FEB 20 PUNKY FUNKY ROCKU REGGAE GROOVE HGHTL DRINK iPECIALl PRIVATE CLUB FOR MEMBERS & GUESTSAWIjlAd MEMBERSHIPS AVAILABLE FREE FREE FREE FREE FREE FREE FREE FREE FREE FREE FREE FREE FREE FREE FREE FREE FREE FREE FREE FREE FREE FREE FREE FREE CAJUN REFRESHMENTS FREE FREE FREE FREE FREE FREE FREE FREE FREE FREE FREE FREE MARDI GRAS PRIZES FREE FREE FREE FREE FREE FREE FREE FREE FOR ALL ECU STUDENTS SCHEDULE OF EVENTS Friday February 26,1993 7:00-8:15 p.m. Collar Hill 8:30 p.m. College Hill 9:00 p.m. 9:(K)- 12:(X)mid. MSC Recreation 9:00- 10:30 p.m MSC Multi-Purpose 9:00 -12:00 mid. MSC 244 9:30- 11:00 p.m. MSC Underground 10:00 p.m. Hendrix Theatre 10:30-11:00 p.m. MSC Multi-Purpose Human Float Judging Crowning of Mardi Gras King & Queen Parade Formation Parade through campus to Mendenhali Student Center Accompanied by The Will Bridges Band Parade arrives at MSC "Bourbon Street and Mardi Gras begins. FREE open and challenge bowling. FREE billiards and table tennis Dance to ECU's Panama Steel Drum Band Karaoke contest - Sing and strut your stuff for prizes Listen to the music of Spiral. FREE movie - "Birth of the Blues starring Bing Crosby Costume contest judging and awards 11 :(X) -1:00 a.m. Mardi Gras Ball Dance to one of New Orleans' MSC Multi-Purpose finest bands - Steve Riley and the Mamou Playboys 1:00 a.m. FESTIVITIES END Masks required and available at the door. NO ONE UNDER THE INFLUENCE WILL BF ADMITTED Admission by valid ECU ID. One guest per person. M i i� ii ir February 16, 1993 TheEastCarolinian Classifieds Page 5 c lwvwyM9w For KINGS ARMS APARTMENTS :1 and 2 bedroom apartments. Energy- efficient, several locations in town. Car- peted, kitchen appliances, some water and sewer paid, washerdryer hook- ups. Call 752-8915. STUDENTS: Don't wait for next se- - mester,doitnow We have now over a hundred apartments that will be available for May, June, July, and Au- gust. Call 752-1375 Homelocators to- day for your selection. HOUSES FOR RENT: 2608 Tryon Drive; 3 bedroom1 bath; $550.00 p m. 404 S. Eastern Street; 3 bedroom 2 bath; 5680.00pm. No pets. Lease and Deposit Required. Duff us Realty, nc. Call 756-2675. t TIRED OF YOURpresent living situ- ation? Room available in nice house 4 blocks from campus. Call TODD OR f3RK at 830 - 3882 or 830-1371. �7TH STORY luxury suite hanging Over the whit sand and clear water of outh Florida's most beautiful beach. Smpletely furnished, sleeps five in tjabelievable luxury; minutes from jai Alai, airport, horses dogs, Ft. Lauder- ijale Beach, Miami Action. $800 for Week36-313atHollywood Beach tower. Call (205) 948-7493. APT. FOR RENT near ECU - Female Roommate 5140 12 util - Will ac- cept less rent. Call (919 779 - 6299 after 5 or leave msg. Condominium for rent - T&filloughby Park, 2 bedroom, 2 bath, fireplace, pool, tennis, NOPETS, avail- able March 1st, $525,756 - 9420. Ir lBR APARTMENT on 13th St Great for pets, esp. dogs. Availableimmedi- ately. $275 mo. Call 752 - 9197. Ranted roommate: Ringgoid "powers, Male, $187.50, Plus 12 ex- penses. Call 757-0369 or (919) 291- RDOMMATE NEEDED to share3 bd house, $150 plus 13 utilities. Please call 757 -2730 close to campus. ROOMMATE NEEDED IMMEDI- ATELY: 427 Wedgewood Arms Apts. xennis Court & Swimming Pool. Call Jaysenat(919)321-1760. FEMALEROOMMATE NEEDED to share 2 - bedroom apt. at Carriage House. 5160 month rent 12 elec- tric. NO DEPOSIT REQUIRED. Roommate is needed immediately. Please Call Christie for info, at 756 - 9261. MALE ROOMMATE WANTED: Wesley Village E Third St 3 bed- room duplex, own room, firtplace, all appliances, washer dryer, gas grill, neat, serious, non - smoking student. Must see to appreciate. Call at 830 - 4030. ALL NEW UNRELEASED live concert & studio recordings for sale. Over 1000 new titles available mis week from the following artists: ROCK- U2, R.E.M Clapton, Zeppelin, Hendrix, Black Crowes, Springsteen, SRV, Van Halen, Rush, Beatles, Doors, G-N-R, etc. AL- TERNATIVE- Nirvana,Pearl Jam, Chili Peppers, Cure, Depeche Mode, MORE OTHERS INCLUDE- Bob Marley, Ma- donna, Prince, and more. Call 931-2573 to leave name, number, and requested artist onmessagefallnewCD'sand tapes in stock). DAY BED, white, iron and brass w2 twinsizeOrthopedicmattressesand roll- out pop-up trundle. Never used, in box. Cost $700. S310cash (919) 637-4421 after 6:30 pm. BRASS BED, queen size w frame and deluxe Orthopedic mattress set in fac- tory box. Can't use. Cost $750, sacrifice $285 cash (919) 67-4421 after630 pm. GOVERNMENT SEIZED CARS,Trucks, Boats, 4-wheelers, motorhomes, by FBI, IRS, DEA. Avail- able your area now. Call 1-800436-4363 ext.c-5999. MOVING MUST SELL! 5 piece cherry or oak bedroom set- $42500 Call (919) 946-9653. SAMSUNG 8180 computer w514 floppy disk drive. Monochrome moni- tor. AlsoCitizenl20-Ddotmatrix printer. Fjccellentcondition! 4:0.00call 756 0125. GEORGEOUSPUPnEStogoodhome. Willbe ready for Valentine's Day. (Give yoursweethearttheperfectgift.) Austra- lian shepherd mix. Info: 758-2733. FOR SALE: Fisher CD Component Great Value at $65.00 Call-Leave mes- sage for Kat 931 - 9667. 1987 KX125 new parts & Answer pipe. Extra rear tire. This bike will Scream. 1050. Call Todd 752-2616. COMICBOOKS for sale, various issues ofThe Death and Funeral of SUPERMAN. Great Prices. 10 - 50 off current price guides. Allarefirstprintingsandinmint condition. Call 758-5819 for Info Ask for Johnnie. Leave Message. SAVE on Spring Break '93! Jamaica, Cancun, Bahamas from 5459 Florida from !149! Organize group and travel free! Contact Susan �931 -7334 or call Sun Splash Tour s today 1 -300-426-7710. INTERNATIONAL EMPLYMENT - Make money teaching English Abroad. JapanandTaiwan. Make$2000- $4000 permonth. Manyprovideroom& board other benefits! No previous training or teaching certificate required! For In- ternational Employment program, call the International Emplayment Group: (206)632-1146ext.J5362. TOPLESS DANCERS WANTED: Great club, great money, unbelievable tips. Work Thursday, Friday,Saturday, 9 pm-2 am. Call Sid 919-735-7713 or Paul919-736-0716. MothersPlayhouse inGoldsboro. $10 - $360UP WEEKLY Mailing bro- chures! Sparefull time. Set own hours! RUSH stamped envelope: Publishers (Gr)1821HilandaleRd.lB-295 Durham, NC 27705 POSTAL JOBS AVAILABLE! Many positions, Great benefits. Call 1-800- 4364365 ext.P-3712. COLLEGE REP WANTED to distrib- ute "Student Rate" subscription cards at this campus. Good income. For application write to Collegiate Ma rket- ing Services PO Box 1436 Mooresville NC 28115. BRODY'SANDBRODY'SFORMEN are acceptting applications for part - time sales associates. Flexible schedule salary clothing discount. Apply Brady's The plaza Mon - wed. 1-4 pm. OUTER BANKS largest watersports center hiring enthusiastic persons for sailing windsurfing instruction, powerboat and equipment rentals, re- tail. Norm Beach Sailing, Inc. Box8279, Duck, NC 27949. (919) 261-6262. FULL TIME MONEY, PART TIME WORK: Weneed a few energetic, posi- tive, part - time reps for nat'l Co. ex- panding in NC work flexible hours, ex- cellent income, opportunity for travel and have fun. Call Cindy 752-6560. CHEERLEADING INSTRUCTORS NEEDED. Looking for enthusiatic people with strong cheering and inter- personal skilils to teach cheerleading camps in NC & SC. Great pay and flexible scheduling. Up to 10 weeks possible! If you love cheerleading, this is the summer job for you! To apply, Call 1-800-280-3223. ATTENTION STUDENTS: Earn ex- tra cash stuffing envelopes at home. All Materials provided. Send SASE to Na- tional Distributors POBox9643 Spring- field, MO 65801. Immediate response. ���AWESOMESPRING BREAKTRIPS! Bahamas Cruise 6 Days Includes 10 Meals, Great Beaches & Nightlife! $279! Panama QryBeachfrontRooms WifhKitchens$l 19, Key West Oceanfront Hotel $249, Daytona Beachfront Rooms With Kitchens $149, Cancun$459, Jamaica $479! Springbreak! 1 - 8006786386 �AWESOMESPKINGBREAKBAHA- MAS CRUISE $279! Includes 6 days in Bahamas,10meals!SailfromFlorida!Beau- tiful Beaches, Grea t Nightlife! Drinking age 18! Springbreak 1006786386 BEST TANNING PRICES in town at Scissorsmith Hair Designs and Tanning Center! One month unlimited only $30.00, other packages too! 107 ETstbrook Drive 758-7570. PARTY HOUSES - North Myrtle Beach Welcome groups of 4-34 people Group- RESEARCH INFORMATION! Largest Library of Information In U.S. all subjects Order Catalog Today with visaMC or COD 800-351-0222 TOLL FREE HOT LINE in Calif. (213)477-8226 Or, rush $2.00 to: Research Information 11322 Idaho Ave. 1206-A. Los Angles. CA 90025 SPRING BREAK'93! LAST CHANCE TO SAVE JAMAICA - $429 CANCUN - $439 FLORIDA - $159 V For Th0 Lomit xk -?- Prices & Tha Boat Kg F Trip, Call SUN SPLASH TOURS 1-800-426-7710' mtmonrmsAOAMoetT�Ktuu.Bfooutm GREEKS & CLUBS $1,000 AN HOUR! Each member of your frat, sorority, team, club, etc. pitches in just one hour and your group can raise $1,000 in iust a few days! Plus a chance to earn $1,000 for yourself! No cost. No obligation. 1-800-932-0528, ext. 65 RTTBTOON SPRING BREAKERS PARTY LIKE GODS! Panama City $139, Key West $269, Jamaica & Cancun from $450. Quality Accomodations, Free Drink Parties! Call Joe! ENDLESS SUMMER TOURS 1-800-234-7007 W&LNESS Program Opportunities Pitt County Memorial Hospital is accepting applicationsresumes for the following positions in our Wellness Program: PROGRAM ASSISTANT (part-time vacancy) Requires a 4-year degree in Nursing, Health Education. Nutrition or related with 1-2 years of experience in teaching health-related classes andor preparing health promotion cam- paigns. WELLNESS ASSISTANTS 1-2 years of experience in teach- ing aerobic classes required. ompeiitive salaries offered. For consideration, send resume to: Employment Office, Pitt g Ciiuni Memorial Hospital, P. O. Box 6028, Greenville. NC 27835-6028; 551-4556. � EOEIAA Pitt County Memorial Hospital � a constituent of University Medical Cefftep H Of Eastern Carotina-Pitt County � Leaderdiscourts. CaUByrtteBeadYTours9 -4 pm (703) 250-2125. SPRING BREAK' 931 Travel to Jamaica, Cancun and Honda for guaranteed lowest prices! Call Stu at 757-0313 immediately to ensure a space! WANTED: Men and Women to share in furv sun - filled weeks in Jamaica, Cancun andFlorida forSpringBreakj. Reserveyour space by callingStu at 757-0313. DONTBELEFTOUT! Limited spacestill available to Jamaica, Cancun and Floridia for Spring Break. Contact Stu at 757-0313 before it's sold out! WIN TO LOSE Tired of yo - yo diets,hate mealsubstitute9,noterKighttimetoexercise but desperately want to bse weight? Give me a call at 746 - 4583. (Leave name and number on recorder). FLORIDA SPRING BREAK 7 nights beadi front $139 -159 Quad Deadline soom. Reserve rooms NOW! CallCMIl - 800-423-5264. BOOKTRADER BUY AND TRADE PAPERBACK BOOKS OVER 50,000 TITLES 919 Dickinson Ave. Greenville, NC 758-6909 COMICS OLD & NEW NOW! USED CDS JfJ �asv Soiling SWt Oiornvs tit- Saiamae �r tie- Kt Sk EJ tit. DaxoMSt �r � flius L5 . mitr tkipar-tu tuns tr.ds i ettudtit wit.1 far self ththoddc ttttf -800-780 -4001 HAPPY BIRTHDAY to the girls in apartment 7. Debbie, Laurie, Lisa, Sherry, and Kris. Best Wishes on your Birthdays and we hope your party is a great Success C&M RACHEAL HAPPY 21ST BIRTH- DAY. All My Love Jimmy. WARMANDLOVINGfemalewants to give health Caucasian baby a close knit family and financial security. Will help with expenses. Call Collect (804) 572-8403 or Write PO Box 655, South Boston, VA 24592. SHERRY: Rush is finally over. You did agreatjob. Thanks forbeingawonderful BIG SIS! 2 LAM Sandra. LESLIE: Can't wait for tonight! Hope you have as much fun as I am going to. Thanks fortakingcareofme. ZetaLove, Sandra. LEIGH: today's the day! Can't wait for tonight. Thanks for taking care of me. ZetaLove, Sandra. ZETATAU ALPHA: The Brothers and Pledges of Kappa Delta Rho hope your Spring Rush was a great success. THE SISTERS OF GAMMA SIGMA SIGMA would like to recognize thenevv Pledgesof the Delta PledgeClass: Carter Lawrence -PresCatherineHawley-V. Pres.StacySevic-SecJoelleSevior,Tres. -Jenna Fazio-SisterLiasonJackieHinson - Historian, Susan Alford, Kimber An- thony, Julie Brooks, Amanda Carver, Marcy Cole, Frankie Collins, Caroline Covuan, Kris Gregory, Kim rack, Misty Joyner, Debbie Knittel, Marsha Mills, Michelle Moore, Amanda Prescott, Chris- tine Riffle, CourtneySmith, Becky Tyson, Kara Webb. Best of Luck Love, The Sisters. CONGRATULATIONSTOTHENEW SISTERS OF CHI OMEGA Michelle BaritelLBeau Beauchemin,Tricia Crotts, Carmen Elles, Julie Fields, Courtney Fincher, Lucy Goodwin, Tiffany Hacke, Lisa Hines, Dee Huskey, Joy Newman, Martha Peacock, Beth Powell, Carlotte Rakowski, Amy Sadler, Kathy Sare, MamiSchlifkirvCaroleSharpless, Mkh- elleSteiner.TuBeThooson.andSteDhanie Withrow. We Love You! COORS: Congratulations on the new changes of the East Carolinian! They look great even though they are a real pain in the a to lay out but other factors work into that! Well not much else to say except that I am trying to take up some space left by New York! See ya later, Your Roomie! EAST CAROLINIAN ACCOUNT EXECUTIVES Karen Bilyj Lindsay Fernandez Matt Hege Aime'e Lewis Brandon Perry CALL 919-757-6366 for more advertising information. : It f Announcements NEW GARDEN OF EDEN. INC We are proud to announce the incorporation of a new non - profit organization located in the city of Greenville, Pitt County, NC Our organization supports the preserva- tion of animals and plants who's ge- netic pools are in danger of extinc- tion. As stated above, new Garden of Eden, Inc. innon-profitand survives solely through donation, grant and memberships. For more information please send a SASE and $1.00 to New Garden of Eden, Inc. C o Mr. Hollis Bracy Lilley, III 100 Duran St. Green- ville NC 27858 or call 355 - 0981 for info. REMOVING INCOMPLETES IN MATH 0001 Students who received a grade on Incomplete (T) in Math Lab (Math 0001) Fall Semester, 1993 must be sure to remove the incomplete by 3:00 pm, Friday March 19, . The math Lab will be open from 2:00 pm until 5:00 pm on Mondays through Thursdays, to allow students need- ing to remove and incomplete time to study, receive any necessary help, and complete the remaining tests, a student with an incomplete from the Fall, 1992 semester, who fails to com- plete the required work March 19th will receive a grade of "f" and will be required to register for and repeat (from the beginning) Math 0001. (Note: Students entering the Math Lab to work on removing an incom- plete must have with them a picture ID). CAMPUS CHRISTIAN FELLOW- SHIP Looking for a fellowship of Christians, a place to pray, study God's word, be involved in social and service projects? Need a refuge from time to time? Campus Christian Fel- lowship may be what you are looking for. Our weekly meetings are at 7 pm Wednesdays at our Campus House located at 200 E. 8th St directly across Cotanche St. from MendenhaJl Stu- dent Center. Everyone is welcome. For more information, Call Tim Turner, Campus Minister, at 752 - 7199. CAREER SERVICES RESUME WRITING WORKSHOP The Career Services office an- nounces workshops on resume writ- ing to be held on Wednesday, Febru- ary 17 and Tue. Feb. 23 at 4:00 pm in the Bloxton house. Participants will learn about format, content and pro- duction of a professional resume. Handouts will be available. This workshop is especially designed for prospective graduates, but is open to anyone. INTERVIEW SKILLS WORK- SHOP Seniors,graduatestudentsand cooperative education students who need help in developing or refining their interview skills are invited to a workshop sponsored by Career Ser- vices. Come and learn special tech- niques that will help you prepare for the job search! The interview work- shops will be held on Thursday, Feb- ruary 18 at 3:00 pm and Thursday, February 25 at 4:00 pm in the Bloxton House. REC SERVICES EXPOSE YOUR- SELF! Show off your roundball tal- ents at the Slam Dunk Contest spon- sored by Recreational Service and Greenville Grand Slam. A informa- tion meeting will be held on Wednes- day, February 17 at 5:00 pm in Biol- ogy 103. Men's and women's divi- sions are open for 8" and 9" and 10" tall baskets. Great prizes for the best Slammers! for more information call 757-8367. REC SERVICES HUNT DEAD ROACHES!?! Yes! And maybe possible a male chest hair, a mattress or even theChancellorssignature. Sound like fun If so, Recreational Services will be sponsoring a Scavenger Hunt on Tuesday, February 16 form 4:00 - 6:00 for West and Central Campus. Come out and enjoy this wild and wacky hunt! For more information Call 757 -6387. PARENTS WITHOUT PARTNERS TheGreenvilleChapter of Par- ents Without Partners will hold a monthly meeting on Tuesday, Febru- ary 16, 1993. Orientation will begin at 7 pm. followed by a guest speaker at 7:30 pm. The regular planning meet- ing will begin at 8:30 pm. The meet- ing will take place at the First Presby- terian Church located in the corner of 14th and Elm Streets. MSA Muslim Student Association meets weekly. For further informa- tion contact Adib Farhadi at 355-6707. POETRY FORUM The Poetry Forum will meet on Thursday, February 18. The meet- ing will be held in Mendenhall, room 248, at 8 pm. If you would like feed- back on your poetry, please bring copies for those attending. BLACK HISTORY MONTH TheGreenviileMuseum of Art located on 802 S. Evans Street will be celebrating Black History Month through an evening of poetry. It will beheld Tuesday,February 16at7pm. There will be a special encore presen- tation Thursday, February 18 at 8 am. For more information contact Billy Walls at 8304260. AED PREMEDICAL HONOR SOCIETY Attention AED members and pledges. AED will meet at the ECU School of Medicine, Brody Medical Sciences Building in the Gold Audi- torium on February 16,1993 at 7 pm. Dr. Ann Jobe will discuss medical school and give us a tour. Remember, the Gold Aud. in Brody 1st floor at 7 pm. No pledge meeting. Announcements 25 words or less: Students $2.00 Non-Students $3.00 Each additional word $0.05 �All ads must be pre-paid� Any orsanization may use the Announce- ments Section of The East Carolinian to list activities and events open to the public two times freeofchar3e. tjetothelimitedamount of space, The East Carolinian cannot guaran- tee the publication of announcements. Deadlines Map To THE EAST CAROL NAN 2nd Floor of the Student Pubs Buildme JOYNER LIBRARY MENDENHALL STUDENT CENTER Displayed $5.50 per inch: Displayed advertisements may oe cancelled before 10a.m. thedayprior to publication; however, no refunds will be given. Friday 4 p.m. for Tuesday's edition. Tuesday 4 p.m. for Thursday's Edition For more information call 757-6366. . mmmmmmmmm mt"s�Hammrm The East Carolinian February 16, 1993 TuesdayOpinion Country must look to unity to heal racism rift "It's all right to be ethnically conscious, but not ethnically controlled This statement is the crux behind ECU's New Gen- eration Campus Ministries program last week that pro- moted unity through religion, as opposed to separatism. NGCM's president, Bryan Evans said that it was time for students and individuals "to look to ourselves as leaders. This program presents a strategy to go beyond the past and to look forward to the future Evans also said that "people need to hear a fresh perspective He commented that the majority of people are following doctrines based on separatism. "We need to be at peace with one another instead of at war Evans said. "We are one As the jury is currently being selected in the civil suit against the officers accused of beating Rodney King, the country waits breathlessly to see if another installment of the Los Angeles riots looms on the horizon. Police chiefs in major (and minor) cities around the nation anxiously await the outcome that will determine whether this coun- try will be subjected to another three days, if not more, of terror and fear. The L.A. riots showed us just how separated this country has become. Mass lootings and burnings oc- curred in the city, not discriminating between black and white store owners. Videotape footage showed brutal beatings of both blacks and whites; police were lost as to how to combat the overwhelming flood of looters and pillagers. A drive through the riot area today shows a person the slow comeback that business owners are trying to make. Burnt-out shells of stores and supermarkets still mark three-day shook this to its knees, pable air of still resides people walking as if they're m t h e riot that country A pal- tension air, with waiting for the other shoe to drop or to be kicked once again like a stray dog This tension shows no signs of decreasing in the near future, either. This country must look long and hard at its stance on racism and discrimination before any light of hope can be seen at the end of this dark tunnel. Imagining that the problem has gone away just because people can't see the symptoms anymore will just make it all the more horrifying when these same symptoms reappear in a much more dramatic form. To paraphrase the quote above, ethnicity should not control a person's life, but rather make a person more aware of his or her heritage. African-Americans have been degraded and debased in the past, but steps are being taken to remedy those past faults. Would having a separate black nation be the answer to all these problems? Absolutely not. Unity is the key here, not separatism. Only by working together�both blacks and whites � can this nation hope to repair the rift and wound that racism and segregation has created. Further segregation would only increase this rift to the point that it very well could rival the one seen in Civil War days. The "Union" and the "Confederacy" are two names that just may see a resurgence, but with vastly different ideas behind them. Rodney King's statement of "Can't we all just get along?" has taken a lot of ribbing and kidding in the media lately. Trite as it may sound, this saying epitomizes the basic need of this country today and in the future. When people can recognize that skin color is not that big a difference, some progress can be made in America. Opinion Page 6 The East Carolinian James R. Knisely, General Manager Blair Skinner, Managing Editor Arthur A. Sutorius, Advertising Director Elizabeth Shimmel, News Editor Karen Hassell, Asst. News Editor Dana Danielson, Lifestyle Editor John Bullard, Aur. Lifestyle Editor Joe Horst, Opinion Page Editor Robert Todd, Sports Editor Warren Sumner, Asst. Sports Editor Sean Herring, Copy Editor Gregory Dickens, Copy Editor Michael Albuquerque, Business Manager Jody Jones, Circulation Manager Cori Daniels, layout Manager Monique Campbell, Asst. Layout Manager Woody Barnes, Creative Director Dail Reed, Photo Editor Richard Haselrig, Staff Illustrator Matt MacDonald, Systems Manager Deborah Daniel, Secretary The East Carolinian publishes 12,000 copies every Tuesday and Thursday. The masthead editorial in each edilion is the opinion of the Editorial Board. The East Carolinian welcomes letters, limited to 250 words, which may be edited for decency or brevity. The East Carolinian reserves the right to edit or reject letters for publication. Letters should be addressed to The Editor, The East Carolinian. Publications Bldg ECU, Greenville, N.C 27858-4353. For more informa- tion, call (919) 757-6366. Printed on 100 recycled paper A VIEW FROM ABOVE ByT. Scott Batchelor IRS tax forms: study in sadism, bureaucracy The friendly folks at the U.S. Department of the Treasury sent me my tax forms the other day. They call the form 1040 EZ, with a play on the word "easy (Boy, what a bunch of wacky punsters those guys are!) I read over the booklet that comes with this form as soon as I received it. I mustadmit that in several years of filing taxes, this is the first time I've sat down and really read the information. There's one section which addresses some questions people frequently ask, called "Answers to frequently Asked Questions" (page five of the booklet for those of you playing along at home). One ques- tion asks, "Do I have to file a re- turn?" The reader is directed to page nine where, in true govern- ment style, a whole page is used to basically answer, "Yes, you do ha ve to file Another item in the booklet reads, "Gift to reduce the public debt Apparently, there are people out there who forgot to take their medication and they call the IRS and ask i f they can send even more money than thegovemmentwants. Theitemcontinuesasfollows: "You may make a gift to reduce the pub- lic debt. If you wish to do so, en- close a separate check with your income tax return. Make itpayable to 'Bureau of the Public Debt Reading this, one overwhelming question came to my mind: Are Jim and Tammy Bakker writing the tax booklets now? The last page of the booklet has some enlightening information. It reads, "In fiscal year 1991 fed- eral income was $1,054.3 billion and outlays were $1,323 billion, leaving a deficit of $268.7 billion To put this into perspective for the college student, this is like writing a $50check for the keg when you've only got $35 in your checking ac- count. The federal government calls this a budget defici t; the police call it check kiting. Both are crimes and should be punished as such. Filling out theactual tax form itself is the most fun. As the saying goes, if you put an infinite number of monkeys in a room with an infi- nite number of typewriters, they'll eventually produce an IRS tax form. One of the first items on the form reads'Presidential Election Campaign : Do you want $1 to go to this fund?" and you check yes or no in the appropriate block. I can see a television commercial di- rected towards people who check yes or no in the appropriate block. "My friend, did you check "yes" to sending money to the Presidential Election Campaign fund on your tax form? If you did then come on down to Crazy Jake's Auto Sales where we've got a deal for you. New 1992 Yugos for just $37,995; recently acquired Russian�made automobiles starting at $30,990; and a special deal on used 1984 GM pickup trucks Then there are the instruc- tions. "Subtract line 4 from line 3. If line 4 is larger than line 3, enter 0. If line 6 is larger than line 7, or you were born in a month thatcon tains an "r subtract line 7 from line 6, unless you are currently with a resident from G uadalupe, in which case you divide line 7 by pi times the square root of the IQ of the sadist who produced this form All this j ust so you can find ou t that you owe the government more money. This brings up an interesting question. Just where does all this money go? On the last page of the booklet there are two pie graphs, one showing where federal gov- ernment income came from in fis- cal 1991, and the other showing where the outlays went. Sixty-five percent of what the government took in came from personal income, social security, Medicare, unem- ployment, and other retirement taxes. The biggest receivers of money were social security, Medi- care and other retirement, defense, veterans and foreign affairs and � the saddest revenue sapper of all � net interest on the debt. This is how our money is spent. In her note to the Taxpayer, on page three in the 1040 EZ book- let, Internal Revenue Commis- sionerShirleyD.Peterson refersto us as "customers" of the Internal Revenue Service. This is a bit odd. When was the last time you were forced to buy a stereo or micro- wave, or were ordered to choose a certain dish ata restaurant? No, we are certainly not "customers If we are, then we're being forced to do business with the company store. So happy tax filing. I certainly hope you don't have to pay any- thing. Maybe you'll actually get some money back. And remem- ber, if you get the urge to write a check to the Bureau of Public Debt asagift to reduce thedeficit,justsit down and wait for it to pass. fatfW. Vfe�Wfft�M MR,M&Cmf&fttm cafe QuotcoftheDay: To like an individual because he's black is just as insulting to dislike him because he isn't white. e. e. cummines Letters to the Editor Students chided for behavior at Chomsky talk To the Editor: I attended the afternoon lecture given by Noam Chomsky on February 9. This letter is addressed to the people (the thoughtless ones) who either attended or di- rected their students to attend. Several students at- tended the lecture without having the slightest idea of who Noam Chomsky is or what he does. The February 4 edition of The East Carolinian carried an excellent letter by professor Hal Daniel, who listed some articles to read. As I left the lecture, I overheard several young fe- males remark that they "don't see what he has to do with psychology Again, a lack of preparedness on their part. Also, psychology is not all clinical. Some instructors obvi- ously assigned this lecture as extra credit or as a require- ment without briefing their students about Chomsky's work. Lastly, to the students who giggled, chatted, gos- siped, jingled keys and were otherwise bothersome; you and your actions were rude. If you cannot act as adults, please don't attend the lec- ture. P.S. George Graduate Student Psychology � LOVELOOKtN ficr-m i4ue an MY &' VTH WHAT HAMB ON , THAT By Amy E. Wirtz SI swimsuit issue not worthy of pornography label TheSporfsIusrraferfswimsuitissueisdue out this week. With it comes the same old controversy: cries of soft- core pornography and degradation of women. But to attack SI and call it "pornographic" is unfounded. Undoubt- edly, many feminists would have me locked away for my views on this, but it is something they (above all others) need to hear. The American culture hasa problem with sexuality. It has not and probably never will be completely embraced, since people tend to be scared of their own, and other's, sexuality. Camille Paglia, a humanities instructor at The University of the Arts in Philadelphia and au- thor of the book Sexual Persotwe, states that: "profanation and violation are part of the per- versity of sex, which never will conform to liberal theories of benevolence We've been brainwashed to believe that the only way to be good is to abstain from sex. Paglia also believes that the knowledge of "fantasies is expanded by pornography, which is why pornography should be tolerated, though itspublicdisplaymayreasonably be restricted This isn't to say that it should be accessible to everyone. Certainly children do not need to view a Playboy or Penthouse asparlof their sexual education. But we aren't discussing Playboy. What we're discussing is Sports Illustrated. Now come on, take a real look at the swimsuitissue. Those models are there because they want to be there. Posing that way is, very simply, part of the job. The real issue is that nudity, or partial-nudity, intimidates people. People don't want to believe that the human body is a beautiful thing. Over the years it has been made in to something vulgar, to be hidden away and a vessel of sin. Many argue that women should not be rated by how they look. Unfortunately, that is uheprimarywayfhatweidentifyeachother.Anti- pornography supporters twist thatand use it to their advantage. What they're saying is that it's O.K. to size someone up visually at first meet- ing but to feature a woman's body in a maga- zine is degrading. This is a blatant double- standard. Another argument, which is somewhat founded, is that female athletes should be fea- tured instead of the swimsuit issue; females are not getting as much coverage as their male counterparts. What if the female athletes were in bathing suits? Would that be acceptable? I'm sure it wouldn't, because then thev would be featured as sex objects. I hate to say this, but we areall objects ofsex.Weare sexual beings. Until we realize this, there will be disa rd among all. I'm sure the religiously pious are fainting right about now, since sexuality is not part of any religion'sdogma. Until we start identifying and coming to terms with this part of ourselves, we will be perpetuating an age-old issue. The swimsuit issueisnot changing Ameri- can society and hurtling it towards inevitable destruction. In fact, ignoring this facet of our- selves is probably destroying us more than a mere magazine. So please, if you don't like to look at beautiful women in bathing suits, don't open the magazine. Millions of others in touch with their sexuality will. � . ' M � �amun The East Carolinian FEBRUARY 16, 1993 Lifestyle Page 7 Conversing with Noam Chomsky �ditor's Note: The following is a conversation between staff writers Franco Sacchi and Nathanial Meade with Noam Chomsky, which will be printed in two parts. Lookjbr the second installtnent in the Thursday, Feb. 18, edition. On Feb. 9, Noam Chomsky came to ECU and spoke at Mendenhall Theater. In his usual bold and incisive style, Chomsky discussed contemporary subjects ranging from the political philosophies of David Hume and Adam Smith, to global informa- tion control, to the subtle influence of Ameri- can sports. For those unfamiliar with Chomsky, he is presently one of the most famous linguists in the world and has had books published worldwide. Amonghismostrecentpolitical works, Deterring Democracy has received much a Mention. Now 65 years old, Chomsky has taught since 1955 at the Massachusetts Institute of Technology, where he became a full professor at age 32. He is widely known for his dedicated probing into the dark side of American foreign policy, as well as his in- depth study of information control in Ameri- can society. Much of what Professor Chomsky has to say seems offensive and outlandish, yet this is mainly because the topics themselves are of such intense significance for our soci- ety. For this reason, most of his work has been published in the "alternative press" and has remained largely hidden from the lay public. At the same time, the mainstream media continues to marginalize Chomsky's work. Chomsky is not a pol i tician but a scholar. Every detail, every accusation, is substanti- ated by hisrigoroususeof primary research� from archives and other forms of official documentation. For this reason, his adver- saries have repeatedly relied on a single weapon: silence. The following interview only skims the surface of Chomsky's sweeping thought, which is extremely difficult to compress in a single article. We hope the following inter- view will give those not present Tuesday night at least a taste of this fascinating mind. Here, surely, is one of the great free-thinkers of our society. During the interview, Profes- sor Chomsky was wearing sneakers and had a distinct bounce in his step. THE EAST CAROLINIAN: George Bush's behavior during his term as presi- dent often seemed to have traces of Messianism. Do you think Bush ever had a bigger plan in the geopolitical arena, a hid- den agenda for a truly new world order un- der his leadership? From this point of view,howis President Clinton's positiondif- ferent? NOAM CHOMSKY: I don't accept your premise. I think George Bush is a minor bureaucrat who was following orders all his life.Take a look at his history. He came into national prominence as U .N. ambassador in 1971. He was then head of CIA, then in the House of Representatives, then vice president and president. He was a loyal servant of the law. I don't think he had any grand mission � Noam Chomsky you know, big-plan thoughts in his head. When any president, or any leader, of any country tries to mobilize the population for a dangerousand violent action, they always invent a messianic purpose. Ican'tthinkofahis- torical exception to that. He couldn't think of anything, so he came up with New World Order. What did the words mean? Zero. He didn't know wha t they meant, and nobody else knew what they meant. It's just tha t he had to mobi- lize the population for the Gulf War. The New World Order was just a joke. He had no concep- tion of anything except serving the interests of American wealth. Clinton, as far as I know, is about the same. TEC: Given the complexity of modern society and political system, very few people seem to know where the center of power is. From this perspective, can the president of the United States have any real control of the situation? Can President Clinton promote the necessary, large scale changes mis coun- try needs? NG Clinton won't try to promote big change. If you look at the day after the election, his campaign promises and ambi- tions quickly disappeared. That's not sur- prising. I can't imagine why anyone would be surprised. The day after the election, the front pages were telling us that Clinton's advisors said theambitious social programs they's been talking about would have to be dumped, but that there would be a little- discussed tax that would benefit investors. Big surprise. Then take his position on Haiti. Yes, he had something to say about that, though it was contrary to what he had said during the campaign. Now he was going to intensify the same Bush policy he had op- posed. And so on down the line. If you're sophisticated, all of this is well See CHOMSKY page 10 Ray dispels Hollywood-hype image By Joe Horst Staff Writer She's a down-home country girl who went to the Big City and became a star. That's one way you might de- scribe the life of television star and ECU graduate Connie Ray. But, don't ever think for a minute that Ray has bought into that glitzy and glamorous image that people see of actors and actresses. Ray said at a recent luncheon that people need to realize that actors are human, too. "You turn from Connie Ray, the person, to Connie Ray, the thing Ray said. "Connie Ray, the thing, is not me. Connie Ray, the thing, is a product and it's some- thing that I sell. The real me is over here. "If you start buying the hype, you get really weird. You start be- lievingall rhatstuff. Youhear about people acting bad and throwing fits, it's because they bought the hype. They believe they are the thing, the product. That's not what we are. When you get so big, you either completely become the prod- uct or you stay a real person Ray grew up in White Cross, N.C, and this Southern upbring- ing shows up in her plays, like Smoke on the Mountain, and when she talks about how it's influenced her life. "There's something to be said for growing up in the South, with that good Southern heritage Ray said. "I was taught as a kid that Southern work ethic�you work and you do as good a job as you can no matter what that job is. "I am a good Southern girl who is hard-headed to the nth de- gree, and I will not give up. My image for myself you ever had a 'Sniper' hits ifs target, barely By Ike Shibley little puppy? And you play with him with those rag toys? And they clomp down on it and they won't let go? And you can sling them around in the air and they just don't let go? That's the way I look at what I want to do. I'm a very goal-oriented person Ray also commented on the stereotypical image that Southern- ers have around the country and how she combats it with her work. "I'm really proud of being a Southerner Ray said. "When I went up North, I can't tell you how many people said, 'What's your name, Daisy Mae?' You watch tele- vision, and everybody's laying on hay, telling jokes�three teeth and overalls. Connie Ray "That's not the people I know from North Carolina. The people that I know from North Carolina are good, sturdy people with in- tegrity and a morality that I would not trade for anything Through her playwriting, as seen in Smoke on the Mountain, Ray wants to portray Southern people as they really are, not the popular hick image. "My writing preserves the Southern way of life I knew � Southern people have more than three teeth and they do wear shoes. I will go to my death championing a good Southern character After growing up in North Carolina, Ray came to ECU and earned a degree in dance. But she Photo courtesy ECU Theatre Department used that work ethic that was so instilled in her to get people to look at her in the theatre. "I had to use my wits to figure out a way to get casted in a play Ray said. "Don Biehn an ECU the- atre professor was directing Who's Happy Now and we had to read from the script and to sing a coun- try western song. I decided the best way to get myself noticed above everyone else, was to write my own country western song. Which I did, and it went over great, and I got the role Ray also said that she looked upon her liberal arts education in college as one of the most impor- See RAY page 10 Staff Writer Sniper, a new film that pre- sents a different look at the hor- rors of a different kind of war, unfolds in the jungles of Panama. Tom Berenger plays Gun- nery Sergeant Thomas Beckett, a marine whose profession is assassinating people. Beckett is a sniper whose spotter gets shot as the film opens. A civilian named Rich- ard Miller, played by Billy Zane, is sent to replace the slain man and aide Beckett on his next as- signment. That assignment is executing a Panamanian gen- eral who threatens to disrupt the free election slated to be held in that country. Miller has never killed any- one before and Beckett senses this. Beckett feels that Miller will be a liability unless he can be counted on to pull the trigger in a moment of crisis. Sniper chronicles the mis- sion of Beckett and Miller through the forest to their final destination at a seaside haci- enda. Films like Sniper usually in- trigue the audience for the simple reason that a person who can kill without compassion poses an enigma. The very fiber of a person's soul cries out against the slaying of another human being. Only in the military struc- ture is killing another human being not considered a crime. The military complex actually fosters an indifference in its re- cruits towards killing. The entire military structure rests on the proposition that the killing of a person becomes ac- ceptable if the government sanc- tions such an act. War films, at least the better ones, explore some facet of this philosophical stance. In Sniper, Thomas Beckett interests the viewer because of the detached manner in which he views his job. He kills on command and without compas- sion. He kills for neither anger nor fun. He kills because he can. He's good at it. Had Sniper probed Beckett's mind, his past and future, then the film may ha ve been on firmer ground as an interesting study of man. Instead the film's mak- ers concentrated on the assassi- nation. The story they tell never re- ally drags, much to the film's credit. For almost two hours nothing fills the screen but Beckett and Miller surrepti- tiously edging closer to their bounty. The tension builds, but the crescendo is dampened by insipid, cliched dialogue. Miller asks Beckett about his dreams and Beckett talks about fishing in Montana. Beckett makes melodramatic statements like: "If I wasn't prepared to die, I wouldn't be out here A silly facet of the story in- volves Miller's assertion that he is in charge of the mission be- cause he was sent by Washing- See SNIPER page 9 Attic Society revisited Michael Preston Staff Writer The "Attic Society Revisited ECU Student Union Foru m Commi ttee's on- going roundtable debate series, is pre- senting their latest topic. The debate, titled "The Future of Eastern North Carolina; Devel- opment, at what Cost?" takes place tonight at 8 in the Mendenhall Stu- dent Center Great room. The heated topic, which has made or bro- ken political careers, takes a look at the im- portance of both eco- nomic development as well as environmental preservation. Six panel- ists from throughout Eastern North Carolina will tackle this touchy subject. The panelists represent various po- litical views and invested interests. Representing theeconomic community is Steve Byran of the new Kinston Re- gional Jetport and Mark Finlayson of Weyerhauser. The environmental team includes Vince Bellis of the biology department and Davia McNor of the PamlicoTar River Foundation. To make things in- teresting, Phil Dickerson, a county engineer will be caught in the political middle. "The Forum Com- mittee feels strongly aboutthisdebate'said David Belch, a Forum Committee member. "There are not many places where you will find theTarRiver Foun- dation and Weyerhauser taking each other on outside the political arena The Attic Society is a rebirth of an Oxford debate club. Being a roundtable discussion, the members are spurred on by a modera- tor who plays Devil's advocate. �� There are not many places where you will find th� Tar River Foundation and Weyerhauser taking each other on outside the political arena David Belch Nonfiction writer to speak on campus Eddy Harris will read from his latest novel By Chandra Speight Staff Writer Nonfiction writer Eddy Harris will read from his latest novel in Mendenhall's Great Room Feb. 17 at 8 pm The novel, relating Harris's motorcycle trip through the southern partof the United States, will bepublished this Spring. Ha ms,aSt Louisnative,attended Stanford University in California. He worked as a jour- nalist for several years, but now devotes his time to writing novels. A world traveler, Hir- ris has lived in numerous countries including England, France and Africa. Currently, Harris resides in Harlem. ThR)ughvvriting,Harriscorrelateshi5 trav- els to his personal growth "M ississippi Sok his first novel, concerns his solo canoe trip down the Mississippi River. Harris's second novel, "NativeStninger br ught him much success. Harris traveled ti i Africa in order to better understand his rela tionship with the country. He tells of his ex- periences in the novel. Originally published only in the United States,Penguin Books is now producing an edition that will be published internation- ally. The Student Union Minority Arts and Forum Commit- tees, in conjunction with the Department of English and the graduate colloquium, combined forces to bring Harris to ECU. "Harris possesses an innatesenseof curi- osity and intuition that compels him to travel to a variety of places in (rder to better under- stand himself and others Professor Julie Fay Eddy Harris of the ECU English De- partment said. "He will appeal toadiverseaudi- ence "Our main pro- gram goal is to work in conjunctionwiththeaca- demic departments to bringinquality,thought- provoking speakers said J. Marshall, Mendenhall Student Center's assistant direc- tor of student activities. "A more specific goal is to educate the univer- sity and community au- diences in different cul- tures in conjunction with African American Awareness Month Marshall also ex- pressed his gratitude to the ECU English Department for their efforts. 4? 1 � � - II � 8 The East Carolinian FEBRUARY 16, 1993 The Orb displays inorganic sensuality By Thomas Croft Staff Writer It's cybernetic cosmo-zwhirl, humming and fading and pump- ing quaalude post-rave rigor mor- tis. It'svirtuaJsensuality,aural plas- ticity for the faceless e-ball genera- tion. The Orb's second album, UF.Orb(BigLifeMercury),sounds mysteriously like their first, The Orb's Adventure in the Underworld. Both have recieved critical acclaim, probably due to The Orb's epic es- capism, both on record and as an artistic, musicial outfit. The Orb is the synthetic off- spring of techno celestia 1-head s Dr. Alex Patterson and Thrash. It sounds like hyperspace techtonics with rave-hall house beats. Butitbeatsthegenericmael- strom of daydream nation generia that manifests rave culture and the hype. There'sa sick musicality about The Orb, and about U.F.Orb. The CD (74 minutes) comes complete with an extra, bonus CD (66 min- utes). When The Orb records its inorganic unsensuality it delivers � not skimping out on quantity here. In terms of quality, however, TheOrbwavesabitflaky. Aestheti- Photo courtesy Mercury Records Tlie Orb cally, U.F.Orb is excellent to study, read, garden, cook, relax, sleep, write or dance to. Though tremen- douslyfunctional asanatmospheric link to alien lifeforms and a smokescreen tobackground silence, The Orb crosses over enough gen- erative sound associations to oftentimes evade anv musicality at all. It is crystals and incense and trippy and throbbing. It's micro- chip masturbation. U.F.Orb contains seven tracks, though you'd never know it. The bonus CD contains four tracks, though you'd never know it. The album is a great investment if you want to create a "mood" at a din- ner party, drug sit-in or romantic engagement. The record also con- tributes utility to anyone's need of changing a given mood or elimi- nating any uncool vibes or bogus atmosphere. Elephant breathing, Japanese flutes and Radio Moscow are only some of the gems that pepper The Orb'saural feast of crazy whacked body grind candy samples. There's something disturbing about The Orb, not musically but inprinciple. One person; one com- puter. The Orb. The formula can be as spooky �if long-time pondered�asarti- ficial intelligence orauto-pilot cars on L.A. freeways. It is the antithesis of 1960s psychedelia. It is faceless, voice- less; it has no plasma. Celestial information-age commando futurismo overload cyberpunk hemmorage brain-lobe antiseptic asphaltcream. Liqui-pulsatepush- button chugg plastic hippo revolu- tion emotion vacuum slippy striped strobe green Doc Martin mega-hatted plaid puke in the af- ternoon nipple-pierced relax. Mary's Danish sets new, unique standards By Chandra Speight FREE PREGNANCY TEST while you wait Free & Confidential Services & Counseling Carolina Pregnancy Center 111 E. 3rd Street The Lee Building Greenville NC 757-0003 Hours: Monday - Friday 8:30-3:30 aff Writer Mary's Danish is one of those bands that can't be compared to any other band. Maybe we want to say they sound like the B-52's and The Bangles mixed with Kiss or something crazy, but no, the truth is Mary's Danish sounds like Mary's Danish. Then again, on some of the slower numbers, thevocals sort of sound like Rindy Ross of QuaterFlash. Well heck, throw Alannah Myles in too. But those are slight similarities. American Stamford,theband's third album, features a cover with a sloppy cheeseburger perched on Uncle Sam's hat. I like fun album covers, and this one is fun. The press release says the cheese- burger is really a veggie burger � which is still swell � -rid it symbolizes that "Americans are fed up with the country and its politics being reduced to fast- food, artifice and seven second sound-bite ideologies Well, well, well. I like it. The music is sometimes fast and furious, sometimes eclectic, but always good. I especially like one of the mellower tracks, "O Lonely Sou I, It's a Hard Road It's a moving number about being alone, and the vocals, smooth and syrupy, are every- where. Here's "Killjoy the first track: "You'rea killjoySuffocate the rising sunJoy � you always take it backTo the place where pride and vice are one If that's not a killjoy, what is? "Killjoy" is swell, but I'm more moved by "Porcupine a shakin'short little number about not getting along: "ain't got time to work it outSo why not sit at homeAnd sing a little song about ha ting everyone you know Other tracks on the album include "God Said a little ditty about televangelism; "Leave it alone another little number ah ut not getting along; and "Weeping Tree a great rockin' song about how music, like po- etry, revealsemotion. There's lots of references to guns and stuff everywhere too. American Standard is for people who stay away from too much mainstream music. But then again, it's music for everybody, especially fun people. On the ol' one to ten, I give Ameri- can Standard an eight. WHO COULDN'T USE SOME �. Greenville's Source for Books Magazines & Newspapers Hardback and Paperback Books 3500 Magazines Titles Bargain Book Collection from $2.98 up Local and Out-of-state Newspapers (updated daily) Large Selection of Trading Cards Greeting Cards 1993 Calendars Gift Certificates Available we recycle paper products Central Book & News Mon-Sat 9:30am-9:30pm Greenville Square Shopping Center 757-7177 i nil (-iumi sessions iti sriii ,1 in pi 11. tr flic (oi nun mill i miu in n ih Mmli 2d. IWJ (i.MM I ,nn GMAT Review Course Course Schedule: TuesdayFebruary 23 ThursdayFebruary 25 TuesdayMarch 2 ThursdayMarch4 TuesdayMarch 16 ThursdayMarch 18 (no clasa diring Spring Bred) Course Time: 7:00 p.m9:00 p.m. ONLY $149 Cost unhides till tiistiin lloniil fees and two popitlar UMAI Verbal and Math Topics To Be Reviewed: � Sentence Correction Reading Comprehension � Critical Reasoning � Problem Solving (Arithmetic, Algebra, Geometry) � Data Sufficiency Location: ECU School of Business, BB&T Center for Leadership Development, General Classroom Building, Suite 1200 Instructors: Course taught by full-time ECU faculty Texts: The Princeton Review: Cracking the System: The GMAT The Official Guide for GMAT Review � iixltian tctaai GMAT question wilt) �otaaom) Presented by ECU School of Business � Professional Programs 1200 General Classroom Building (919) 7S76377 Canned Hams GOLDEN RIPE Dole Bananas "IN THE DAIRY CASE" CHILLED, REGULAR OR COUNTRY STYLE Donald Duck Orange Juice 6OZ. 99 Stog Pizzas FROZEN, ASSORTED VARIETIES Fox De Luxe 5)7 oz. � PKcs.m "IN THE DELI PASTRY SHOPPE" Chi-Chi's Tortilla Chips BUY ONE GET ONE 11 OZ. CAFFEINE FREE DIET PEPSI, MOUNTAIN DEW. DIET PEPSI OR Pepsi Cola $mo9 2LTR. 1 COPYRIGHT 1993-THE KROGER CO. ITEMS AND PRICES GOOD SUNDAY FEB 14 THROUGH SATURDAY, SEPT.20 1993 IN GREENVILLE. WE RESERVE THE RIGHT TO LIMIT QUANTITIES. NONE SOLD TO DEALERS. WESTERN I I MONEY union! transfer The fastest way to send money. AVAILABLE AT ALL KROGER STORES. ADVERTISED ITEM POLICY- Each of these advertised items is required to be readily available tor sale in each Kroger Store, except as specifically noted in this ad. If we do run out of an advertised item, we will offer you your choice of a comparable item, wnen available, reflecting the same savings or a raincheck which will entitle you to purchase the advertised item at the advertised price within 30 days. Only one vendor coupon will be accepted per item purchased. ��Hi HHSMMMMMIM MM1 K. FEBRUARY 16, 1993 The East Carolinian 9 Jatit nun r T2Lj UJ& !By JiJiarJ. Czanuum Competition is hell ALFREDO'S New York Pizza By The Slice DOWNTOWN 218 E. 5th St752-0022 Exercise is important, and I try to get some now and then. I was playingsome rowdy racquetball the other day with this groovy guy, and he was about four points down. It was his serve and he bounced the ball, jumped in the air and hit it between his legs. He lost his serve because the ball went straight t to the floor, but it killed me the way it did mat. It was a good game, lots of laughs. Anyway,that'sswell,butIdon't want to talk about him, I like him. I want to talk about people I don't like � those ultra-competitive people who take the fun out of ev- erything. Have you ever done anything with these people? If you haven't, you are one of these people: stop reading now or you're going to get your feelings hurt. But probably not, you're insensitive. Those people, let's call them "turds are everywhere. You can't play basketball,racquetball, volley- ball, Trivial Pursuit or make salsa without some turd telling you or showingyou how itshould be done. And if they should happen to lose or bewrong! World coming toan end! That's when the ailments and aches come climbing out of their large mouths like maggots from a dead raccoon that swells u p and bursts in the sun: "my arm is still sore from curling 1,000 pounds Look,has this ever happened to you? You cook something�potato salad, for instance�and you bring some with you to school or workfor for lunch, and you're eating it and the local turd says, "what are vou eating?" Potato salad. "Did you make it?" Yes. "What did you put in your's?" And as soon as you say pota- toes, onions, blah, blah, blah, what do you get? "Well this is howdo it Oh goody thank you little turd ofa super-cook for letting me know that my humble littlebowlof potato salad doesn't make the grade. Oh, well. But that's nothing. Let mesha re this with you. As you may know, I no longer have a car since the little accident with the pipe bomb, so I rely on others for transportation. OK, so I'm playing racquetbal 1 with this turd. Now, I already knew he wasa turd; I've played disc golf and volleyball with him (Heaven help you if serve into the net when you're on his team!) HedroveusuptoMingessowe could play. In all honesty, the only way to get to these people i s to make them lose in a big way; it eats at them likeacid,oryou could laughat them: they're usually so intent of putting up this facade of conde- scending superiority that they're easy to put down in front of every- body. Anyway, I had toputasideall my goofiness and stuff 'cause this was going to be a serious match. I thrashed him soundly. Now, I'm sure his fragile ego wasn'tbruised,afterall, I laterfound out that he had aggravated an old arm injury and he had been sick. But that's not the point. The point is, he made me walk home; he couldn't give me a ride, he said. The nerve of this turd. Maybe I should have let him win once, maybe. So, we don't play racquetball anymore because he can't stand to lose, and I made sure he never won again. OK, OK, OK. My point is that nobody likes you if you're that way, except your mother. If you're going togoaround informing everyone of your superiority, then be a good sport about it when you lose and be in good humor when everybody picks on you because they hate you.Sohavefun,forcryingoutloud! You'll end uplike thebully in Back to the Future if you don't, or you'll die of high blood pressure. One last thing: Peel and slice potatoes, boil til tender. Add sliced onions and green peppers, salt and lots of pepper. Throw in some rel- ish, a chopped boiled egg, some Miracle Whip, mustard, and a little sour cream. DAILY 5-8 PM 2 FOR 1 SPECIAL BUY ONE GET ONE FREE DINNER MENU: 2 CALZONES, 2 STROMBOUS, 2 BEERS, 2 DRINKS r ALFREDO'S 2 Large Pizzas wiffi 7 Topping 6.99 with this coupon ALFREDO'S 1.75 Pitchers Sun, Mon, lues with this coupon HOME OF THE KILLER SLICES SNIPER Continued from page 7 ton, D.C The sequence in D.C which only occupies five minutes of screen time early in the film, plays as trivial � like actors trying to muster enough energy to sound ominous. The scene leaves the viewer feeling uninvolved. As the scene ends, one can practically vi- sualize the actors walking off the set at the end of the take. The basic storyline itself plays as cheap melodrama � an aged veteran has to handle a young hot shot, the young hot shot rebels but eventually matures and ends up saving the aging veteran's life in the final reel. Sniper is one of those films that your dad might enjoy. Sniper manages to maintain a tense atmosphere with adequate direction from Luis Llosa and an eerie soundtrack that underscores the tension evident on the screen. The locations � Sniper was filmed entirely on location in Panama and Australia � add to the gritty real- ism for which the film strives. The use of camouflage and the art of sniping provide an interesting side- light to the ma in story. Even enough plottwistsare included to keep the film from becoming trite. If you enjoy war films then Sniper should keep your interest. It chronicles war in a manner suit- able for the types of conflicts hap- pening in the '90s. Sniper possesses most of the admirable qualities of a war movie. Unfortunately, war movies have not as a rule, gained the distinction of being an admirable genre like Westerns and crime stories have. Still, Sniper provides enough entertainment to warrant a recom- mendation no matter to whatgenre it belongs. Lifestyle Writers � I have some new stories! Stop by and pick up an assignment or two. Thanks . . . Dana STUDENT APPRECIATION DAY TUESDAYS IN FEBRUARY at SEAFOOD 626 S. Memorial Drive Present your 1993 Student ID Card and get: YOUR CHOICE OF ANY DINNER FOR ONLY $029 Excluding platters & family packs Not valid with any other discounts Beverages and desserts not included ATTIC �; The 2�NE : i liimnnHUMiMiTrTrrr 752-7303 i 209 E. 5th Wednesday, February 17 FRANK BASTILLE I I I I I I I I I I I I I I I I I I SPENDTHE FUNNIEST NIGHT OF YOUR LIFE $1.SO HI BALLS $1.50 TALL BOYS i Bring In This Ad For $2.00 ADMISSION before 10:00 PM I DBHI HB I i ROCK FOR REAL DILLON FENCE SIDEWINDER I i Benefit for Real House $2.00 32 oz. DRAFT $2.00 32 oz. DRAFT � FEATURI THE GREAT SAVINGS FOR SPRING SKIING LAST CHANCE SALE February 14-21 All Ski Jackets & Sweaters 25 off Mens, Womens. Child'ens February 22-27 40 off March 1-7 50 off WILL YOUR JACKET STILL BE THERE? Great Sale Prices on Ski Packages make your own packages) GORDON'S GOLF & SKI 200 E. Greenville Blvd. 756-1003 0 itlJ43�liV4 Rove �VJik'l4H�7.iVJ�i CLASSICS NIGHT $3.00 Members $4.00 Guests 0 DRAFT ALL NIGHT! $3.00 Teas & Bahama Mamas � 504 Jello Shots � 754 Kamikazes SWEET 16 NIGHT $1.00 Domestics � $2.75 Pitchers � $3.00 Teas & Bahama Mamas 50C Jello Shots � 75� Kamikazes � 75 100 M.P.H. RUSH HOUR FREE Admission for All 7 til 9:00 $3.00 Teas & Bahama Mamas � $2.75 Pitchers � 500 Jello Shots 750 Kamakazes � 750 100 M.P.H. wmmmmmx i iu i �iLvmmmmmmm DflNoE PaRTY HI 10 The East Carolinian FEBRUARY 16, 1993 RAY tant things she ever had. "The more you know about � everything, the better off you're gonna be in the real world Ray said. "Knowledge is a very power- ful tool. "I grew u p here in a lot of ways. I made enormous mistakes here, butl learned from them. I was given enormous opportunities, just from hard-headedness and a certain CHOMSKY amount of talent. I look back on going to college as a great gift When asked whether she could give any advice to students who were graduating, Ray said that ev- erybody will find their own way to succeed. "Who am 1 to come here and go, 'Yes, I'm a big success and I'm gonna tell you how to do it? Ray said. "That's such baloney. You're gonna have to figure out your own way. Everybody has their own unique way of finding their way, and finding their way to success. "The way I looked at it � and I betcha the way you'll look at it, too�well, somebody's gotta make it. They say only a tiny, tiny little percentage of people ever make it in acting � only a tiny, tiny little percentage of people ever make it Continued from page 7 Continued from page 7 in what-not. Well, I want to be part of that tiny, tiny little percentage. If everybody falls over and gives up, nobody'll ever make it When asked about the enter- tainment business as a whole, Ray said that it is a "look" business that is especially hard on women. "Show business is really type- oriented Ray said. "You're the blond bimbo, you're the plump mother, you're the studly guy. You can either grab on to it tight, which makes it easier for them to cubby- hole you, or you become a leading lady, or a leading man. "There are 70,000 professional actors in L.A. Last year, there were 50,00 jobs. 16,00 of those were for women. What does that tell you? It's really hard for women Lee Norris, Ray's co-star in the new sitcom Almost Home (which airs Saturdays on NBC at 8 p.m.), summed up Connie Ray�the per- son and Connie Ray � the actor in few short sentences. "She's a great person Norris said. "She's fun to be around, to work with. When's it's really tight on the set she's always there, and happy and smiling. "Sne's really good understood. Remember when Bush raised the taxes, and everyone was screaming at him? There was an Op-Ed in the Bos- ton Globe, written by some respected academic, saying, "Look these criti- cisms of Bush are completely unfair. We have to understand that there'sa difference between running for election and governing. The pur- poseof runningforelection is to win. The purpose of governing is to do what's best for the country, which may be the opposite of what you promised Okay, well there's a little faker here too, because it's not the country you're doing the best for. But what you're saying is that election prom- ises are made to be broken. They're just part of the technique of getting someone into office. No one should take them seriously. Now the cynicism towards de- mocracy � this editor is a bonafide Kennedy liberal and an academic� I is unimaginable. To them the situa- ! tion isjusta nuisance. Sure, we have tohavedemocraticreforms,butwe're not going to let them truly function. If Clinton really did try to do something�I mean, let's just say by ! some miracle Clintondid try tocarry out reform programs�it wouL 't ! amount to anything. Say I was elected president and i wanted tocarry outreformprograms, I wouldn't be able to do it. In a state capitalist society, especially an inter- national state capitalist system, it's the people who control me resources who run everything. They set theconditions in which decisions are made. If theydon'tlike what'shappening, they disinvest and 46 .The purpose of running for election is to win. The purpose of governing is to do what's best for the country, which may be the opposite of what you promised. the decisions can't be made. TEC: How do you think the powerbrokers of the West view the situation of instability- in Eistern Europe, the war in Bosnia? NC: I don't think the West likes the situation. They just don't know what todoabout it. The West would much prefer to have Eastern Europe go back tobeinga well-behaved sec- tion of the Third World, as in the old days. TEG But this would be more an advantage for Germany than for the United States. NG Sure,andifyou'venoticed, Germany hasbeen in theadvance on this situation. The United States has dragged its feet all throughout the '80s about the liberation of Eastern Europe. The United States tried to bar Ost-Politik a West-German term. They didn't like the increase of East- West trade. Just a week before Ukraine declared independence, Bush made a big speech saying they shouldn't declare independence. In fact, all the way through the United Noam Chomsky Stateshasnot wanted independence for Eastern Europe for thevery simple reason you just mentioned: Ger- many is much better placed than the United States is to take advantage of the new Third World. In fact, if you look at Germany policy, it has a lot to do with what's happeningin Yugosiavia.Germany, unilaterally (because there big guys too, the- do what they feel like) and against everyone's objections, has said it would recognize Croatia and Slovenia. No one wanted them to do it. Slovenia, therichestpart,ispretty mucha partof Germany. So Slovenia isn'tabigthreatandnomingtoworry about; and they're integrating back into the West. If the situation in Croatia gets settled, it will become part of the German control system. Serbia I wouldn't worry too much about. It's poor. They would be happy to see the thing settled, because it's dangerous. If the Serbs go into Kowsovo, and the Turks become involved, it could get really ugly, and nobody wants that. (The second part of this interview will be printed Jan. 18.) ml VISIT CAPTAIN WILLIAMS AT THE STUDENT STORES LOBBY FROM 10:00-2:00 P.M. ON FEBRUARY 22, 1993 OR CALL 1-800-722-6715 FOR MORE INFORMATION I i-iii ii i iiiii The East Carolinian February 16. 1993 Sports Page 11 Pirate baseball begins season by dropping two of three By Michael Albuquerque Staff Writer STATESBORO, Ga. � East Carolina opened its 1993 baseball season on Friday, Feb. 12, with a three-game weekend series against Georgia Southern, losing the opener 4-2 and splitting the final two games with an 8-4 win on Sat- urday and a 4-1 loss on Sunday. Pirate head coach Gary Overton sentstaff ace Johnny Beck to the mound for the opener, and although he lost, Beck pitched ef- fectively for ECU, recording five strike outs and allowing only four earned runs. "Johnny Beck threw very well Overton said. "I thought that it was one of his best outings. Johnny did a remarkable job against whatwe feel likeisoneof the better hitting clubs we'll see all year GSU center fielder Todd Greene, a pre-season All-America selection by Baseball America and Collegiate Baseball, broke a score- less tie in the fourth inning with a PITCHING:WLERA. G GSGGSHOsvIPHRERBBSOHRE Beck, Johnny013.8610007.07432520 Blackwell, Richie000.0000001.01000100 Hartgrove, Lyle104.1510008.71 1441710 Layton, Billy000.0000002.71001300 Mills, Jason000.0000001.01000100 Morsa, Stancll000.0000000.32000100 Sanburn, Mike018.3110004.38442100 File Photo Pirate baseball started over the weekend. The Bucs took one of three without the help of All-CAA outfielder Dave Leisten. solo home run to left field which gave the Eagles a 1-0 lead. 'Todd Greene is one heck of a college hitter and readily deserves to be one of the best in the nation Overton said. "He's a very tough out. He's an excellent hitter, and I think that just truly sums him up Georgia Southern added three more runs in the fifth inning, in- cludingan opposite field homer by freshman Mark Hamlin which Pi- See BASEBALL Page 14 Spiders bite Pirates, ladies lose momentum By Warren Sumner Assistant Sports Editor The ECU women's basketball team is discovering firsthand how difficult it is to sustain momentum. The Lady Pirates, after winning a barnburner against James Madi- son Friday night, fell 61-60 to Richmond on Sunday. The Pirates, stagnated by terrible shoot- ing, hit just 22 of 58 attempts at the goal and were able to score no three-pointers in the contest The Pirate backcourt connected for 32 points, but was unable to counteract the lack of productivity on the inside. Pirate center RhondaSmithonly managed toscore four points as she was virtually shut down by the strict Richmond defense. Smith went two-for-six from the field, and with the ex- ception of her rebounding, was notas much of a factor as in previous games. ThePiratescouldnotreturntheSpiders' favor, however, as Richmond battered the Pirates from the inside. The Spider forwards combined for 36 points including the career- high scoring performance of Diana Poulsen. Poulsen connected for 19 points, eight re- bounds and two assists and frustrated the Pirate defense by scoring bom from the in- sideand the perimeter. Foul troubleplagued PiratedefensivestandoutToina Coley asshe was charged with three first half violations and eventually fouled out of the game. The Pirates never fell any farther than five points behind the Spiders, and led by that margin early in the second half, but could not overcome their lack of inside scor- ing. Despite an exciting comeback attempt in the final minute, the day was to belong to the Richmond forwards. The Lady Pirates' record now stands at 4-5 in the CAA, 10-9 overall. ECU (60) Minftrb m-am-ao-tapfP Coley 294-61-22-3259 Cagle 00-12-30-0212 O'Donnell403-84-70-414210 Thurman 224-65-72-51413 Rodgerson 20-00-00-0000 Smith 302-60-03-7034 Baker 121-22-20-1014 Samuels 302-12W)1-1034 Blackmon 26692-85-100314 Totals 20022-5816-29 16-35 19 22 60 Percentages: FG - .999, Ft. 655, 3 pt. Goals: 10-28 - .357, Team Rebounds - 2, Blocked Shots - 9, Turnovers - 15, Steals - 7. Richmond(61) Minftrb m-am-ao-tapf�P Barnes353-112-20-1398 Barnes,L. 60-00-00-0110 Sipple408-121-22-60217 Poulson378-103-53-82319 Loos311-50-12-3343 Winn50-10-10-0120 McClure 40-02-20-101t Bartuska 222-62-42-8146 Babb112-22-31-1026 Noise10-00-00-0010 Nicosia50-0O-O0-0000 Totals200 24-4712-2012-32112261 TOTALS12 3.963 301025.031121 161930 WILD PITCHES: SANBURN1 HITTING:AVG.GABRH2B3BHRRBISBcsBBso0BP.SLG.TBSHSFE Borel, Jamie.3003102300010131.462.3003000 Clark, Heath.111390110000012.200.2222011 Cronan, Phil.600251300110021.7141.2006000 Edwards, Lamont.000130000000002.000.0000010 Fedak, Frank.3083132400000011.357.3084000 Harman, Grant.000110000000000.000.0000000 Head, Jason.000280000000002.000.0000000 Kushner, Lee.3333122410020012.385.4175000 Peters, Mike.000250000000013.167.0000002 Pitt, Steven.3083131410010005.308.385s000 Obholz, Kevin.000100000000001.000.0000000 Triplett, Chad.000100000000000.000.0000000 Watkins, Pat.300310I300141021.417.6006001 West, Chris.2313131320010012.286.38550 00 21 TOTALS.24331031125s0210111223.322.350365 HIT BY PITCH:SACRIFICEFLIES: Head 1, Clark 1Watkins1 Thompson's team holds off Dukes, 69-67 By Billy Weaver Percentages: FG - .510, Ft. 600, 3 pt. Goals: 1-5 - 700, Team Rebounds - 3, Blocked Shots - 0, Turnovers - 22, Steals -14. 1st half2nd half OTFinal ECU283260 Richmond313061 Staff Writer Coming off a four-game road stint, the Lady Pirates edged out fa- vored James Madison 69-67 in a thrill- ing game in Minges Coliseum Friday night. ECU went into Minges seeking revenge after a 60-53 loss to the Lady Dukes on Jan. 12. ECU leads the series 18-16 and is 8-5 against JMU at home. The Lady Dukes went into Friday nights game second in the CAA with a 5-2 conference record. With a 3-4 record, ECU issteadily climbing back into the running in the conference. ECU came out playing hard. The Lady Pirates took the early lead and never looked back. The Lady Pirates led by as much as eight points in the first half but could not finish off JMU who came back to cut the lead to three to make the score 35-32 at halftime. The Lady Pirates came out after the half with the same intensity until 11:54 left when JMU's Gail Shelly halted an ECU drive with a steal that led to the Lady Dukes' first lead of the game 46-44. In the second half, the lead would change hands several times but nei- ther team would give an inch. The Lady Dukes ran tough until 36 seconds left to play when ECU's Tomekia Blackmon scored under- neath to put the Lady Pirates up 67- 62. It seemed as though ECU would coast to an easy victory but JMU re- Senior divers lead ECU into CAA contention By Brent St. Pierre Staff Writer Go back into your library of sporting knowledge and fry to find the one sport that evokes terror when you see it and a sense of amazement when it is pulled off. I must remind you though, Super Dave Osborne is not considered an athlete; moreover, neither is Dale Earnhardt or Dick Trickle. So, what one sport gives the spectator that tingly sensation in the pit of their stomach? What one sport makes you ask; "How the hell did he do that?" Here is a hint: this sport is offered at ECU. No, it's not football, though I realize the same feelings and questions areasked and no, it's not basketball either which gives you an all together different tingly sensation;I think it iscalled nausea. What is this sport that comprises Michael Jordanesque talents you ask? Diving. Granted, diving probably was not the sport to come to mind; but, go back to the Olympics and try to recall the diving events. They were spectacu la r; the divers were doing things that seemed almost inhuman. And when their mortality was questioned, our perverted love for other people's pain would be answered with a thunderous "slap" as some poor German guy would screw up and do a belly-flop from six stories up. ECU has such ath- letes. ECU's diving team is headed by John Rose and manned by what he termed as, "the greatest ECU diving team from top to bottom that has ever been put together in the 12 years that I have been at the helm Rose said. ECU is led by three outstanding se- niors. Tara Rohland, Matt Lawerence and George Garbe. Together they ha ve the abil- ity to be the catalyst needed to earn ECU the CAA Swimming and Diving Champi- onships held in Wilmington next week. Individuallyeach of these threeaerial- acrobats are special, special in their ac- complishments, but more importantly, special in the heart of Head Coach John Rose. The men are led by Matt Lawerence and George Garbe. Rose is confident that both will be finalists at the Conference Championships. Rose's confidence is not unfounded. "Matt Lawerence is the best diver that 1 have ever coached in my twelve years at ECU. He has finished first or second in every meet for fou r yea rs and is one of the greatest kids that I have ever been fortunate enough to coach Rose said. As for Garbe, Rose has no lack of Lady Pirates come home after four road games fused to die. With 15 secondsleft, Gail Shelly hit a dramatic three-point shot that knot- ted the game at 67. The only thing JMU had to do now was to hold ECU's of- fense from scoring for the remaining 14 seconds which would send the game intoovertime.But,JMU'sChristinaLee made a critical mistake. She was called for her fifth foul which sent LaShonda Baker to the free-throw line. Baker showed poise at the line and sank both free throws to send the Lady Dukes back to Harrisonburg with a 5-3 record. The Lady Du kes, who are ranked no. 4 in the NCAA in field goal percentage (52.8 percent), finished Friday's game with a low 38.5 percent average. For the fourth straight week, Gaynor O' Donnell has led the na- tion in assists average. O'Donnell managed to reel off nine assists add- ing to her impressive school record of 707. Rhonda Smith who was seven for eight from the field led the Lady Pirates in scoring with 16 points. The Lady Pirates improved to 4- 4 in the conference and look for- ward to seeing JMU again in tour- nament play. iff- 'iMifflr 1 vs. RiGlffifSfil Mingftrb m-am-ao-taPfP Cagle 102-30-00-1224 0'Donnell391-13-51-4935 Thurman 274-72-41-40410 Rodgerson 40-02-20-0002 Sutton 30-01-20-0011 Smith 267-82-40-61416 Baker 363-73-40-2129 Samuels 326-102-21-34215 Blackmon 233-61-30-5127 Totals 20026-4216-26 3-27 18 20 69 Percentages: FG - .619, Ft. 615, 3 pt Goals: 1-3 - 333, Team Rebounds - 2, Blocked Shots -2, Turnovers - 22, Steals -11. James Madison(67) Minif.ftrb m-am-ao-taPf Lee 254-126-93-745 Powell 201-53-53-414 Hopkins 325-103-32-402 Shelly 394-13(M)3-633 Algeo 364-120-03-643 Ratliff 152-60-01-204 Woodson 335-73-44-813 dLek zOa The CAA tournament win be held at Old Dominion University March 11-13. p I 14 5 13 9 9 4 13 Totals 20025-6515-21 22-41 13 24 67 Percentages: PG - 385, Ft. 714,3 pt Goals: 2-6 - 333, Team Rebounds - 4, Blocked Shots - 0, Turnovers -17, Steals - 9. ECU JMU 1st half 35 32 2nd half OT 34 35 Final 69 67 praise either. "Since transferring from Radford, George has established himself as the most self-motivated and hardest working diver I have ever had. Last year he didn't even go to the Conference Cham- pionships due to injuries this year he is in position to become a finalist on both boards with Lawerence Rose said. The women are led by Tara Rohland. RohJand,afinalistlastyear on both boards, is prepared for a return visit. Rose is confident in Rohland's chances to return to the Conference promised land. "She is the second-best female diver that I have ever coached and perhaps the most dedi- cated, consistent hard workingdiver that I have ever had. She has finished first or second in every meet and will easily re- turn to the finalsat the Conference Cham- pionships Rose said. If it sounds as if Rose has a parental tone in his praise of the three seniors, it is true. There is a sense of compassion and love in the praise he gives Rohland, Lawerence and Garbe, and it is apparent thathe believes they will be successful this weekend in Wilmington. What should be a three-way dog race to the Championship crown may very well be settled on the boards. If confidence counts for anything then Roses' divers are well prepared to bringthe championship back toGreenville. Tara Rohland (left) is the hardest working and most dedicated diver Coach Johnny Rose said he has ever had. This years' diving team has enjoyed more success than most of ECU's other athletic teams. � ' t Photo by Dail Read � �� -72 The East Carolinian FEBRUARY 16, 1993 Charlotte's Bogues plays David to NBA's goliaths That's the CHARLOTTE (AP)�The cyn- ics may still laugh at Muggsy Bogues, butthey should know better after five years. Instead oflingeringasa 12th man with very little playing time because he's5-fcot-3,Boguesisstartingforthe Charlotte Hornets after a frustrating rookieyearwiththeWashingtonBul- lets.Hehasmaintained aplaoeamong the statistical lead- ersintheNBA,and Bogues also is provingthathehas Ultimate, knowing that you can be among the top guards in the league and you 're starting and you're being respected as a starter Muggsy Bogues dominated by big- ger men. "Ihafsthe ul- timate, knowing that you can be among the top guards in the Bague and you're Jlartingand you're being respected as a starter Bogues says. "If ssomething that I've always believed, that I am a starter The former Wake Forest star is working on leading the Hornets into the playoffs in their fifth year. It's a ldfty goal for a player whose hoop heroes as a youngster were not in the pios. "WhenIwasgrowingup,Ididn't wjatch the NBA that much Bogues s$ys. "I watched college some. I was mainly involved in my own sports, gOysaround theneighborhoocLIhad nfighborhood heroes. I didn't have NBA heroes because I couldn't really relate to them The NBA did have small guards then, but by Bogues' standards Nate 'Tiny" Archibald was a monster of a guard at 6-foot-l. There was Calvin Murphy and Charlie Crist, also of the era where being a point guard didn't necessarily require the build of a frontcourt player. IfBogueshad an idol,itwassome- body he could look in the eye � al- most "A guy named Dwayne Woods. He went to Dunbar High School says Bogues, who led the school's 1983 team to an un- beatenseason. "Hewas only 5-5 I wasn't pat- terning my game be- hind him, butl learned sornetiungsfromhirn' With his neigh- bors tel ling him to for- getproball,Boguesput his athletic life in per- spective and made college his next challenge. He took the wisdom he gained from Woods to Winston-Sa- lem, where he became an all-Atlantic Coast Conference performer and less of a novelty. But Wake Forest ta ughthim more than basketball, he says, adding that the school was the best thing that ever happened to him. "It was a challenge for me to go there asa student-athlete he says. "It was tough, but I fought my way through it" The fight was just beginning. Bogues was a first-round pick of the Bullets in the 1987 draft and the 12th selection overall. He played in 79 gamesand handed out404assists while scoring a modest 5 points per game. But Bogues watched thecoaching staff change the offense around him to a more deliberate style. It took him away from histypeof gameand caused Bogues tovvonder if thecoacheswould stick with him. "I think the coaching staff was more ca ught up in what was happen- ing aioundtheleague,andIthink they started second-guessing themselves aboutthedetisionthattheymadehe says. 'They got caught up in listening to other people It was nice to be near his home of Baltimore, Bogues said, but the situa- tion was "uncomfortable "I was unhappy, I wasn't playing like I though 11 should have been play- ing he says. "It wasn't a good situa- tion Bogues feels he didn'tget the shot he deserved. "They just gave up on me too quick he says. "For them to give up on a number one pick that early, it was kind of unusual When time came for Charlotte to pick from theexpansion pool, the team took a chance on Bogues. Still, in his firstyear with his new team, he had to prove he belonged. T had another coach who didn't believe in me,butl wasdoing so many positive things out on the floor that there was no way he could stop play- ingmehesaysIwasthatimportant to the team mat he had to play me DickHarterwasthecoach.Aftera season and a half he was gone. Bogues went from a bit player to a key per- former, raising his assists from 620 to 867 from his first year in Charlotte to his second, which was under Gene Littles. Last season Bogues was fourth in theNBAin assists and eighth in steals. He put on his best basketball toward theclose of 1991-92, when theHomets were flirting with a playoff spot Thisyear,Charlotteisexpected to close the deal on a playoff berth. With Larry Johnson,KendallGill and Alonzo Mourning, the Hornets were picked before the season started to be among the eight teams in the Eastern Confer- ence to fight for the crown. His peers are convinced Bogues can do the job. Tfsa good thing he's that short Seattle guard and former North Caro- lina State star Nate McMillan says. "I can't imagine how good he'd be at 6 foot But his shortness makes him so hard to guard and also makes him seem even faster Milwaukee guard Eric Murdock got 14 points on Bogues in a recent meeting, but he developed a healthy respect for his opponent "By far he's the toughest Murdock said when asked who was. the toughest guard to bring up the ball. against "You know he's soquick. But just when you get by him and think you're free, he's coming again to get you. He's easily the toughest Autoclave Sterilization New Needles Each Client Fine & Bold Line Custom Cover-ups Sobriety Required 919-756-0600 CCCVLj 5, 'Custom Jaikooinq by (fyavm �fattoo cbuudi LO 516 A Hwy264A Greenville, NC "Greenville's ONLY Exotic Nightclub- Adult Entertainment jf Center MONDAYS Football Sports Night TUESDAYS Silver Bullet's Female "Exotic" Dancers WEDNESDAYS Amateur Night for Female Dancers 11 pm-1 am CASH PRIZE 00jj 'Comestontt need to cull & register in advance. Must arrive by 8.O0. W09�&tPtf THURSDAYS -SATURDAYS Silver Bullet's Female "Exotic" Dancers We do Birthdays, Bachelor Parties, Bridal Showers, Corporate Parties & Divorces ECU STUDENT SPECIAL $2.00 OFF Admission Any Night with this coupon Doors Open 7:30pm Stage Time 9:00pm EsB Call 756-6278 i 5 miles west of Greenville on 264 Alt (behind John's Convenient Marl) ValidN.C. ID. Required ram . �KHih1 Is your love-life a frustration?? Find out how to improve it 8 PM Thursday, Feb. 18 Mendenhall Room 244 Sponsored by Campus Crusade for Christ and Athletes in Action. m -�� d STUDENT UNION HAPPENINGS MOVIES I 8 PM HENDRIX THEATRE PACINO LEMMON BALDWIN HARRIS ARKIN GLENGARRY GLEN ROSS BASED ON THE PULITZER PRIZE WINNER GLENGARRY GLEN ROSS WED.& SUN, FEB 17 & 21 PASSENGER 57 THUR, FRI, & SAT, FEB 1 8, 19, & 20 . FORUM I THE FUTURE OF i��- EASTERN NORTH CAROLINA CS ?J�w DEVELOPMENT AT WHAT COST? �2�M1X1 THE ATTIC SOCIETY REVISITED TUES, FEB 16,8 PM MENDENHALL GREAT ROOM MINORITY ARTS I AUTHOR, AUTHOR & FORUM CO-SPONSORED WITH DEPARTMENT OF ENGLISH & GRADUATE ENGLISH COLLOQUIUM an evening with EDDY HARRIS WED, FEB 17, 8 PM MENDENHALL GREAT ROOM Books will be available for sale through ECU Student Stores VISUAL ARTS ILLUMINA '93 STUDENT ART COMPETITION CALL FOR ENTRIES FRI, FEB 19 1-8 PM MENDENHALL ROOM 244 ENTRY FORMS AT MSC INFO DESK CALL 757-47 5 FOR MORE INFO For More Info Call The University Unions Program Hotline at 757-6004 When is it too late to say "NO" to sex? What is it to be T" masculine? How do you deal with feelings of jealousy in a relationship? What is it V to be feminine? Healthy Relationship Week 1993 "PURPLE & GOLD PASSIONS" What personal qualities are you looking for in a date? What personal qualities are you looking for in a relationships? "PURPLE AND GOLD PASSIONS" will give the ECU campus community the opportunity to express opinions about dating and relationships - the frustrations and rewards! Tell all your passions on "The Wall" at the ECU Student Store on FEBRUARY 15TH AND 16TH from 10:00 until 2:00. Also stop by the "LOVE SHACK" sponsored by the ECU Peer Health Educators and obtain information on sexually transmitted diseases and contraceptive options. THEN ON TUESDAY, FEBRUARY 16TH AT 7:00pm, Mendenhall Student Center, Room 244 Have you ever wanted to participate in a talk show like Oprah or Donahue? Now is your chance to attend The Joe Boehman Show in which a panel of experts will discuss PURPLE AND GOLD PASSION: How ECU students feel about sex, lies, and disease in the 1990s. ALL STUDENTS ARE WELCOME AND ADMISSION IS FREE. i February 16, 1993 The East Carolinian Fab five still wet behind ears 13 BLOOMINGTON, Ind. (AP) � There's a long way to go in the Big Ten season and no one has conceded the conference titie to Indiana. On the other hand, Michigan's run at the league championship is just about over. "We're probably not going to win the Big Ten title. It would take a major miracle Michigan coach Steve Fisher said Sunday as his team fell three games out with seven to play after losing 93-92 to top-ranked Indiana, the team in first place. The loss may have hurt the fifth-ranked Wolverines' record, but it didn't dampen their confi- dence as the NCAA tournament still looms on next month's hori- zon. "PmnotbelittlingtheBigTen ring at all, but I think all of us knows which ring is more impor- tant Michigan's Chris Webber said. Indiana (22-2,11-0) has to be one of the favorites for both pieces of championship jewelry. The win was the 11 th in a row for the Hoo- siersand it was their 27th straight at home, the longest such streak in the nation. Both streaks remained intact because the Hoosiers wereable to overcome a 13-point deficit in the first half and one of nine points in the second half. "Last year, the year before, we would have just given up on a game like this said Indiana's Calbert Cheaney, who had 20 points and 9 rebounds. "Today, we dug in and told each other 'Let's go'and we did it Indiana's tough defense held Michigan (19-4, 8-3) without a field for 6 12 minutes. Michigan took its final lead at 78-76 on two free throws by Jalen Rose with 6:01 left. Indiana scored the next 13pointsand a last-minute3-point barrage by Webber made it seem a lot closer than it was. "When we took the lead, I thought our defense was pretty good Indiana coach Bob Knight said. He thought the crucial point came quite a bit earlier. "The first point 1 want to make, and it is possibly the most important point of all, was that we were able to leave the floor at halftime just down two points he said. "It nearly got away from us again, but we did a really good job of hanging in there and our guys off the bench really contrib- uted The lead contributor off the bench was freshman Brian Evans, who finished with a season-high 17 points including a 3-for-6 ef- fort from 3-point range where he had only made eight shots all sea- son. Matt Nover had 20 points for Indiana and his 8 rebounds were a big part of the Hoosiers' 38-30 advantage, 20-10 on the offensive end. Webber finished with 23 points, 11 rebounds and 6 assists, but was just 4 for 11 from the foul line. He had three 3-pointers in the final 54 seconds as the Wol- verines, who shot 58 percent from the field, finished 12 for 22 from long range. In other games Sunday, No. 3 North Carolina beat Georgia Teach 77-66 and Louisville de- feated No. 15 UNLV 90-86. U. of Iowa still recovering IOWA CITY, Iowa (AP) � Nearly all theteammatesChrisStreet left behind came to this comer of basketball heaven for the same rea- sons he did and from the same kind of small Midwestern towns that he did. Maybe that's what made it so strange to go on without him. Four weeks ago today, Street was killed in an auto accident after leaving a team d inner and trying to ease hiscar onto Highway 1. He was heading back to campus for a night class. He was 20 years old. In some ways, the story that began unfolding here three weeks ago is similar to the emotional run that Loyola Marymount made in the 1990 NCAA tournament after thedeathofstarforward Hank Gath- ers. Davis notes many of the same things that happened then happen- ing to his kids now. They focus bet- ter at some times, but wander at others; they need little motivation, but they get wound up too easily; they never fail to lay a body on every body that rumbles down the lane, but sometime the play is just plain ragged. In the week that followed Street's death, school officials post- poned two games toallow a proper mourning period. Something unex- pectedlv sweet happened: The Hawkeyes climbed three spots in the poll, ending it at No. 11. The next week proved even sweeter. First, Street's teammates madt'upal7-pointdeficitin the last 530 to beat Michigan State on the road. Then they closed out at No. 9 after beating powerful Michi- gan at home and presenting the game ball to Street's parents at courtside. An hour after their loss to In- diana, Davis lingered in the hall- way of Carver-Hawkeye Arena to talk about what would come next. "I really don't have any idea he said, "but I don't have any doubts we'll get through it fine. There's no schedule for this. I've let the players guide me through it so far and they've been terrific The ECU Student Union Visual Arts Committee Presents ILLUMINA '93 February 22-March 5 Reception Wednesday, Febbruary 24, 7:00-8:00 p m Mendenhall Student Center Art Gallery Call for Entries Friday, February 19 1:00 - 8:00 p.m. MSC Room 244 Entry Forms Available at the MSC Information Desk For more information call 757-4715 Cash Prizes Totalling $700 Will Be Awarded Top twenty-Five The Top Twenty Five teams in The Associated Press'college basketball poll, with first-place votes in parentheses, records through Feb. 14, total points based on 25 points for a first- place vote through one point for a 25th-place vote and previous ranking (ACC teams in bold): Record Pts Pvs 1. Indiana (59) 22-2 1,521 1 2. Kentucky 18-2 1,351 2 3. N.Carolina 20-3 1,348 6 4. Arizona (1) 17-2 1305 5 5. Michigan 191 1,281 4 6. Kansas 20-3 1,275 7 7. Duke 19-4 8. Cincinnati 19-2 9. Florida St 19-6 10. Wake Forest 16-4 11. Vanderbilt 19-4 12. Utah 19-3 13. Arkansas 16-5 14. Purdue 15-5 15. UNLV 16-3 16. Seton Hall 18-6 17. Pittsburgh 15-5 18. Tulane 17-4 19. UMass 17-4 20. Iowa 14-6 21. New Orleans 18-2 22. Louisville 14-6 23. Virginia 15-5 1,132 1,114 1,064 1,029 929 724 695 565 558 538 529 467 455 396 278 226 197 3 8 10 9 11 16 14 18 12 19 17 20 22 13 25 24 24. Marquette 25. St. John's 17-4 14-6 178 15 172 � Other receiving votes: Brigham Young 86, Oklahoma 64, Xavier, Ohio 52, Illinois 47, Memphis St. 47, Oklahoma St 29, Nebraska 25, Boston Col- lege 22, Georgia Tech 20, New Mexico St. 19, Michigan St. 17, Minnesota 10, New Mexico 9, Syracuse 9, Southern Meth. 8, George Washington 7, LSU 6, W. Kentucky 6, Miami, Ohio 3, Rice 3, Wisconsin 3, Kansas St. 2, Alabama 1, Manhattan 1, NE Louisiana 1, Washington St. 1. Jason Tremblay has been named sports writer of the week. Hooray for the "Endowed Cine" (he's a wonderful writer). Writer's meeting @ 4:30, Thursc INTERVARSITY CHRISTIAN FELLOWSHIP Every Wednesday Night at 7:00 RM in 244 Mendenhall Enjoy the tun with shits. music and guest speahers! EVERYONE IS WELCOME WHERE WILL YOU BE IN 93? Will you be doing the same old thing, or do you want a new challenge? If so, you're looking in the right place! The U.S. Coast Guard, the nation's smallest armed service, can offer you: Law Enforcement Search & Rescue Engineering Accounting Computer Science Health Care Management Aviation Environmental Protection Ship & Boat Handling Positions are available in these and other specialties, at various levels in the organization, for individuals between the ages of 17-27 with a High School Diploma or College Degree. Our excellent benefit package includes: �30 Days Paid Vacation �Full Medical & Dental CAre �Undergraduate & Postgraduate Training Opportunities Will You Take The Challenge? If you are interested in taking the OAR Exam (Officer Aptitude Rating Exam) to see if you qualify to become an officer in the United States Coast Guard, Contact your local recmiting office at: U.S. COAST GUARD RECRUITING OFFICE 3480 SUNSET AVENUE ROCKY MOUNT, NC 27804 (919) 443-7476 CALL COLLECT The Coast Guard is committed to equal opportunity. Minorities and women are encouraged to apply. 14 The East Carolinian February 16, 1993 baseball Slamf est to be held Wednesday at Grand Slam Continued from page 12 rate right fielder Pat Watkins al- most pulled down with a leaping effort. ECU had difficulty getting to GSU starter Jim Carragher, a left- handed finesse pitcher,until late in the game when the Eagles had a 4- Olead. After manufacturing a run in the sixth, the Pirates had their best opportunity to mount a comeback in the eighth inning with succes- sive two-out doublesby Chris West and Lee Kushner,cutting the Eagles lead to 4-2. However, GSU left fielder threw out Kushman at the plate as he tried to score on Steven Pitt's single to left. "Theonly thing in the matter is that it's a game that could have been won Overton said. "It'scer- tainly not a game that should have been won but one that could have been won On Saturday, Feb. 13, ECU starter Lyle Hartgrove pitched a strong eight and two-third innings, and the Pirateshad no trouble with Eagle left)' Ron Buffington, a pre- season All-SouthemConference se- lection who was 8-1 last year. Steven Pitt led off the second inning with a double to right field, and one out later Pat Watkins hit a two-run blast to right-center field to give ECU an early 2-0 lead. The Pirates struck again in the fifth inning with five singles and a sacrifice fly to produce three more runs, and Jamie Borel scored an- other run in the sixth to give ECU a 6-0 lead. Both innings were keyed by beautifully executed hit-and-run plays by Borel on the bases and second baseman Frank Fedak with the bat. Phil Cronan, who filled in for injured catcher Mike Peters, led off the seventh with a home run to right field, and Watkins scored an- other run to give the Pirates a com- manding 8-0 lead. Greene finally put the Eagles on the board with a two-run double in the eight and a two-run homer to deep center field in the ninth before Pirate closer Stand 1 Morsecameon to get the final out in the ninth. The final game of the series on Sunday, Feb. 14, looked like a re- peat of game one as another Eagle lefthander, sophomore pitcher Clint Fair, blanked the Pirate hit- ters with an outstanding perfor- mance until he left after seven in- nings with a two-hitter and seven strikeouts. The Pirates mounted a two- out rally in the ninth inning with consecutivesinglesbyKushnerand Pitt before Eagle head coach Jack Stallings brought in closer Paul Thorton, a senior transfer from Florida Community College who was 9-2 with 12 saves and a 2.01 ERA last year. However, Thorton, who hits 92 mphon theradargun,struggled with his control and walked the first two batters he faced before Jason Head flied out to deep left field to end the game. The Pirates next game will be at2 p.m. on Wednesday, Feb. 17,at Campbell followed by the home openerat Bunting Field at3 p.m. on Friday, Feb. 19, against UNC. By Thad Peoples Recreational Services Asa prelude to All-Star Week end, ECU will show of it's own great athletes in Slamfest. The Recreational Services De- partment of Intramural Sports will be holding a Basketball Slam Dunk Contest Wednesday, Feb. 17, at Grand Slam USA, located at 100E.14thStreet. There willbean eight-foot rim division for all fe- male participants and male par- ticipants that are 5 feet 9 i nches or under, a nine-foot rim division will be held for participants un- der 6 feet 2 inches and a 10-foot rim division will be open for all players. An information meeting will be held at 5 p.m. on the afternoon of the event in Biology Building Room 103 for anyone interested in participating. Contestants may register for the event at Grand Slam 15 minutes before the start of your division. The eight and nine-foot divisions will be held from 7:45 to 8:45 p.m. and the 10- foot division will be from u to 10 p.m. Rules of the NBA Slam Dunk competition will be in effect. Each participant will attempt two dunks in the first and second rounds and three in the third round. The lowest third round score will be dropped. Contes- tants will beallowed tosubstitute one missed dunk in each round. There will be a score of 1.0 to 10.0 given toeach mii cessfuldunk.The dunks will be judged on style, creativity, and displayed athletic ability. Each round is scored sepa- rately. The four participants with the highest scores after each round will advance. If there isa tie, there willbeaSuddenDunkwhereeach participant will get an additional dunk to break the tie. No props will be permitted in any round. However, more than one basket- ball may be used. Your reputation is on the line. The opportunitv to soar through theairand pound the ball into the rim should get you off of your couch and into Grand Slam on Wednesdaynight.lfnot to partici- pate, merely just to see the show. This is your opportunity to show evervone what you are made of. When you finish your copy of The East Carolinian, be sure to recycle it, and then tell a friend to recycle their copy as well. UBE Says 'Thanks' To Students and Fans With Spectacular Savings You'll Treasure Russell Sweatshirts Reg. '13.95 AH sizes up to XXL. Great selection of colors. 50Offl30Off Large Selection Of ECU T-Shirts 40 Of � "Zubaz" Shorts & Pants Russell Cotton Shorts $J50 Regularly $7 9S 25 Off Any Regular Priced Stuffed Animal 400ff All Dinosaurs Selected Backpacks 20 0�� Baseball Shirts Selected Youth Sweats $�?00 All Calendars 50 Off $5�� Any Greek Vertical Lavalier Regularly 24.45 Selected I Portal Posters 12 Price 50 Off Greek Handled Mugs JAll Nylon Jackets Adults & Youth i Russell Hoods Regular U6.95 Assorted Colors. 300ff Selection "ECU" Sportshirts 20 Off 3'x5' ECU Flags 20 Off "Portal" T-Shirts 5 Subject Composition Book $2� Originally '4.25 95 Greek Hats iw $00 �0ff Selected "Champion" Reverse Weaves, Classic Crews, Tee Shirts & Shorts Russell Zips $1450 Regular '20.95 Assorted colors. 8-400R Selection "ECU Caps" FREE Champion� Turtleneck With Any Regular Priced Champion� Sweatshirt Purchase Yard Sale Table Russell ECU Hoods $S"0ff Now16.95 Werc'2l.95j 200�� U Greek" Jerseys 2040 OK Framed And Unframed Prints At University Frame Shop Save Up To On Selected Merchandise Selected Paperback Novels �c $100 To FREE 6 Packs Of Pirate Pride Whilr SUfptiM lsl No �urch�e Nciessary 50 Off Selected Art 8c Backdrop Papers 250f� Select Jewelry & Pottery At University Frame Shop 40 Off Selected Art Supplies Sale Thru Saturday, February aoth iiiiiftri ii mMi inii! iMi'iWii Guardian by Jeff Grubbs 7U� FREE 2LONE- A Ptce. or growth PROSPERITY, anO S�LFI5M PBggLg; I CAN'T BELIEVE SI MY BEST FMEND- K1 YESTERDAY. KILLED FROM THE CRIME U ,TY S OUNE- �LED JUST 1Y A HIT I, GARRISON. HOVT WHY" PIP GARRISON FIND OUT THAT STACEY WAS HY INFORMANT DSD HF REALIZE THAT SHE WAS INVESTIGATING TH" PISAPPEARANOEi; OF PB3PLC IN THE QUARANTINED ZONE' I CHESS, IT'S UP TO ME TO KIND TW; ANSWERS SINCE THE AUTHORITIES WON'T ENTER THE Q.X. WHAT HAS THE world a me to i thought THE RACE WAR WAS HAD Hi: � if .Tit' AS A MEMBER (If THE SPECIAL FORCES TEAM "GUARDIAN I mitti TO attain PttCB DtSt EK H9 1VIL WAR. I SAW THE HATRED CM tnri sides. NCW PEOPLE DON'T CARE AT ALL: I DON'T KNOW WHICH Efl NDM . reds Corner By Sean Parnell 3f life ij i HA The World of Ghannon and Elvis by Whiteley and Brown CCC3 GEE HONEY, AREN'T H THE WHALES SUCH JEACBFUL CREATURES? 24, Phoebe by Stephanie Smith THESE VITAMINS will TAP INTO ThEI IDLE AREAS OP THE BRAIN AND IN- CREASE AWARENESS SEE THE PRETTY I PICTURE OF EINSTEIN ON THE: I LABfcL 1 AND THESE WIU REvE5Ej ' THE AGING PROCESS. ALL FOR ONLY ZO DOLLARS ' I M SO GLAD YOU DECIDED TO PURCHASE THESE WONDERS OF ANCIENT MEDICINE. IVE USED THEm ALL MY LIFE AND LOOK PCX ME ' I DON'T LOOK A DAY OVER. THIRTY; I AGED WELL AND r FEEL GRE SO. HOW OLD ARE YOU,0 WIS� ONE' WANG TV Pagliacci SCetOUP!?bJl'IZB firr "me BOTTOM OF �XACRVDllHeDO by Ferguson and Manning ), WV! at nk iPO IH GOtKG 7& A . CiCVCDrfftfleHCE lr) vWPgNlttiffsR fHC , w�E�Md. vjW � ,M by Mark Brett HSU JH"r ?! etPcri'�0 3) so�e���f� gpwsm . seo cboi? nuct� tPflJTH'is'ytr (joTvf v. Www tfpeHoo BmHmG- Uwr Rich's Nuthouse pUVtf3, ' IT9. vatwtt t4f�& ENOLMU4. i i �J' J : ARE YOU READY FOR YOUR LIFESTYLE CONDOM? The disease of AIDS has reo bed epidemic proportions; researchers and experts state that within the. generation every person in the country will know at least one person who has AIDS. The implications of this prediction are staggering; AIDS is not fust something a person can disregard. Tins disease has brought the issue of safer sex to the forefront of our society, forcing people to think about subjects that otherwise they would drop as uncomfortable. The purpose of this four-part safer sex campaign is simply put � to save lives. The East Carolinian wt in any way promoting sex; what we are promoting is even' student's knowledge of their choice between abstinence and safer sex. Only through information, knowledge and common sense t an a person make this choice, one of the most important decisions heshe will make in hisher life. The last part of this "safer sex campaign" ties all three previous parts into one neat bundle�how to choose a condom. Hopefully, a couple now knows all the facts and risks that are being taken when they decide to engage in intercourse. AIDS has made it a necessity to use a condom whenever engaging in sex. Knowing how to buy condoms, how to use them and how to communicate with a partner about condoms are three essentials parts of the sexual experience. Safety is paramount here � being assured that you are at the least risk possible will eliminate a lot of fear and confusion. The Past Carolinian thanks the students who modeled for this campaign. llfeSfyle (llf-stID n 1. a way of life or style of living that reflects the attitudes and values of an individual or group. Communication is an integral part of the process of sexual intercourse. Intercourse is not just confined to the physical act alone; it encompasses the act, the foreplay and the discussion before and after the act between mutually consenting partners. A person may know all the facts and figures behind AIDS and STDs, but if heshe does not feel comfortable enough discussing them with a partner, they lose their purpose. Agree on how to use andor purchase a condom before having sex. The risk, lethal as it is, is just too great not to take the time beforehand to discuss all the issues. Most people feel uncomfortable when talking about sex or discussing the possibilities of sexually transmitted dis- eases. Concerns range from feelings of inadequacy to feelings of confusion, All of these problems and fears are valid; however, one must overcome them to protect hisher health and life. The first step in improving communication on sex and condoms is to know all the facts. The more you know, the easier it will be to discuss it out in the open. The more you know, the more determined you'll be to engage in safer sex. Next, plan what you want to say. Know all the questions you have and try to anticipate all the questions your partner may have. Decide when to bring the subject up; a quiet time may be better than before having sex. There are many and various reasons a partner can come up with if heshe does not want to use a condom. Knowing exactly how you feel about sex will help to alleviate some confusion; these situations may help with any additional problems. ? "I'm a virgin � "I'm not. This way we'll both be protected T "You carry a condom around with you? You were planning to seduce me � "I always carry one with me because I care about myself. I have one with me tonight because I care about us both ? "It destroys the romantic atmosphere � "It doesn't have to be that way ? "I'll lose my erection by the time I stop and put it on � "I'll help you put it on, that'll help you keep it These examples are, by no means, all of the scenarios a person might find hisherself in. If a person does not care enough about hisher partner to take the time to communi- cate, a problem exists. Sexual intercourse is between two consenting adul s � only when all parts o! this exist can safety be totally ensured. Buying condoms can be one of the most important choices a person can make after deciding to have sex. The size of a condom, the proper way to put a condom on and the proper way to take the condom off are all essential to know before using a condom. Some do's and don'ts follow: On buying, condoms: ? Do check expiration date on outer package. ? Do check name of lubricant. Nonoxynol-9 is the most recommended and provides a chemical barrier against sexu- ally transmitted diseases. ? Do use a water-based lubricant. ? Do store in a cool dry place. ? Do carry a condom with you at all times, either FDA- approved American or Japanese. ? Don't buy condoms made of any material other than latex, which prevents passage of harmful germs. T Don't buy outdated condoms. ? Don't store condoms in hot areas, like a glove compart- ment, as heat can damage a condom. ? Don't carry a condom in a hip wallet for long periods of time � this shortens the life of a condom. Condoms can be bought in various sizes. Condom manu- facturers usually indicate larger sized condoms by names such as "Beyond Seven "Mentor" or "Magnum Smaller sized condoms may be labelled under the phrase "a snugger tit All sizes aside, this does not mean a man must have a larger penis to satisfy his sexual partner. On putting a condom on: ? Do roll condom down on penis as soon as it is erect, before any contact with genitalia occurs. T Do leave 14-12 inch extra space at the tip of a condom if the condom has no nipple. ? Don't unroll condom before putting it on; roll it on all the way toward the base of the penis. ? Don't twist, bite, or prick a condom with a pin � this will damage the condom and may allow fluid to leak out, which may infect a partner. On taking off a condom: ? Do remove condom soon after ejaculation, ? Don't let the penis go soft inside partner. This could allow the condom to drop off, with fluids being leaked out. ? Don't tug to pull a condom off � this may cause the condom to tear. Mutual consent between sexual partners is a necessary ingredient before any of these factors can be considered. Communication is a must in any relationship in order to ensure the prevention of sexually transmitted diseases. ARE YOU READY TO Ml ARE YOU READY TO BECOME A TATISTIC? ARE YOU READY TO DISCRIMINATE? ARE YOU READY F REDEEM THIS COUPON FOR A QlkA LifeStyles CONDOM? : iXs? FREE PACKET OF LifeStyles CONDOMS CAROLINIAN I I I I I I Today only, between 10am and 2pm at The East Carolinian booth located outside of the Student Stores. ! � 'Limited quantities available While condoms redut e the risl oj onta, ting HIV and oth, - S TDs, the risks arc not entirely minuted. Abstinence is the only 100 effect � ; i m vent mmmwmmmwmwmwmwmwmmmmtWBZMwm m HIV and s 1 Di
 local, filename 58367.0001 53582084 image/tiff 6.0 PRONOM PUID: fmt/10 little endian uncompressed MD5 786d45d5dd5556a583648514ad2cc2e6 ecu:digital_collections 6984 7672 Grayscale BlackIsZero mm mm 20150619 object plane in. 300 1 300 1 8 integer 1 internal local, filename 58367.0002 53347844 image/tiff 6.0 PRONOM PUID: fmt/10 little endian uncompressed MD5 1acbdd469f8697b07ef81d074613bf10 ecu:digital_collections 6968 7656 Grayscale BlackIsZero mm mm 20150619 object plane in. 300 1 300 1 8 integer 1 internal local, filename 58367.0003 52109044 image/tiff 6.0 PRONOM PUID: fmt/10 little endian uncompressed MD5 6adb15cd02dc343e5abe95b635425428 ecu:digital_collections 6792 7672 Grayscale BlackIsZero mm mm 20150619 object plane in. 300 1 300 1 8 integer 1 internal local, filename 58367.0004 53459332 image/tiff 6.0 PRONOM PUID: fmt/10 little endian uncompressed MD5 041a1308662c71e733c65679a6897607 ecu:digital_collections 6968 7672 Grayscale BlackIsZero mm mm 20150619 object plane in. 300 1 300 1 8 integer 1 internal local, filename 58367.0005 53582084 image/tiff 6.0 PRONOM PUID: fmt/10 little endian uncompressed MD5 8606e2eec2e26bb1a2dfc1d25bfe5861 ecu:digital_collections 6984 7672 Grayscale BlackIsZero mm mm 20150619 object plane in. 300 1 300 1 8 integer 1 internal local, filename 58367.0006 53459332 image/tiff 6.0 PRONOM PUID: fmt/10 little endian uncompressed MD5 0c8eb59c253513255f3154327380df5a ecu:digital_collections 6968 7672 Grayscale BlackIsZero mm mm 20150619 object plane in. 300 1 300 1 8 integer 1 internal local, filename 58367.0007 53459332 image/tiff 6.0 PRONOM PUID: fmt/10 little endian uncompressed MD5 dff0ff6dd64e777c21cded8dfbc7595d ecu:digital_collections 6968 7672 Grayscale BlackIsZero mm mm 20150619 object plane in. 300 1 300 1 8 integer 1 internal local, filename 58367.0008 53582084 image/tiff 6.0 PRONOM PUID: fmt/10 little endian uncompressed MD5 5c6fffda83c9c1b5ab77f73a97cfefbf ecu:digital_collections 6984 7672 Grayscale BlackIsZero mm mm 20150619 object plane in. 300 1 300 1 8 integer 1 internal local, filename 58367.0009 53470340 image/tiff 6.0 PRONOM PUID: fmt/10 little endian uncompressed MD5 54e7d4dbc8d1741eb1e58647f307ed83 ecu:digital_collections 6984 7656 Grayscale BlackIsZero mm mm 20150619 object plane in. 300 1 300 1 8 integer 1 internal local, filename 58367.00010 53347844 image/tiff 6.0 PRONOM PUID: fmt/10 little endian uncompressed MD5 2b2a1503e14c4f7b58354e2425024b83 ecu:digital_collections 6968 7656 Grayscale BlackIsZero mm mm 20150619 object plane in. 300 1 300 1 8 integer 1 internal local, filename 58367.0011 53347844 image/tiff 6.0 PRONOM PUID: fmt/10 little endian uncompressed MD5 5efd1399eca46b2f2e59b2871a065340 ecu:digital_collections 6968 7656 Grayscale BlackIsZero mm mm 20150619 object plane in. 300 1 300 1 8 integer 1 internal local, filename 58367.0012 53347844 image/tiff 6.0 PRONOM PUID: fmt/10 little endian uncompressed MD5 01fc0a7887fd1e327dc2de276be2bb59 ecu:digital_collections 6968 7656 Grayscale BlackIsZero mm mm 20150619 object plane in. 300 1 300 1 8 integer 1 internal local, filename 58367.0013 53582084 image/tiff 6.0 PRONOM PUID: fmt/10 little endian uncompressed MD5 ff1802dce4d5be60251a0f1522629eba ecu:digital_collections 6984 7672 Grayscale BlackIsZero mm mm 20150619 object plane in. 300 1 300 1 8 integer 1 internal local, filename 58367.0014 53582084 image/tiff 6.0 PRONOM PUID: fmt/10 little endian uncompressed MD5 f680890f7cc952c522c6670f24235c29 ecu:digital_collections 6984 7672 Grayscale BlackIsZero mm mm 20150619 object plane in. 300 1 300 1 8 integer 1 internal local, filename 58367.0015 53470340 image/tiff 6.0 PRONOM PUID: fmt/10 little endian uncompressed MD5 282cb44641179a3762add11e821ac86d ecu:digital_collections 6984 7656 Grayscale BlackIsZero mm mm 20150619 object plane in. 300 1 300 1 8 integer 1 internal local, filename 58367.0016 53459332 image/tiff 6.0 PRONOM PUID: fmt/10 little endian uncompressed MD5 efda00c40c19a94dbde66895973abdb4 ecu:digital_collections 6968 7672 Grayscale BlackIsZero mm mm 20150619 object plane in. 300 1 300 1 8 integer 1 internal